
Sample records for actinium 208

  1. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    International Nuclear Information System (INIS)

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  2. The sorption of polonium, actinium and protactinium onto geological materials

    International Nuclear Information System (INIS)

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  3. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  4. Spectroscopic and computational investigation of actinium coordination chemistry. (United States)

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J


    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  5. Discovery of the actinium, thorium, protactinium, and uranium isotopes


    Fry, C; Thoennessen, M


    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  6. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources. (United States)

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R


    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  7. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    International Nuclear Information System (INIS)

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  8. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    International Nuclear Information System (INIS)

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  9. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John


    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  10. Comment: 208 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Anopheles stephensi Anopheles stephensi Anopheles_stephensi_L.png 208.png Public Do...main CDC(Centers for Disease Control and Prevention)のimage libraryから(Public Domain) bando 2010/02/15 14:45:35 2010/02/15 14:48:55 ...

  11. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    International Nuclear Information System (INIS)

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  12. A new method for the determination of low-level actinium-227 in geological samples

    International Nuclear Information System (INIS)

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  13. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Energy Technology Data Exchange (ETDEWEB)

    Momeni, M.H.


    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  14. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    International Nuclear Information System (INIS)

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  15. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    International Nuclear Information System (INIS)

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  16. 12 CFR 208.4 - Capital adequacy. (United States)


    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Capital adequacy. 208.4 Section 208.4 Banks and... Requirements § 208.4 Capital adequacy. (a) Adequacy. A member bank's capital, as defined in appendix A to this... light of all the circumstances, the bank's capital appears inadequate in relation to its...

  17. 40 CFR 240.208-1 - Requirement. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirement. 240.208-1 Section 240.208-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.208-1...

  18. 24 CFR 208.112 - Cost. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cost. 208.112 Section 208.112... MULTIFAMILY SUBSIDIZED PROJECTS § 208.112 Cost. (a) The costs of the electronic transmission of the correctly... cost of contracting for those services, or the cost of centralizing the electronic...

  19. 40 CFR 240.208 - Residue. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Residue. 240.208 Section 240.208 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.208 Residue....

  20. 23 CFR 633.208 - Maintenance. (United States)


    ... 23 Highways 1 2010-04-01 2010-04-01 false Maintenance. 633.208 Section 633.208 Highways FEDERAL... PROVISIONS Federal-Aid Contracts (Appalachian Contracts) § 633.208 Maintenance. Maintenance of all highway... responsibility of the State. The State may arrange for maintenance of such roads or portions thereof,...

  1. 8 CFR 208.19 - Decisions. (United States)


    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Decisions. 208.19 Section 208.19 Aliens and... REMOVAL Asylum and Withholding of Removal § 208.19 Decisions. The decision of an asylum officer to grant... and to acknowledge receipt of the decision to grant or deny asylum, or to refer an asylum...

  2. 28 CFR 36.208 - Direct threat. (United States)


    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Direct threat. 36.208 Section 36.208... ACCOMMODATIONS AND IN COMMERCIAL FACILITIES General Requirements § 36.208 Direct threat. (a) This part does not... individual poses a direct threat to the health or safety of others. (b) Direct threat means a...

  3. 22 CFR 208.920 - Civil judgment. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Civil judgment. 208.920 Section 208.920 Foreign...) Definitions § 208.920 Civil judgment. Civil judgment means the disposition of a civil action by any court of... creates a civil liability for the complained of wrongful acts, or a final determination of liability...

  4. 42 CFR 93.208 - Evidence. (United States)


    ... 42 Public Health 1 2010-10-01 2010-10-01 false Evidence. 93.208 Section 93.208 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS... MISCONDUCT Definitions § 93.208 Evidence. Evidence means any document, tangible item, or testimony offered...

  5. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL (United States)

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.


    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  6. 22 CFR 208.905 - Affiliate. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Affiliate. 208.905 Section 208.905 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT... ownership; (b) Identity of interests among family members; (c) Shared facilities and equipment; (d)...

  7. 5 CFR 179.208 - Certification. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Certification. 179.208 Section 179.208 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS... Office's regulations have been approved by OPM pursuant to 5 CFR part 550, subpart K; (5) The date...

  8. 14 CFR 1274.208 - Intellectual property. (United States)


    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Intellectual property. 1274.208 Section... WITH COMMERCIAL FIRMS Pre-Award Requirements § 1274.208 Intellectual property. (a) Intellectual property rights. A cooperative agreement covers the disposition of rights to intellectual property...

  9. 31 CFR 208.7 - Agency responsibilities. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Agency responsibilities. 208.7 Section 208.7 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL...

  10. 31 CFR 208.2 - Definitions. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Definitions. 208.2 Section 208.2 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY DISBURSEMENTS §...

  11. 31 CFR 208.9 - Compliance. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Compliance. 208.9 Section 208.9 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY DISBURSEMENTS §...

  12. 31 CFR 208.8 - Recipient responsibilities. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Recipient responsibilities. 208.8 Section 208.8 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL...

  13. 31 CFR 208.4 - Waivers. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Waivers. 208.4 Section 208.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY DISBURSEMENTS §...

  14. 31 CFR 800.208 - Critical infrastructure. (United States)


    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Critical infrastructure. 800.208..., AND TAKEOVERS BY FOREIGN PERSONS Definitions § 800.208 Critical infrastructure. The term critical infrastructure means, in the context of a particular covered transaction, a system or asset, whether physical...

  15. 44 CFR 208.43 - Rehabilitation. (United States)


    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Rehabilitation. 208.43... Agreements § 208.43 Rehabilitation. DHS will reimburse costs incurred to return System equipment and... Activation. (3) Personnel costs associated with equipment cache rehabilitation. DHS will reimburse...

  16. 5 CFR 430.208 - Rating performance. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Rating performance. 430.208 Section 430.208 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERFORMANCE MANAGEMENT Performance Appraisal for General Schedule, Prevailing Rate, and Certain Other Employees §...

  17. Octupole transitions in the 208Pb region

    International Nuclear Information System (INIS)

    The 208Pb region is characterised by the existence of collective octupole states. Here we populated such states in 208Pb + 208Pb deep-inelastic reactions. γ-ray angular distribution measurements were used to infer the octupole character of several E3 transitions. The octupole character of the 2318 keV 17− → 14+ in 208Pb, 2485 keV 19/2− → 13/2+ in 207Pb, 2419 keV 15/2− → 9/2+ in 209Pb and 2465 keV 17/2+ → 11/2− in 207Tl transitions was demonstrated for the first time. In addition, shell model calculations were performed using two different sets of two-body matrix elements. Their predictions were compared with emphasis on collective octupole states

  18. Dicty_cDB: VHD208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHD208 (Link to dictyBase) - - - Contig-U16430-1 VHD208P (Link to Original site) VHD2...08F 584 VHD208Z 594 VHD208P 1158 - - Show VHD208 Library VH (Link to library) Clone ID VHD2...e URL Representative seq. ID VHD2...08P (Link to Original site) Representative DNA sequence >VHD208 (VHD208Q) /CSM/VH/VHD2-A/VHD2...s. 88 7e-41 4 L34027 |L34027.1 Plasmodium falciparum (clone Dd2) heat shock protein 86 gene, complete cds. 9


    NARCIS (Netherlands)



    In a high precision experiment, Mott scattering of the Pb-208 + Pb-208 system was measured at E(lab) = 873.40 MeV and 1129.74 MeV with kinematic coincidences for angle pairs around theta(lab) = 30-degrees, 60-degrees and theta(lab) = 45-degrees, 45-degrees. The observed Mott oscillations exhibit an

  20. Complete electric dipole response in 208Pb

    CERN Document Server

    Tamii, A; von Neumann-Cosel, P; Fujita, Y; Adachi, T; Bertulani, C A; Carter, J; Dozono, M; Fujita, H; Fujita, K; Hatanaka, K; Heilmann, A M; Ishikawa, D; Itoh, M; Ong, H J; Kawabata, T; Kalmykov, Y; Litvinova, E; Matsubara, H; Nakanishi, K; Neveling, R; Okamura, H; Özel-Tashenov, B; Ponomarev, V Yu; Richter, A; Rubio, B; Sakaguchi, H; Sakemi, Y; Sasamoto, Y; Shimbara, Y; Shimizu, Y; Smit, F D; Suzuki, T; Tameshige, Y; Wambach, J; Yamada, R; Yosoi, M; Zenihiro, J


    A benchmark experiment on 208Pb shows that polarized proton inelastic scattering at very forward angles including 0{\\deg} is a powerful tool for high-resolution studies of electric dipole (E1) and spin magnetic dipole (M1) modes in nuclei over a broad excitation energy range testing up-to-date nuclear model calculations. The E1 polarizability extracted from the data provides a constraint on the neutron skin thickness in 208Pb and the poorly known density dependence of the symmetry energy, relevant to the description of neutron stars.

  1. 27 CFR 46.208 - Unmerchantable articles. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Unmerchantable articles... Tubes Held for Sale on April 1, 2009 Inventories § 46.208 Unmerchantable articles. Articles that the.... However, the dealer must segregate any such unmerchantable articles and include them in a separate...

  2. 37 CFR 2.208 - Deposit accounts. (United States)


    ... Section 2.208 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF... upon receipt of the statement to cover the value of items or services charged to the account and thus...) Bank Routing Code, which is 021030004; (iii) United States Patent and Trademark Office account...

  3. Epilepsy 208 Cases Clinical Analysis%癫痫208例临床分析

    Institute of Scientific and Technical Information of China (English)



    目的 探讨癫痫患者的临床及脑电图(EEG)改变.方法 对208例癫痫患者EEG进行分析.结果 208例癫痫患者EEG轻度异常55例,中度异常109例,重度异常17例.结论 EEG可为癫痫患者的诊断提供重要依据.

  4. 49 CFR 195.208 - Welding of supports and braces. (United States)


    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding of supports and braces. 195.208 Section 195.208 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS... HAZARDOUS LIQUIDS BY PIPELINE Construction § 195.208 Welding of supports and braces. Supports or braces...

  5. 12 CFR 208.42 - Notice of capital category. (United States)


    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Notice of capital category. 208.42 Section 208... Action § 208.42 Notice of capital category. (a) Effective date of determination of capital category. A member bank shall be deemed to be within a given capital category for purposes of section 38 of the...

  6. 9 CFR 93.208 - Articles accompanying poultry. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Articles accompanying poultry. 93.208 Section 93.208 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF... FOR MEANS OF CONVEYANCE AND SHIPPING CONTAINERS Poultry § 93.208 Articles accompanying poultry....

  7. 46 CFR 122.208 - Accidents to machinery. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Accidents to machinery. 122.208 Section 122.208 Shipping... Voyage Records § 122.208 Accidents to machinery. The owner, managing operator, or master shall report damage to a boiler, unfired pressure vessel, or machinery that renders further use of the item...

  8. 46 CFR 185.208 - Accidents to machinery. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Accidents to machinery. 185.208 Section 185.208 Shipping...) OPERATIONS Marine Casualties and Voyage Records § 185.208 Accidents to machinery. The owner, managing operator, or master shall report damage to a boiler, unfired pressure vessel, or machinery that...

  9. 10 CFR 590.208 - Small volume exports. (United States)


    ... 10 Energy 4 2010-01-01 2010-01-01 false Small volume exports. 590.208 Section 590.208 Energy... WITH RESPECT TO THE IMPORT AND EXPORT OF NATURAL GAS Applications for Authorization To Import or Export Natural Gas § 590.208 Small volume exports. Any person may export up to 100,000 cubic feet of natural...

  10. 33 CFR 110.208 - Buffalo Harbor, N.Y. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo Harbor, N.Y. 110.208 Section 110.208 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.208 Buffalo Harbor, N.Y. (a) The anchorage...

  11. 22 CFR 208.25 - How is this part organized? (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false How is this part organized? 208.25 Section 208.25 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT) § 208.25 How is this part organized? (a) This part is subdivided into ten subparts. Each...

  12. 9 CFR 113.208 - Avian Encephalomyelitis Vaccine, Killed Virus. (United States)


    ..., Killed Virus. 113.208 Section 113.208 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.208 Avian Encephalomyelitis Vaccine, Killed Virus....

  13. 50 CFR 665.208 - Protected species conservation. (United States)


    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Protected species conservation. 665.208 Section 665.208 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND... Fisheries § 665.208 Protected species conservation. The Regional Administrator may change the size of...

  14. Radiogenic lead-208 abundance 88.34 %

    International Nuclear Information System (INIS)

    Brazil has a long tradition in thorium technology, from the monazite ores mining until the production of the nuclear grade thorium compounds. Early in 1969 the Institute of Energy and Nuclear Research (IPEN) designed a project for a pilot plant installation to purify the thorium compounds, based on the solvent extraction technique. Thorium compounds used came from monazite's industrialization. During the course of the operation of this plant, a crude sludge were formed containing thorium not extracted and the whole rare earths, plus minor impurities like sodium, titanium, zirconium, hafnium, iron, silicon, phosphate and the thorium daughters were accumulated. Included is the radiogenic lead-208. This sludge, hereafter named 'RETOTER', was treated with hydrochloric acid and the lead was separated and recovered by anion exchange technology. The lead-208 was analyzed by mass spectrometry (HR-ICPMS) technique. The lead-208 abundance measure was 88.34%, this allowed the calculation of the thermal neutron capture cross section of σ0γ = 14,6 +/- 0.7 mb, considerably lower than the σ0γ = 174.2 +/- 0.7 mb value of the natural lead. (author)

  15. 22 CFR 208.340 - If I disclose unfavorable information required under § 208.335, will I be prevented from... (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false If I disclose unfavorable information required under § 208.335, will I be prevented from participating in the transaction? 208.340 Section 208.340... Participants § 208.340 If I disclose unfavorable information required under § 208.335, will I be prevented...

  16. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    International Nuclear Information System (INIS)

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  17. 50 CFR 226.208 - Critical habitat for green turtle. (United States)


    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Critical habitat for green turtle. 226.208 Section 226.208 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC... green turtle. (a) Culebra Island, Puerto Rico—Waters surrounding the island of Culebra from the...

  18. 47 CFR 25.208 - Power flux density limits. (United States)


    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Power flux density limits. 25.208 Section 25... COMMUNICATIONS Technical Standards § 25.208 Power flux density limits. (a) In the band 3650-4200 MHz, the power flux density at the Earth's surface produced by emissions from a space station for all conditions...

  19. 31 CFR 208.5 - Availability of the ETA SM. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Availability of the ETA SM. 208.5 Section 208.5 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL...

  20. 31 CFR 208.6 - General account requirements. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false General account requirements. 208.6 Section 208.6 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL...

  1. 31 CFR 208.3 - Payment by electronic funds transfer. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Payment by electronic funds transfer. 208.3 Section 208.3 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL...

  2. 31 CFR 208.1 - Scope and application. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Scope and application. 208.1 Section 208.1 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY DISBURSEMENTS §...

  3. 44 CFR 208.36 - Reimbursement for Alert. (United States)


    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Reimbursement for Alert. 208... Cooperative Agreements § 208.36 Reimbursement for Alert. (a) Allowable costs. DHS will reimburse costs incurred during an Alert, up to the dollar limit specified in the Alert Order, for the following...

  4. Dicty_cDB: SFC208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFC208 (Link to dictyBase) - - - Contig-U16412-1 SFC208P (Link to Original ... r*rtsstscqrsrnskdsl*snhesnlkryv*kscccsrss*ksinxg*i pkis *cwys*irlni**nnfkkkklkn* Frame B: rmwssgmmhpchgcelg ...

  5. 15 CFR 2011.208 - Paperwork Reduction Act assigned number. (United States)


    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Paperwork Reduction Act assigned number. 2011.208 Section 2011.208 Commerce and Foreign Trade Regulations Relating to Foreign Trade Agreements OFFICE OF THE UNITED STATES TRADE REPRESENTATIVE ALLOCATION OF TARIFF-RATE QUOTA ON IMPORTED SUGARS, SYRUPS AND MOLASSES Specialty Sugar...

  6. 31 CFR 208.10 - Reservation of rights. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Reservation of rights. 208.10 Section... SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY DISBURSEMENTS § 208.10 Reservation of rights. The Secretary reserves the right, in the Secretary's...

  7. 48 CFR 208.7304 - Refined precious metals. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Refined precious metals... Government-Owned Precious Metals 208.7304 Refined precious metals. See PGI 208.7304 for a list of refined precious metals managed by DSCP....

  8. Dicty_cDB: AHA208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AH (Link to library) AHA208 (Link to dictyBase) - - - Contig-U16405-1 AHA208P (Link to Original ... ikyc*glyi*cfgfsil sksiqfei**ktkniw*ryshywlifkiiwws*fpy *fh*ck*tfcc*r*fl*sif*l** yycnistrirki*vvl**nwg*scti ...

  9. 40 CFR 600.208-77 - Sample calculation. (United States)


    ... 600.208-77 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values § 600.208-77 Sample...

  10. 30 CFR 208.14 - Civil and criminal penalties. (United States)


    ... U.S.C. 1719-20, and regulations at 30 CFR part 241. Civil penalties applicable under the OCSLA and... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Civil and criminal penalties. 208.14 Section... MANAGEMENT SALE OF FEDERAL ROYALTY OIL General Provisions § 208.14 Civil and criminal penalties. Failure...

  11. 5 CFR 847.208 - Changes of election. (United States)


    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Changes of election. 847.208 Section 847... (CONTINUED) ELECTIONS OF RETIREMENT COVERAGE BY CURRENT AND FORMER EMPLOYEES OF NONAPPROPRIATED FUND INSTRUMENTALITIES Elections To Continue Retirement Coverage After a Qualifying Move § 847.208 Changes of...

  12. Pygmy dipole resonance in 208Pb

    CERN Document Server

    Poltoratska, I; Tamii, A; Adachi, T; Bertulani, C A; Carter, J; Dozono, M; Fujita, H; Fujita, K; Fujita, Y; Hatanaka, K; Itoh, M; Kawabata, T; Kalmykov, Y; Krumbholz, A M; Litvinova, E; Matsubara, H; Nakanishi, K; Neveling, R; Okamura, H; Ong, H J; Özel-Tashenov, B; Ponomarev, V Yu; Richter, A; Rubio, B; Sakaguchi, H; Sakemi, Y; Sasamoto, Y; Shimbara, Y; Shimizu, Y; Smit, F D; Suzuki, T; Tameshige, Y; Wambach, J; Yosoi, M; Zenihiro, J


    Scattering of protons of several hundred MeV is a promising new spectroscopic tool for the study of electric dipole strength in nuclei. A case study of 208Pb shows that at very forward angles J^pi = 1- states are strongly populated via Coulomb excitation. A separation from nuclear excitation of other modes is achieved by a multipole decomposition analysis of the experimental cross sections based on theoretical angular distributions calculated within the quasiparticle-phonon model. The B(E1) transition strength distribution is extracted for excitation energies up to 9 MeV, i.e., in the region of the so-called pygmy dipole resonance (PDR). The Coulomb-nuclear interference shows sensitivity to the underlying structure of the E1 transitions, which allows for the first time an experimental extraction of the strength and energy centroid of the PDR.

  13. Multipole matrix elements for 208Pb

    International Nuclear Information System (INIS)

    New measurements of inelastic proton scattering to low-lying states of 208Pb at 200 and 400 MeV are reported. Deformation lengths extracted from angular distributions for the 3- (2.614 MeV), 51- (3.198 MeV), 52- (3.209 MeV), 2+ (4.086 MeV) and 4+ (4.324 MeV) states are in good accord with values extracted at other incident proton energies. The fact that the deformation lengths are independent of incident proton energy within experimental uncertainty provides support for the validity of the collective DWBA for medium energy proton scattering to strongly excited states. Advantage is taken of this to extract statistically more precise values of the ratio of neutron to proton multipole matrix elements (M/sub n//M/sub p/). Different methods of determining the appropriate average value of M/sub n//M/sub p/ are discussed. 3 refs., 1 tab

  14. Unusual Threshold Anomaly in the 6Li+208Pb System

    Institute of Scientific and Technical Information of China (English)

    ZHANG Chun-Lei; JIA Hui-Ming; WU Zhen-Dong; XU Xin-Xing; BAI Chun-Lin; ZHANG Huan-Qiao; LIN Cheng-Jian; RUAN Ming; LIU Zu-Hua; YANG Feng; WU Xiu-Kun; ZHOU Ping; AN Guang-Peng


    @@ The angular distributions of elastic scattering for the 6Li +208Pb system have been measured at several energies around the Coulomb barrier. The parameters of optical potential are extracted by means of a phenomenological optical model analysis. It is found that the real and imaginal potentials show a pronounced energy dependence.The behaviour of the potential at the nearly especially sub-barrier energies in the 6Li+208Pb system is quite different from the results of some previous reports observed in other systems, such as 19 F +208 Pb and 16 O+208 Pb.This unusual threshold phenomenon indicates that breakup channel is strongly coupled with the elastic channel and has obvious effects on optical potential.

  15. 27 CFR 555.208 - Construction of type 2 magazines. (United States)


    ..., FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Storage § 555.208 Construction of type 2 magazines. A type 2 magazine is a box, trailer, semitrailer, or other mobile...

  16. Association of benign recurrent vertigo and migraine in 208 patients


    Cha, Y-H; Lee, H.; Santell, LS; Baloh, RW


    The aim of this study was to determine the association of benign recurrent vertigo (BRV) and migraine, using standardized questionnaire-based interview of 208 patients with BRV recruited through a University Neurotology clinic. Of 208 patients with BRV, 180 (87%) met the International Classification of Headache Disorders 2004 criteria for migraine: 112 migraine with aura (62%) and 68 without aura (38%). Twenty-eight (13%) did not meet criteria for migraine. Among patients with migraine, 70% e...


    NARCIS (Netherlands)



    In a high precision experiment, Mott scattering of the Pb-208+Pb-208 and elastic scattering of the Pb-208+U-238 systems was measured at 6 energies near the Coulomb barrier with kinematic coincidences for angle pairs at theta(lab)=30 degrees, 60 degrees. The relative laboratory angle between scattere

  18. Neutron decay of giant resonances in 208Pb

    International Nuclear Information System (INIS)

    The neutron decay of the giant multipole resonance region between 9 to 15 MeV in 208Pb has been studied. The giant resonances were excited by inelastic scattering of 17O at 380 MeV. Neutrons from 208Pb and γ rays from 207Pb were detected in the ORNL Spin Spectrometer and the 17O in ΔE-E silicon detector telescopes. The neutron branching ratios for the decay to the ground state and to the low lying excited states of 207Pb were measured as a function of the excitation energy of 208Pb and compared to Hauser-Feshbach calculations. Evidence for non statistical neutron decay to selected single-hole states, and to hole-surface vibration and hole-pairing vibration coupled states was found. 18 refs., 1 tab., 5 figs

  19. Neutron Star Structure and the Neutron Radius of 208Pb

    CERN Document Server

    Horowitz, C J


    We study relationships between the neutron-rich skin of a heavy nucleus and the properties of neutron-star crusts. Relativistic effective field theories with a thicker neutron skin in $^{208}$Pb have a larger electron fraction and a lower liquid-to-solid transition density for neutron-rich matter. These properties are determined by the density dependence of the symmetry energy which we vary by adding nonlinear couplings between isoscalar and isovector mesons. An accurate measurement of the neutron radius in $^{208}$Pb---via parity violating electron scattering---may have important implications for the structure of neutron stars.

  20. 21 CFR 208.26 - Exemptions and deferrals. (United States)


    ... subject to this part shall provide a Medication Guide to any patient who requests information when the...: GENERAL MEDICATION GUIDES FOR PRESCRIPTION DRUG PRODUCTS General Requirements for a Medication Guide § 208... an applicant, may exempt or defer any Medication Guide content or format requirement, except...

  1. 27 CFR 27.208 - Liquor bottles denied entry. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Liquor bottles denied... BUREAU, DEPARTMENT OF THE TREASURY LIQUORS IMPORTATION OF DISTILLED SPIRITS, WINES, AND BEER Requirements for Liquor Bottles § 27.208 Liquor bottles denied entry. Filled liquor bottles, not conforming to...

  2. 12 CFR 208.51 - Real estate lending standards. (United States)


    ... 208.51 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM... bank's board of directors at least annually. (2) The lending policies shall establish: (i) Loan portfolio diversification standards; (ii) Prudent underwriting standards, including loan-to-value...

  3. Spreading width of Gamow-Teller resonances in 208Bi

    International Nuclear Information System (INIS)

    The spreading width of the Gamow-Teller resonance in 208Bi is studied in the self-consistent TDA with the Skyrme interaction. Coupling between 1p1h states and 2p2h states are included in the TDA linear response function. (orig.)

  4. 44 CFR 208.8 - Code of conduct. (United States)


    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Code of conduct. 208.8... of conduct. The Assistant Administrator will develop and implement a code of conduct for System Members acting under DHS's direction and control. Nothing in this section or the DHS code of conduct...

  5. 33 CFR 160.208 - Changes to a submitted NOA. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Changes to a submitted NOA. 160... Conditions, and Certain Dangerous Cargos § 160.208 Changes to a submitted NOA. (a) Unless otherwise specified in this section, when submitted NOA information changes, vessels must submit a notice of...

  6. 47 CFR 73.208 - Reference points and distance computations. (United States)


    ... middle latitude. (vi) NS=the North-South distance in kilometers. (vii) EW=the East-West distance in... 47 Telecommunication 4 2010-10-01 2010-10-01 false Reference points and distance computations. 73... SERVICES RADIO BROADCAST SERVICES FM Broadcast Stations § 73.208 Reference points and distance...

  7. On the states 3- x 3- in 208Pb

    International Nuclear Information System (INIS)

    Two-particle-two-hole states built upon collective surface and pairing excitations are studied in 208Pb using the multistep shell-model method. It is found that only two of the three 0+ states that arise from those collective excitations are reached by two-neutron transfer or inelastic scattering probes, in agreement with recent high-resolution experiments. (orig.)

  8. 44 CFR 208.64 - Administrative and audit requirements. (United States)


    ... Reimbursement Claims and Appeals § 208.64 Administrative and audit requirements. (a) Non-Federal audit. For Sponsoring Agencies and States, requirements for non-Federal audit are contained in 44 CFR 13.26, in... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Administrative and...

  9. 48 CFR 52.208-4 - Vehicle Lease Payments. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Vehicle Lease Payments. 52....208-4 Vehicle Lease Payments. As prescribed in 8.1104(a), insert the following clause in solicitations...: Vehicle Lease Payments (APR 1984) (a) Upon the submission of proper invoices or vouchers, the...

  10. 40 CFR 180.208 - Benfluralin; tolerances for residues. (United States)


    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Benfluralin; tolerances for residues...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.208 Benfluralin; tolerances for residues. (a) General. Tolerances are established for residues...

  11. 20 CFR 655.208 - Temporary labor certification applications involving fraud or willful misrepresentation. (United States)


    ... involving fraud or willful misrepresentation. 655.208 Section 655.208 Employees' Benefits EMPLOYMENT AND... Temporary labor certification applications involving fraud or willful misrepresentation. (a) If possible fraud or willful misrepresentation involving a temporary labor certification application is...

  12. The Pb-208(n,p)Tl-208 reaction at E-n=97 MeV

    NARCIS (Netherlands)

    Ringbom, A; Hakansson, A; Tibell, G; Zorro, R; Blomgren, J; Conde, H; Rahm, J; Olsson, N; Ramstrom, E; Ronnqvist, T; Jonsson, O; Nilsson, L; Renberg, PU; vanderWerf, SY; Lenske, H


    Double-differential cross sections of the Pb-208(n,p) reaction have been measured at 97 MeV in the angular range 0 degrees-30 degrees for excitation energies up to 40 MeV. The experimental proton spectra have been compared with calculated spectra obtained with a statistical multistep direct reaction

  13. 31 CFR 575.208 - Prohibited transportation-related transactions involving Iraq. (United States)


    ... transactions involving Iraq. 575.208 Section 575.208 Money and Finance: Treasury Regulations Relating to Money... REGULATIONS Prohibitions § 575.208 Prohibited transportation-related transactions involving Iraq. Except as... transportation to or from Iraq; (b) The provision of transportation to or from the United States by any...

  14. 20 CFR 498.208 - Exchange of witness lists, witness statements and exhibits. (United States)


    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Exchange of witness lists, witness statements and exhibits. 498.208 Section 498.208 Employees' Benefits SOCIAL SECURITY ADMINISTRATION CIVIL MONETARY PENALTIES, ASSESSMENTS AND RECOMMENDED EXCLUSIONS § 498.208 Exchange of witness lists,...

  15. 5 CFR 930.208 - Administrative Law Judge Loan Program-detail to other agencies. (United States)


    ...-detail to other agencies. 930.208 Section 930.208 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT... (MISCELLANEOUS) Administrative Law Judge Program § 930.208 Administrative Law Judge Loan Program—detail to other... that coordinates the loan/detail of an administrative law judge from one agency to another. An...

  16. 22 CFR 208.855 - Who has the burden of proof in a debarment action? (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Who has the burden of proof in a debarment action? 208.855 Section 208.855 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT) Debarment § 208.855 Who has the burden of proof in a...

  17. 22 CFR 208.725 - How much time do I have to contest a suspension? (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false How much time do I have to contest a suspension? 208.725 Section 208.725 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT) Suspension § 208.725 How much time do I have to contest...

  18. 22 CFR 208.720 - How may I contest a suspension? (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false How may I contest a suspension? 208.720 Section 208.720 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT) Suspension § 208.720 How may I contest a suspension? If you as a respondent wish to contest...

  19. 40 CFR 141.208 - Special notice for exceedance of the SMCL for fluoride. (United States)


    ... SMCL for fluoride. 141.208 Section 141.208 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Drinking Water Violations § 141.208 Special notice for exceedance of the SMCL for fluoride. (a) When is the special notice to be given? Community water systems that exceed the fluoride secondary maximum...

  20. 31 CFR 515.208 - Restrictions on loans, credits and other financing. (United States)


    ... other financing. 515.208 Section 515.208 Money and Finance: Treasury Regulations Relating to Money and... REGULATIONS Prohibitions § 515.208 Restrictions on loans, credits and other financing. No United States... provide other financing for the purpose of financing transactions involving confiscated property the...

  1. 48 CFR 52.208-8 - Required Sources for Helium and Helium Usage Data. (United States)


    ... Helium and Helium Usage Data. 52.208-8 Section 52.208-8 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.208-8 Required Sources for Helium and Helium Usage Data. As prescribed in 8.505, insert the following clause: Required Sources for Helium and Helium Usage Data (APR 2002) (a)...

  2. 48 CFR 252.208-7000 - Intent to furnish precious metals as Government-furnished material. (United States)


    ... metals as Government-furnished material. 252.208-7000 Section 252.208-7000 Federal Acquisition... precious metals as Government-furnished material. As prescribed in 208.7305(a), use the following clause: Intent To Furnish Precious Metals as Government-Furnished Material (DEC 1991) (a) The Government...

  3. The Evaluation of 208 Ventricular Septal Defect Patients


    Paç, F. Ayşenur; EGE, Erdal; Paç, Mustafa; Battaloğlu, Bektaş; Emmiler, Mustafa; Akpınar, Beşir; Sarı, Süleyman; Pelik, Fatma


    Venticular septal defect is the most common congenital heart defect except bicüspit aortic valve. The first description of ventricular septal defect as a clinical entity was credited to Roger in 1879. It occurs in 1.5-2 in 1000 alive birth. We studied retrospectively 208 cases of VSD seen in our medical center. The patients were evaluated according to the especially clinical data, types of VSD, closure rates, complications (AVP, AY, VSD aneurysm), and surgical therapies. Key words: Ventri...

  4. Near barrier scattering of 8He on 208Pb

    Directory of Open Access Journals (Sweden)

    Marquínez-Durán G.


    Full Text Available The exotic nucleus 8He is investigated by means of the measurement of the angular distributions of the elastic channel and the 6He and 4He fragment yields produced in the collision with a 208Pb target at two energies around the Coulomb barrier, 16 and 22 MeV. The experiment was performed at the GANIL-SPIRAL facility, with the aim of extracting information about the structure of 8He and the relevant reaction mechanisms. In this contribution, details of the experimental setup and preliminary data on elastic cross sections are reported.

  5. Angular distributions of threshold photoneutrons from 208Pb

    International Nuclear Information System (INIS)

    The shape of the 41 keV resonance in the 208Pb(γ,n)207Pb reaction has been considered in some detail in view of recent reports of asymmetry interpreted in terms of interference between resonant and nonresonant neutron capture amplitudes. Additional threshold measurements were made using bremsstrahlung with an endpoint energy of 8.0 MeV. It has been concluded that asymmetry in the present data appears to be induced by the presence of an unresolved resonance, and that this interpretation of the resonance shape cannot be confuted on the basis of (n,γ) or total neutron cross section measurements made elsewhere. (author)

  6. The impact parameter dependence of the K MO X-ray emission in 208Pb+208Pb collisions

    International Nuclear Information System (INIS)

    The emission probabilities for quasimolecular K-X-radiation (K-MOR) have been measured in 208Pb+208Pb collisions at 4.3 MeV/u and 4.8 MeV/u as a function of the scattering angle using the particle-photon-coincidence technique. The probabilities exhibit a superposition of two exponential slopes with different fall-off constants. We identify the sharp fall off at very small impact parameters (<60 fm) with the K-MOR contribution from the decay of 1ssigma-vacancies. The flatter slope for impact parameters larger than 60 fm is attributed to the radiative decay of holes in 2psub(1/2)sigma molecular states. In this way, experimental ''1ssigma-MOR-emission probabilities'' could be extracted and compared with theory. For 4.3 MeV/u the 1ssigma- and 2psub(1/2)sigma-excitation probabilities could also be determined and have been compared to coupled-channel calculations and to a scaling law for 1ssigma-excitation. (orig.)

  7. Electron capture and positron decay of 206Fr and 208Fr and the energy levels of 206Rn and 208Rn

    International Nuclear Information System (INIS)

    The isotopes 206Fr and 208Fr were produced by the reactions Ir(20Ne,xn)/sup 206,208/Fr and mass separated on-line. The electron-capture and positron decays to 206Rn and 208Rn were studied by collecting γ ray and internal conversion electron singles spectra as a function of decay time as well as γ-γ, γ-e-, and γ-x ray coincidence spectra. The energies and many of the spins were determined for 18 excited, even parity states in 208Rn and for 10 excited, even parity states in 206Rn. These nuclei appear to be excellent candidates for interpretation in terms of a weak coupling shell model. The energy levels were also compared to the predictions of the interacting boson approximation model

  8. 22 CFR 208.515 - What specific information is in the EPLS? (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false What specific information is in the EPLS? 208.515 Section 208.515 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT... an individual to verify the identity of an individual, only if permitted under the Privacy Act...

  9. 45 CFR 400.208 - Claims involving family units which include both refugees and nonrefugees. (United States)


    ... refugees and nonrefugees. 400.208 Section 400.208 Public Welfare Regulations Relating to Public Welfare OFFICE OF REFUGEE RESETTLEMENT, ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES REFUGEE RESETTLEMENT PROGRAM Federal Funding Federal Funding for Expenditures for...

  10. Search for the two-phonon octupole vibrational state in {sup 208}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Blumenthal, D.J.; Henning, W.; Janssens, R.V.F. [and others


    We performed an experiment to search for the two-phonon octupole vibrational state in {sup 208}Pb. Thick targets of {sup 208}Pb, {sup 209}Bi, {sup 58,64}Ni, and {sup 160}Gd were bombarded with 1305 MeV beams of were bombard {sup 208}Pb supplied by ATLAS. Gamma rays were detected using the Argonne-Notre Dame BGO gamma-ray facility, consisting of 12 Compton-suppressed germanium detectors surrounding an array of 50 BGO scintillators. We identified some 30 known gamma rays from {sup 208}Pb in the spectra gated by the 5{sup -} {yields} 3{sup -} and 3{sup -} {yields} 0{sup +} transitions in {sup 208}Pb. In addition, after unfolding these spectra for Compton response, we observed broad coincident structures in the energy region expected for the 2-phonon states. Furthermore, we confirmed the placement of a 2485 keV line observed previously in {sup 207}Pb and find no evidence consistent with the placement of this line in {sup 208}Pb. We are currently in the process of investigating the origin of the broadened lines observed in the spectra, extracting the excitation probability of states in {sup 208}Pb, and determining the relative probability of mutual excitation and neutron transfer in this reaction. An additional experiment is also being performed to collect much higher statistics germanium-germanium coincidence data for the thick {sup 208}Pb target.

  11. 22 CFR 208.625 - What is the scope of a suspension or debarment action? (United States)


    ... action? 208.625 Section 208.625 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE... debarment of all of your divisions and other organizational elements from all covered transactions, unless... identified individuals, divisions, or other organizational elements; or (2) To specific types of...

  12. 48 CFR 253.208-2 - DD Form 448-2, Acceptance of MIPR. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448-2, Acceptance... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.208-2 DD Form 448-2, Acceptance of MIPR. Follow the procedures at PGI 253.208-2 for use of DD Form 448-2....

  13. 12 CFR Appendix C to Part 208 - Interagency Guidelines for Real Estate Lending Policies (United States)


    ... regulation. 1 The agencies have adopted a uniform rule on real estate lending. See 12 CFR part 365 (FDIC); 12... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Interagency Guidelines for Real Estate Lending... H) Pt. 208, App. C Appendix C to Part 208—Interagency Guidelines for Real Estate Lending...

  14. 8 CFR 208.18 - Implementation of the Convention Against Torture. (United States)


    ... Torture. 208.18 Section 208.18 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... Implementation of the Convention Against Torture. (a) Definitions. The definitions in this subsection incorporate the definition of torture contained in Article 1 of the Convention Against Torture, subject to...

  15. 8 CFR 208.17 - Deferral of removal under the Convention Against Torture. (United States)


    ... Against Torture. 208.17 Section 208.17 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... Deferral of removal under the Convention Against Torture. (a) Grant of deferral of removal. An alien who... Convention Against Torture; and is subject to the provisions for mandatory denial of withholding of...

  16. 33 CFR 208.25 - Pensacola Dam and Reservoir, Grand (Neosho) River, Okla. (United States)


    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Pensacola Dam and Reservoir, Grand (Neosho) River, Okla. 208.25 Section 208.25 Navigation and Navigable Waters CORPS OF ENGINEERS..., Grand (Neosho) River, Okla. The representative of the agency charged with the operation of the...

  17. 22 CFR 208.815 - How may I contest a proposed debarment? (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false How may I contest a proposed debarment? 208.815... SUSPENSION (NONPROCUREMENT) Debarment § 208.815 How may I contest a proposed debarment? If you as a respondent wish to contest a proposed debarment, you or your representative must provide the...

  18. 31 CFR 537.208 - Holding of funds in interest-bearing accounts; investment and reinvestment. (United States)


    ... under the Securities Exchange Act of 1934, provided the funds are invested in a money market fund or in... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing accounts; investment and reinvestment. 537.208 Section 537.208 Money and Finance: Treasury...

  19. 8 CFR 208.5 - Special duties toward aliens in custody of DHS. (United States)


    ... case of an alien who is in custody pending a credible fear determination under 8 CFR 208.30 or a reasonable fear determination pursuant to 8 CFR 208.31. Although DHS does not have a duty in the case of an alien who is in custody pending a credible fear or reasonable fear determination under either 8 CFR...

  20. 22 CFR 208.800 - What are the causes for debarment? (United States)


    ... taken before October 1, 1988, or a procurement debarment by any Federal agency taken pursuant to 48 CFR... 22 Foreign Relations 1 2010-04-01 2010-04-01 false What are the causes for debarment? 208.800... SUSPENSION (NONPROCUREMENT) Debarment § 208.800 What are the causes for debarment? We may debar a person...

  1. 5 CFR 362.208 - Resignation, termination, reduction in force, and appeal rights. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Resignation, termination, reduction in force, and appeal rights. 362.208 Section 362.208 Administrative Personnel OFFICE OF PERSONNEL... Resignation, termination, reduction in force, and appeal rights. (a) Resignation. A Fellow or Senior...

  2. 12 CFR 208.3 - Application and conditions for membership in the Federal Reserve System. (United States)


    ... the Federal Reserve System. 208.3 Section 208.3 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM MEMBERSHIP OF STATE BANKING INSTITUTIONS IN THE FEDERAL RESERVE..., 2 in accordance with this part and § 262.3 of the Rules of Procedure, located at 12 CFR 262.3. 2...

  3. 33 CFR 263.24 - Authority for snagging and clearing for flood control (Section 208). (United States)


    ... clearing for flood control (Section 208). 263.24 Section 263.24 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE CONTINUING AUTHORITIES PROGRAMS Flood Control Policy § 263.24 Authority for snagging and clearing for flood control (Section 208). (a)...

  4. Fragmentation of few-quasiparticle components of highly excited states in sup(207,208)Pb

    International Nuclear Information System (INIS)

    The s-, p- and d-wave neutron strength functions are calculated for sup(207, 208)Pd. Their energy dependence is correctly described. The fine structure of the isoscalar quadrupole resonance is explained and the description for the low-lying octupole resonance and high-lying isoscalar octupole resonance in 208Pb is obtained in agreement with the experimental data

  5. 44 CFR 208.38 - Reimbursement for re-supply and logistics costs incurred during Activation. (United States)


    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Reimbursement for re-supply and logistics costs incurred during Activation. 208.38 Section 208.38 Emergency Management and...-supply and logistics costs incurred during Activation. With the exception of emergency...

  6. 23 CFR 970.208 - Federal lands pavement management system (PMS). (United States)


    ... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands pavement management system (PMS). 970.208... HIGHWAYS NATIONAL PARK SERVICE MANAGEMENT SYSTEMS National Park Service Management Systems § 970.208 Federal lands pavement management system (PMS). In addition to the requirements provided in § 970.204,...

  7. MicroRNA-208a Silencing Attenuates Doxorubicin Induced Myocyte Apoptosis and Cardiac Dysfunction

    Directory of Open Access Journals (Sweden)

    Hasahya Tony


    Full Text Available Aims. GATA4 depletion is a distinct mechanism by which doxorubicin leads to cardiomyocyte apoptosis, and preservation of GATA4 mitigates doxorubicin induced myocyte apoptosis and cardiac dysfunction. We investigated a novel approach of attenuating doxorubicin induced cardiac toxicity by silencing miR-208a, a heart specific microRNA known to target GATA4. Methods and Results. Eight-week-old female Balb/C mice were randomly assigned to sham, antagomir, and control groups. Antagomir group were pretreated with miR-208a antagomir 4 days before doxorubicin administration. At day 0, control and antagomir groups received 20 mg/kg of doxorubicin, while sham mice received phosphate buffered solution. Echocardiography was done at day 7, after which animals were sacrificed and hearts harvested and assessed for apoptosis and expression of miR-208a, GATA4, and BCL-2. Doxorubicin significantly upregulated miR-208a, downregulated GATA4, and increased myocyte apoptosis, with resulting decrease in cardiac function. In contrast, therapeutic silencing of miR-208a salvaged GATA4 and BCL-2 and decreased apoptosis, with improvement in cardiac function. Conclusion. Doxorubicin upregulates miR-208a and promotes cardiomyocyte apoptosis, while therapeutic silencing of miR-208a attenuates doxorubicin induced myocyte apoptosis with subsequent improvement in cardiac function. These novel results highlight the therapeutic potential of targeting miR-208a to prevent doxorubicin cardiotoxicity.

  8. β-decay systematic trends of nuclei beyond 208Pb

    International Nuclear Information System (INIS)

    The β decay of several nuclei beyond 208Pb has been investigated using the FRS+RISING set up at the GSI accelerator facilities, in Darmstadt. This contribution provides a compilation of the β-decay information obtained for neutron-rich Tl, Pb and Bi isotopes. On the basis of the new data, a general overview on the β-decay systematics in this mass region is provided. The study reveals the impact of the microscopic structure of these nuclei on the descriptive power of standard theoretical models. These are used to extrapolate gross properties towards the neutron-drip line, where the nuclei that concur in the formation of the third r-process abundance peak reside. Deficiencies in their predictive power are discussed.

  9. Mobility and lifetime of 208Tl ions in liquid xenon

    International Nuclear Information System (INIS)

    Positively charged 208Tl ions are transported through liquid xenon using electric fields in the range of 4-10 kV cm-1 and for drift distances up to 50 mm. From these measurements we deduce upper limits on the attenuation length for Tl ions in liquid xenon, resulting in a lifetime >5.5 s. In addition to these results, the field independent mobility of Tl bearing species in liquid xenon was measured to be 1.33±0.04x10-4 cm2 V-1 s-1. This result, when coupled with those for other species by previous workers, suggests that positive ion mobility in liquid xenon is proportional to the hard-core radius. Applications to Ba ion collection in a double beta decay experiment are also discussed

  10. Relativistic approach to isoscalar giant resonances in 208Pb

    International Nuclear Information System (INIS)

    We calculate the longitudinal response of 208Pb using a relativistic random-phase approximation to three different parametrizations of the Walecka model with scalar self-interactions. >From a nonspectral calculation of the response -- which automatically includes the mixing between positive- and negative-energy states -- we extract the distribution of strength for the isoscalar monopole, dipole, and high-energy octupole resonances. We employ a consistent formalism that uses the same interaction in the calculation of the ground state as in the calculation of the response. As a result, the conservation of the vector current is strictly maintained throughout the calculation. Further, the spurious dipole strength -- associated with the uniform translation of the center of mass -- gets shifted to zero excitation energy and is cleanly separated from the physical excitations. The best description of the collective modes is obtained using a ''soft'' parametrization having a compression modulus of K=224 MeV

  11. Study of the neutron skin thickness of ${}^{208}$Pb in mean field models

    CERN Document Server

    Roca-Maza, X; Viñas, X; Warda, M


    We study whether the neutron skin thickness $\\Delta r_{np}$ of ${}^{208}$Pb originates from the bulk or from the surface of the neutron and proton density distributions in mean field models. We find that the size of the bulk contribution to $\\Delta r_{np}$ of ${}^{208}$Pb strongly depends on the slope of the nuclear symmetry energy, while the surface contribution does not. We note that most mean field models predict a neutron density for ${}^{208}$Pb between the halo and skin type limits. We investigate the dependence of parity- violating electron scattering at the kinematics of the PREX experiment on the shape of the nucleon densities predicted by the mean field models for ${}^{208}$Pb. We find an approximate formula for the parity-violating asymmetry in terms of the central radius and the surface diffuseness of the nucleon densities of ${}^{208}$Pb in these models.

  12. 25 CFR 900.208 - How are non-medical related tort claims and lawsuits filed for DOI? (United States)


    ... 25 Indians 2 2010-04-01 2010-04-01 false How are non-medical related tort claims and lawsuits filed for DOI? 900.208 Section 900.208 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR, AND... Related Claims § 900.208 How are non-medical related tort claims and lawsuits filed for DOI?...

  13. Therapeutic Inhibition of miR-208a Improves Cardiac Function and Survival During Heart Failure (United States)

    Montgomery, Rusty L.; Hullinger, Thomas G.; Semus, Hillary M.; Dickinson, Brent A.; Seto, Anita G.; Lynch, Joshua M.; Stack, Christianna; Latimer, Paul A.; Olson, Eric N.; van Rooij, Eva


    Background Diastolic dysfunction in response to hypertrophy is a major clinical syndrome with few therapeutic options. MicroRNAs act as negative regulators of gene expression by inhibiting translation or promoting degradation of target mRNAs. Previously, we reported that genetic deletion of the cardiac-specific miR-208a prevents pathological cardiac remodeling and upregulation of Myh7 in response to pressure overload. Whether this miRNA might contribute to diastolic dysfunction or other forms of heart disease is currently unknown. Methods and Results Here, we show that systemic delivery of an antisense oligonucleotide induces potent and sustained silencing of miR-208a in the heart. Therapeutic inhibition of miR-208a by subcutaneous delivery of antimiR-208a during hypertension-induced heart failure in Dahl hypertensive rats dose-dependently prevents pathological myosin switching and cardiac remodeling while improving cardiac function, overall health, and survival. Transcriptional profiling indicates that antimiR-208a evokes prominent effects on cardiac gene expression; plasma analysis indicates significant changes in circulating levels of miRNAs on antimiR-208a treatment. Conclusions These studies indicate the potential of oligonucleotide-based therapies for modulating cardiac miRNAs and validate miR-208 as a potent therapeutic target for the modulation of cardiac function and remodeling during heart disease progression. PMID:21900086

  14. Macroscopic cross sections of neutron radiation capture by Pb-208, U-238 and Tc-99 nuclides in the accelerator driven subcritical core cooled with molten Pb-208 - 286

    International Nuclear Information System (INIS)

    In the paper macroscopic cross sections for several isotopes: 208Pb, 238U, 99Tc and natural mix of lead isotopes, natPb, averaged over neutron spectra of the accelerator driven subcritical core cooled with natPb or 208Pb are given. It is shown that macro cross sections for a coolant from 208Pb are by 6.2 times smaller than those for the coolant consisted from natPb. The economy of neutrons in the core cooled with molten 208Pb can be used for reducing initial fuel load, increasing plutonium breeding and enhancing transmutation of such long lived fission products as 99Tc. The values of macro cross sections calculated for 238U and 99Tc, equal to 0.6 and 0.8 barns, respectively, are comparable with the values of the same nuclide macro cross sections for neutron spectrum of the fast reactor core cooled with sodium. Good neutron and physical features of molten 208Pb permit to assume it as perspective coolant for fast reactors and accelerator driven systems. (authors)

  15. The Peculiar Balmer Line Profiles of OQ 208

    CERN Document Server

    Marziani, P; Calvani, M; Pérez, E; Moles, M; Penston, M V


    We present spectrophotometric observations of the Broad Line Radio Galaxy OQ 208 (Mrk 668, 1404+286) obtained between 1985 and 1991. We show that the Balmer line fluxes and profile shapes undergo remarkable changes. The ratio of intensities between the broad and narrow components of Hbeta increased monotonically from 15 in 1985 to 40 in 1991. The peak of the broad components of Hbeta and Halpha were known to be strongly displaced to the red. We have discovered a correlation between the amplitude of the broad peak displacement and the luminosity of Hbeta, in the sense that the displacement is larger when the line luminosity is higher. We suggest that the observations are not compatible with either a binary Broad Line Region model or one involving ballistic acceleration of the line emitting gas. Radiative acceleration of a system of outflowing clouds readily explains the correlation between line shift and luminosity as well as the peculiar line profiles. Furthermore, it seems that most or all of the Balmer emis...

  16. Electric dipole excitation of 208Pb by polarized electron impact

    International Nuclear Information System (INIS)

    The cross sections and spin asymmetries for the excitation of 1- states in 208Pb by transversely polarized electrons with collision energy of 30-180MeV have been examined within the DWBA scattering formalism. As examples, we have considered a low-lying 1- state and also states belonging to the pygmy dipole and giant dipole resonances. The structure of these states and their corresponding transition charge and current densities have been taken from an RPA calculation within the quasiparticle phonon model. The complex-plane rotation method has been applied to achieve the convergence of the radial DWBA integrals for backward scattering. We have studied the behaviour of the cross sections and spin asymmetries as a function of electron energy and scattering angle. The role of the longitudinal and transversal contributions to the excitation has been thoroughly studied. We conclude that the spin asymmetry S, related to unpolarized outgoing electrons, is mostly well below 1% even at the backward scattering angles and its measurement provides a challenge for future experiments with polarized electrons. (orig.)

  17. Lessons learned at 208K: Towards Debugging Millions of Cores

    Energy Technology Data Exchange (ETDEWEB)

    Lee, G L; Ahn, D H; Arnold, D C; de Supinski, B R; Legendre, M; Miller, B P; Schulz, M J; Liblit, B


    Petascale systems will present several new challenges to performance and correctness tools. Such machines may contain millions of cores, requiring that tools use scalable data structures and analysis algorithms to collect and to process application data. In addition, at such scales, each tool itself will become a large parallel application--already, debugging the full Blue-Gene/L (BG/L) installation at the Lawrence Livermore National Laboratory requires employing 1664 tool daemons. To reach such sizes and beyond, tools must use a scalable communication infrastructure and manage their own tool processes efficiently. Some system resources, such as the file system, may also become tool bottlenecks. In this paper, we present challenges to petascale tool development, using the Stack Trace Analysis Tool (STAT) as a case study. STAT is a lightweight tool that gathers and merges stack traces from a parallel application to identify process equivalence classes. We use results gathered at thousands of tasks on an Infiniband cluster and results up to 208K processes on BG/L to identify current scalability issues as well as challenges that will be faced at the petascale. We then present implemented solutions to these challenges and show the resulting performance improvements. We also discuss future plans to meet the debugging demands of petascale machines.

  18. Multinucleon transfer in the 136Xe+208Pb reaction (United States)

    Li, Cheng; Zhang, Fan; Li, Jingjing; Zhu, Long; Tian, Junlong; Wang, Ning; Zhang, Feng-Shou


    The dynamic mechanics in the multinucleon transfer reaction 136Xe+208Pb at an incident energy of Ec .m .=450 MeV is investigated by using the improved quantum molecular dynamics model (ImQMD). The lifetime of the neck directly influences the nucleon exchange and energy dissipation between the projectile and the target. The total-kinetic-energy-mass distributions and excitation energy division of primary binary fragments and the mass distributions of primary fragments at different impact parameters are calculated. The thermal equilibrium between two reaction partners has been observed at the lifetime of a neck larger than 480 fm /c . By using the statistical decay code gemini to describe the de-excitation process of the primary fragments, the isotope production cross sections from Pt to At are compared with the prediction by the dinuclear system and GRAZING model. The calculations indicate that the GRAZING model is suitable for estimating the isotope production cross sections only for Δ Z =-1 to +2; the DNS + gemini calculations underestimate the cross sections in the neutron-rich and neutron-deficient regions; and the ImQMD + gemini calculations give reasonable predictions of the isotope production cross sections for Δ Z =-3 to 0.

  19. Anharmonicity of multi-octupole-phonon excitations in $^{208}$Pb: analysis with multi-reference covariant density functional theory and subbarrier fusion of $^{16}$O+$^{208}$Pb

    CERN Document Server

    Yao, J M


    We discuss anharmonicity of the multi-octupole-phonon states in $^{208}$Pb based on a covariant density functional theory, by fully taking into account the interplay between the quadrupole and the octupole degrees of freedom. Our results indicate the existence of a large anharmonicity in the transition strengths, even though the excitation energies are similar to those in the harmonic limit. We also show that the quadrupole-shape fluctuation significantly enhances the fragmentation of the two-octupole-phonon states in $^{208}$Pb. Using those transition strengths as inputs to coupled channels calculations, we then discuss the fusion reaction of $^{16}$O+$^{208}$Pb at energies around the Coulomb barrier. We show that the anharmonicity of the octupole vibrational excitation considerably improves previous coupled-channels calculations in the harmonic oscillator limit, significantly reducing the height of the main peak in the fusion barrier distribution.

  20. Freqüência de dermatoses infecciosas em 208 pacientes transplantados renais Frequency of infectious dermatosis in 208 renal transplant recipients


    Gérson Vettorato; André Vicente Esteves de Carvalho; Sérgio Martinez Lecompte; Elisa Gobbato Trez; Valter Duro Garcia; Elizete Keitel


    FUNDAMENTOS: Nos pacientes transplantados renais, a imunossupressão crônica acarreta maior suscetibilidade às dermatoses infecciosas. OBJETIVOS: avaliar a freqüência de dermatoses infecciosas em 208 pacientes transplantados renais no período de 12 meses e verificar a relação entre sua ocorrência e o período de tempo transcorrido desde o transplante. MÉTODO: 208 transplantados renais de uma população de 720 pacientes foram submetidos a exame dermatológico no período de um ano, tendo sido reali...

  1. Four-body effects on 9Be + 208Pb scattering and fusion around the Coulomb barrier

    CERN Document Server

    Descouvemont, P; Canto, L F; Hussein, M S


    We investigate the 9Be + 208Pb elastic scattering and fusion at energies around the Coulomb barrier. The $^9$Be nucleus is described in a \\alpha + \\alpha + n three-body model, using the hyperspherical coordinate method. The scattering with $^{208}$Pb is then studied with the Continuum Discretized Coupled Channel (CDCC) method, where the \\alpha + \\alpha + n continuum is approximated by a discrete number of pseudostates. Optical potentials for the $\\alpha+^{208}$Pb and $n+^{208}$Pb systems are taken from the literature. We present elastic-scattering and fusion cross sections at different energies, and investigate the convergence with respect to the truncation of the \\alpha + \\alpha + n continuum. A good agreement with experiment is obtained, considering that there is no parameter fitting. We show that continuum effects increase at low energies.

  2. Changes in cardiac specific microRNA-208a level in peripheral blood in ST segment elevation acute myocardial infarction patients

    Institute of Scientific and Technical Information of China (English)



    Objective To observe serum cardiac specific microRNA-208a(miR-208a) levels in ST segment elevation acute myocardial infarction(STEAMI) patients,and to explore the role of serum miR-208a levels in the diagnosis of STEAMI. Methods The serum miR-208a concentrations were assessed within 12 hours after STEAMI,while

  3. Study of fusion cross-sections of 16O + 208Pb and 28Si + 208Pb reactions by effective soft-core nucleon-nucleon interaction

    Directory of Open Access Journals (Sweden)

    Ghodsi Omid N.


    Full Text Available In this paper, the cross-sections of fusion reactions 16O + 208Pb, 28Si + 208Pb, 40C + + 40Ca, 40Ca + 48Ca, 58Ni + 58Ni, and 16O + 154Sm at bombarding energies above and near the fusion barrier have been investigated. The fusion cross-sections have been studied by means of the Monte Carlo method and effective soft-core nucleon-nucleon interaction. One adjustable parameter was used in these calculations. This parameter can change the strength and repulsive parts of soft-core potential values. It has to be adjusted, so that the analytical results are in acceptable agreement with the experimental data. In our calculations, we have taken the range of the nucleon-nucleon soft-core interaction to be constant and equal to that of the M3Y-Raid potential. Results show that the higher values for the diffusion parameter in the Woods-Saxon potential obtained from a careful analysis of 16O + 208Pb and 28Si + 208Pb reactions are due to the many particle effects on the nucleon-nucleon potential.

  4. Clinical Analysis of 208 Cases of Pulmonary Embolism%208例肺栓塞的临床分析

    Institute of Scientific and Technical Information of China (English)

    杨玥; 张爱珍; 杜永成


    目的:回顾性分析肺栓塞病例的临床特点、诊断和治疗方法,减少漏诊、误诊,提高对肺栓塞患者的诊断率和治愈率。方法对2009年1月至2013年9月入住山西省人民医院的208例肺栓塞患者的相关危险因素、临床表现、辅助检查结果及治疗方法进行回顾性分析。结果①肺栓塞患者临床表现多样,主要有呼吸困难、咳嗽、胸憋、胸痛和下肢肿胀。②肺栓塞的主要相关危险因素依次为深静脉血栓形成、高血压、吸烟和心功能不全。③常规检查项目中D-二聚体测定可作为筛查肺栓塞的敏感但非特异性指标。④溶栓序贯抗凝治疗与单纯抗凝治疗的治愈率比较二者差异有统计学意义,总有效率差异无统计学意义。结论肺栓塞临床表现及常规检查缺乏特异性,对疑诊患者应综合考虑,提高确诊率,积极治疗。%Objective To retrospectively analyze the clinical features ,diagnosis and therapy of pulmonary embolism for reduction of misdiagnosis and missed diagnosis, and for improving the cure rate.Methods The data of related risk factors, clinical manifestation, auxiliary examination results and treatment of 208 patients with pulmonary embolism in Shanxi Province people’s hospital were summarized.Results①Pulmonary embolism in patients with clinical manifestations of diversity, malnly include dyspnea, cough, chest suppress, chest paln and swelling of lower limbs.②The maln risk factors related to pulmonary embolism are deep vein thrombosis, high blood pressure, smoking and cardiac insufifciency.③Routine inspection project D-dimer determination can be used as screening sensitive but not speciifc indicator of pulmonary embolism.④Thrombolysis sequential anticoagulation compared with pure anticoagulant therapy cure rate was statistically signiifcant difference in, there was no statistically signiifcant difference in total effective rate.Conclusions clinical

  5. Neutron skin of 208Pb, nuclear symmetry energy, and the parity radius experiment

    CERN Document Server

    Roca-Maza, X; Viñas, X; Warda, M


    A precise determination of the neutron skin thickness of a heavy nucleus sets a basic constraint on the nuclear symmetry energy. The parity radius experiment (PREX) may achieve it by model-independent parity-violating electron scattering on 208Pb. We investigate parity-violating electron scattering in nuclear mean field approach to allow the accurate extraction of the neutron skin thickness of 208Pb from the parity-violating asymmetry that the experiment measures. We demonstrate a close linear correlation between the parity-violating asymmetry and the neutron skin thickness in successful mean field forces as a best means to constrain the neutron skin of 208Pb from this innovative experiment. The quality of the correlation supports the commissioning of an improved PREX run to measure the parity-violating asymmetry more accurately. We study the consequences for constraining the density slope of the nuclear symmetry energy.

  6. Electrical Conductivity of ε-Iron under Shock Compression up to 208 G Pa

    Institute of Scientific and Technical Information of China (English)

    毕延; 谭华; 经福谦


    The electrical conductivity of shock-compressed iron was measured up to 208 GPa by using an improved design in experiment assembly in which the iron sample was encapsulated in a single-crystal sapphire cell. High-pressure shock compressions were generated by the plate impact technique with the two-stage light-gas gun. The measured conductivity ofiron varies from 1.45 × 104 Ω- 1 cm-1 at 101 GPa and 2010 K to 7.65 × 103 Ω-1 cm-1 at 208 GPa and 5220 K. After examining these data together with those reported, we found that the Bloch-Griineisen expression is still valid at high pressures and temperatures, even up to 208GPa and 5220K, at least for ε-iron, which is significant in the field of condensed matter physics and deep interior earth science.

  7. Development of an odd-Z-projectile reaction for heavy element synthesis: 208Pb(64Ni, n)271Ds and 208Pb(65Cu, n)272111

    International Nuclear Information System (INIS)

    Seven 271Ds decay chains were identified in the bombardment of 208Pb targets with 311.5- and 314.3-MeV 64Ni projectiles using the Berkeley Gas-filled Separator. These data, combined with previous results, provide an excitation function for this reaction. From these results, an optimum energy of 321 MeV was estimated for the production of 272111 in the reaction 208Pb(65Cu, n). One decay chain was observed, resulting in a cross section of 1.7-1.4+3.9 pb. This experiment confirms the discovery of element 111 by the Darmstadt group who used the 209Bi(64Ni, n)272111 reaction

  8. Particle-hole excitations in 208Pb from the (n,n'γ) reaction

    International Nuclear Information System (INIS)

    Complete text of publication follows. The doubly closed-shell nucleus 208Pb has long held unusual importance in studies of nuclear structure, because it is anticipated that the low-lying excitations can be understood within the shell model. Recently, a revival of interest in 208Pb has occurred, as the structure of this nucleus has been studied with a variety of probes. While much of this excitement has been generated by searches for two-phonon octupole excitations (1-6), these and other studies (7-9) have provided a wealth of new information about the properties of low-lying excitations in this pivotal nucleus. Each of these detailed investigations has provided new insights about the particle-hole states in 208Pb. Rejmund et al. (10) have exploited these data to derive empirically the shell model wave functions for many states in 208Pb. Surprisingly, not much effort has been devoted to obtaining lifetimes of the excited states. Thus a series of (n,n'γ) experiments, including lifetime measurements, has been performed at the University of Kentucky. From these experiments a significant amount of information about the low-lying level structure of 208Pb has been obtained. Much of this new data takes the form of level energies, spin-parity assignments, and γ-ray branchings; however, a unique contribution of this work is the measurement of level lifetimes with the Doppler-shift attenuation method (DSAM). From these lifetimes, it is possible to obtain absolute transition rates for a large number of decays and to compare these with recent calculations. The single-particle nature of states in 208Pb has, therefore, been examined in unprecedented detail. This work was supported under grant PHY-9803784 from the U.S. National Science Foundation, the U.S. Hungarian Joint Fund, JFNo. 94a-403, and by the Hungarian Academy of Sciences. (author)

  9. Reanalysis of electron scattering and muonic x-ray data for 208Pb

    International Nuclear Information System (INIS)

    A simultaneous analysis was performed for the world's supply of data on lead 208. A total of 14 sets of electron scattering data were analyzed along with six independent muonic transition energies. A previously used Fourier Bessel expansion program was expanded to include the full set of available data. The fit was done starting with the density distribution and using 13 expansion coeffients with a cutoff radius of 11 fm. The results are tabulated for muonic energy levels. Interior charge densities of lead 208, differential cross sections, per cent of experimental deviation from the fit, and charge density are plotted. 8 references

  10. Coulomb excitation of re-accelerated 208Rn and 206Po beams

    International Nuclear Information System (INIS)

    In the present study, B(E2; 2+ → 0+) values have been measured in the 208Rn and 206Po nuclei through Coulomb excitation of re-accelerated radioactive beams in inverse kinematics at CERN-ISOLDE. The resulting B(E2; 2+ → 0+) in 208Rn is ∼ 0.08 e2b2. These nuclei lie in, or at the boundary of the region where seniority scheme should persist. However, contributions from collective excitations may be present when moving away from the N = 126 shell closure. To date, surprisingly little is known of the transition probabilities between the low-spin states in this region. (authors)

  11. (3He,t) reaction at 80MeV on 90Zr and 208Pb

    International Nuclear Information System (INIS)

    An experiment using the 80MeV 3He beam of the ISN cyclotron at Grenoble has been done on a target of 90Zr and another one of 208Bi. The 90Zr and 208Pb IAS angular distributions are fitted by DWBA calculations. For the previously reported Gamow Teller transition centered in 90Nb at 8.4MeV, two components are observed. The first one of M1 type is centered at 7.2MeV, the other one of unknown polarity at 9.7MeV

  12. Freqüência de dermatoses infecciosas em 208 pacientes transplantados renais


    Vettorato Gérson; Carvalho André Vicente Esteves de; Lecompte Sérgio Martinez; Trez Elisa Gobbato; Garcia Valter Duro; Keitel Elizete


    FUNDAMENTOS: Nos pacientes transplantados renais, a imunossupressão crônica acarreta maior suscetibilidade às dermatoses infecciosas. OBJETIVOS: avaliar a freqüência de dermatoses infecciosas em 208 pacientes transplantados renais no período de 12 meses e verificar a relação entre sua ocorrência e o período de tempo transcorrido desde o transplante. MÉTODO: 208 transplantados renais de uma população de 720 pacientes foram submetidos a exame dermatológico no período de um ano, tendo sido reali...

  13. Sensitivity of the electric dipole polarizability to the neutron skin thickness in ${}^{208}$Pb

    CERN Document Server

    Roca-Maza, X; Colo', G; Nazarewicz, W; Paar, N; Piekarewicz, J; Reinhard, P -G; Vretenar, D; 10.1063/1.4764239


    The static dipole polarizability, $\\alpha_{\\rm D}$, in ${}^{208}$Pb has been recently measured with high-resolution via proton inelastic scattering at the Research Center for Nuclear Physics (RCNP). This observable is thought to be intimately connected with the neutron skin thickness, $r_{\\rm skin}$, of the same nucleus and, more fundamentally, it is believed to be associated with the density dependence of the nuclear symmetry energy. The impact of $r_{\\rm skin}$ on $\\alpha_{\\rm D}$ in ${}^{208}$Pb is investigated and discussed on the basis of a large and representative set of relativistic and non-relativistic nuclear energy density functionals (EDF).

  14. Complete Electric Dipole Response and the Neutron Skin in 208Pb

    International Nuclear Information System (INIS)

    A benchmark experiment on 208Pb shows that polarized proton inelastic scattering at very forward angles including 0 deg. is a powerful tool for high-resolution studies of electric dipole (E1) and spin magnetic dipole (M1) modes in nuclei over a broad excitation energy range to test up-to-date nuclear models. The extracted E1 polarizability leads to a neutron skin thickness rskin=0.156-0.021+0.025 fm in 208Pb derived within a mean-field model [Phys. Rev. C 81, 051303 (2010)], thereby constraining the symmetry energy and its density dependence relevant to the description of neutron stars.

  15. Triple-differential cross section of the 208Pb(6Li, αd)208 Pb Coulomb breakup and astrophysical S-factor of the d(α,γ)6 Li reaction at extremely low energies

    International Nuclear Information System (INIS)

    A method of calculation of the triple-differential cross section of the 208Pb(6Li, αd)208Pb Coulomb breakup at astrophysically relevant energies E of the relative motion of the breakup fragments, taking into account the three-body (α - d - 208Pb) Coulomb effects and the contributions from the E1- and E2- multipoles, including their interference, has been proposed. The new results for the astrophysical S-factor of the direct radiative capture d(α, γ)6 Li reaction at E ≤ 250 keV have been obtained. It is shown that the experimental triple-differential cross section of the 208Pb(6Li, αd)208Pb Coulomb breakup can also be used to give information about the value of the modulus squared of the nuclear vertex constant for the virtual 6Li → α + d. (author)

  16. 5 CFR 892.208 - Can I change my enrollment from self and family to self only at any time? (United States)


    ... family to self only at any time? 892.208 Section 892.208 Administrative Personnel OFFICE OF PERSONNEL... self and family to self only at any time? If you are participating in premium conversion you may change your FEHB enrollment from self and family to self only under either of the following circumstances:...

  17. 49 CFR 40.208 - What problem requires corrective action but does not result in the cancellation of a test? (United States)


    ... 49 Transportation 1 2010-10-01 2010-10-01 false What problem requires corrective action but does not result in the cancellation of a test? 40.208 Section 40.208 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS...

  18. Radiationless transition probabilities in muonic 208Pb, 232Th, and 238U

    International Nuclear Information System (INIS)

    The probabilities for non-radiative (n.r.) excitations Pn.r. in the muonic nuclides 208Pb, 232Th, and 238U have been determined for (μ-, γγ)-measurements by comparing the intensities of muonic X-ray transitions in single and coincidence spectra. The value of Pn.r. (3p→1s), measured for the first time, is about 90% for the actinides 232Th and 238U, but only about 8% for 208Pb. The value of Pn.r. (3d→1s) is found to be 10% for 233Th, 13% for 238U, and about 4% for 208Pb. For 208Pb a vanishing strength of the n.r. decay of the 2p-level is found, while for 232Th and for 238U n.r. strengths of about 20% and 26%, respectively, are observed. By regarding two subcomplexes of the 2p→1s transitions leading to different mean excitation energies the n.r. transition probabilities were found to be different for 238U only, 21.6% and 31.1%, respectively. (orig.)

  19. New Isomers in the Neutron-Rich Region Beyond 208Pb

    Directory of Open Access Journals (Sweden)

    Gottardo A.


    Full Text Available The region of neutron-rich nuclei beyond 208Pb has been very difficult to explore due to its high mass and exoticity. However, recent experimental improvements allowed one to perform a quite extended isomer decay spectroscopy of these nuclei.


    International Nuclear Information System (INIS)

    Full text: Among the nuclei of the nuclear charter, the nuclei around closed shells play a key role in understanding the effective interaction properties between nucleons far from the valley of stability; particulary, the nuclei of a few valence nucleons around doubly magic 208 28Pb126 and 132 50Sn82 nuclei. The interest of both regions 208Pb and 132Sn lies in the fact that there is a great similarity between their nuclear spectroscopic properties. The single energy gaps in both cases are comparable and the orbitals above and below these gaps are similarly ordered. Each single state in the region of 132Sn has its counterpart in that of 208Pb. An interesting predictive consequence, the interactions of the Sn region, difficult region to reach experimentally, can be estimated from their corresponding ones constructed to describe the nuclei of the Pb region. Because of the importance of the similarity existing between the spectroscopy of these two regions, we are interested in nuclei with three valence nucleons in the lead and Tin regions on the basis of experimental data (spin, parity and energy states). In this context, the theoretical study is conducted within the shell model using the MSDI interaction for the energy spectra calculations of the studied nuclei. The calculated results are in good agreement with the available experimental data and show evidence that a close resemblance between the spectroscopy of these two regions persists when moving away from the immediate neighbours of doubly magic 132Sn and 208Pb.

  1. 30 CFR 208.4 - Royalty oil sales to eligible refiners. (United States)


    ...) Determination to take royalty oil in kind. The Secretary may evaluate crude oil market conditions from time to... Royalty Oil” required by 30 CFR 208.5. (b) Sale to eligible refiners. (1) Upon a determination by the... some or all of the royalty oil accruing to the United States from oil and gas leases on Federal...

  2. 5 CFR 842.208 - Firefighters, law enforcement officers, and nuclear materials couriers. (United States)


    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Firefighters, law enforcement officers... ANNUITY Eligibility § 842.208 Firefighters, law enforcement officers, and nuclear materials couriers. (a... misconduct, is entitled to an annuity— (1) After completing any combination of service as a...

  3. 44 CFR 208.23 - Allowable costs under Preparedness Cooperative Agreements. (United States)


    ... Cooperative Agreement and any required matching funds under 44 CFR 13.22 and this section to pay reasonable... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Allowable costs under... RESCUE RESPONSE SYSTEM Preparedness Cooperative Agreements § 208.23 Allowable costs under...

  4. Structures excited by heavy ions in 208Pb target. Interpretation involving giant resonances and multiphonon excitations

    International Nuclear Information System (INIS)

    Kinetic energy spectra of heavy fragments from the 36Ar+208Pb reaction at 11 MeV/n and 20Ne+208Pb at 30 MeV/n have been measured with a time of flight spectrometer. Numerous structures ranging up to 100 MeV excitation energy are observed in the inelastic and few nucleon transfer channels. These structures are shown to be due to an excitation of the 208Pb target nucleus and not to decay products of excited ejectiles. Positions of low lying structures (E*208Pb. The linear response of the target nucleus to the external field created by the projectile is calculated microscopically in the Random Phase Approximation resolved using the Green's function method in coordinate space with a Skyrme interaction. In the independant quasi-boson approximation multiple phonon excitations reproduce the main features of the experimental data and appear as a plausible interpretation of the observed structures. The theoretical calculations and experimental observations suggest that multiphonon excitations play an important role in heavy ion reactions and contribute strongly to the kinetic energy dissipation

  5. 31 CFR Appendix A to Part 208 - Model Disclosure for Use Until ETA SM Becomes Available (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Model Disclosure for Use Until ETA SM Becomes Available A Appendix A to Part 208 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT...

  6. 31 CFR Appendix B to Part 208 - Model Disclosure for Use After ETA SM Becomes Available (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Model Disclosure for Use After ETA SM Becomes Available B Appendix B to Part 208 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT...

  7. 48 CFR 253.208-1 - DD Form 448, Military Interdepartmental Purchase Request. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448, Military... DD Form 448, Military Interdepartmental Purchase Request. Follow the procedures at PGI 253.208-1 for use of DD Form 448....

  8. 42 CFR 57.208 - Health professions student loan promissory note and disclosure requirements. (United States)


    ... in Lending Regulation Z (12 CFR part 226). (Approved by the Office of Management and Budget under... 42 Public Health 1 2010-10-01 2010-10-01 false Health professions student loan promissory note and..., SCHOLARSHIPS AND STUDENT LOANS Health Professions Student Loans § 57.208 Health professions student...

  9. 7 CFR 761.208 - Target participation rates for socially disadvantaged groups. (United States)


    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Target participation rates for socially disadvantaged... Farm Loan Programs Funds to State Offices § 761.208 Target participation rates for socially disadvantaged groups. (a) General. (1) The Agency establishes target participation rates for providing FO and...

  10. 49 CFR 24.208 - Aliens not lawfully present in the United States. (United States)


    ... 49 Transportation 1 2010-10-01 2010-10-01 false Aliens not lawfully present in the United States... Requirements § 24.208 Aliens not lawfully present in the United States. (a) Each person seeking relocation... of an individual, that he or she is either a citizen or national of the United States, or an...

  11. Production and identification of new, neutron-rich nuclei in the $^{208}$Pb region

    CERN Document Server

    Rykaczewski, K; Plochocki, A; Karny, M; Szerypo, J; Evensen, A H; Kugler, E; Lettry, Jacques; Ravn, H L; Van Duppen, P; Andreyev, A; Huyse, M; Wöhr, A; Jokinen, A; Äystö, J; Nieminen, A; Huhta, M; Ramdhane, M; Walter, G; Hoff, P


    The recently developed methods allowing the experimental studies on new neutron-rich nuclei beyond doubly-magic $^{208}$Pb are briefly described. An identification of new neutron-rich isotopes $^{215}$Pb and $^{217}$Bi, and new decay properties of $^{216}$Bi studied by means of a pulsed release element selective technique at PS Booster- ISOLDE are reported. (9 refs).

  12. 5 CFR 792.208 - What is the definition of executive agency? (United States)


    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false What is the definition of executive... Legislation and to Whom Does It Apply? § 792.208 What is the definition of executive agency? The term... Accounting Office....

  13. 40 CFR 33.208 - How long does an MBE or WBE certification from EPA last? (United States)


    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false How long does an MBE or WBE... ENVIRONMENTAL PROTECTION AGENCY PROGRAMS Certification § 33.208 How long does an MBE or WBE certification from EPA last? Once EPA OSDBU certifies an entity to be an MBE or WBE by placing it on the EPA OSDBU...

  14. Deuteron excitation of the isoscalar breathing mode resonance in 90Zr, 120Sn, 208Pb

    International Nuclear Information System (INIS)

    With the new 108 MeV deuteron beam of the Orsay synchrocyclotron and the new experimental set up which allow measurements without background for angles as small as 40, a systematic study of the breathing mode has been undertaken and the results on 90Zr, 120Sn and 208Pb are reported

  15. 34 CFR 403.208 - What are the requirements regarding supplanting? (United States)


    ...) OFFICE OF VOCATIONAL AND ADULT EDUCATION, DEPARTMENT OF EDUCATION STATE VOCATIONAL AND APPLIED TECHNOLOGY... Applied Technology Education Program? § 403.208 What are the requirements regarding supplanting? (a) The... 34 Education 3 2010-07-01 2010-07-01 false What are the requirements regarding supplanting?...

  16. Elastic scattering of 17O+208Pb at energies near the Coulomb barrier

    Directory of Open Access Journals (Sweden)

    Torresi D.


    Full Text Available Within the frame of the commissioning of a new experimental apparatus EXPADES we undertook the measurement of the elastic scattering angular distribution for the system 17O+208Pb at energy around the Coulomb barrier. The reaction dynamics induced by loosely bound Radioactive Ion Beams is currently being extensively studied [4]. In particular the study of the elastic scattering process allows to obtain direct information on the total reaction cross section of the exotic nuclei. In order to understand the effect of the low binding energy on the reaction mechanism it is important to compare radioactive weakly bound nuclei with stable strongly-bound nuclei. In this framework the study of the 17O+208Pb elastic scattering can be considered to be complementary to a previous measurement of the total reaction cross section for the system 17F+208Pb at energies of 86, 90.4 MeV [5, 6]. The data will be compared with those obtained for the neighboring systems 16,18O+208Pb and others available in literature.

  17. 21 CFR 208.20 - Content and format of a Medication Guide. (United States)


    ... Section 208.20 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Medication Guide has been approved by the U.S. Food and Drug Administration” shall appear at the bottom of a... specific, important risks are known; (iii) A statement of the risks of the drug product to nursing...

  18. 14 CFR 302.208 - Petitions for oral presentation or judge's decision. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Petitions for oral presentation or judge's... TRANSPORTATION (AVIATION PROCEEDINGS) PROCEDURAL REGULATIONS RULES OF PRACTICE IN PROCEEDINGS Rules Applicable to... Applications § 302.208 Petitions for oral presentation or judge's decision. (a) Any person may file a...

  19. MicroRNA-208b Alleviates Post-Infarction Myocardial Fibrosis in a Rat Model by Inhibiting GATA4 (United States)

    Zhou, Chaoyuan; Cui, Qintao; Su, Guobao; Guo, Xiaoliang; Liu, Xiaochen; Zhang, Jie


    Background Myocardial infarction affects the health of many people. Post-infarction myocardial fibrosis has attracted much attention, but details of the mechanism remain elusive. In this study, the role of microRNA-208b (miR-208b) in modulating post-infarction myocardial fibrosis and the related mechanism were investigated. Material/Methods A rat model of myocardial infarction induced by ligating the left anterior descending artery was used to analyze the expression and roles of miR-208b by overexpression with the lentivirus vector of pre-miR-208b. Myocardial function was assessed and the expression of fibrosis-related factors type I collagen (COL1) and ACTA2 (alias αSMA) was detected. Myocardial fibroblasts isolated from newborn rats were transfected with luciferase reporter vectors containing wild-type or mutant Gata4 3′ UTR to verify the relationship between Gata4 and miR-208b. We then transfected the specific small interference RNA of Gata4 to detect changes in COL1 and ACTA2. Results miR-208b was down-regulated in hearts of model rats (P<0.01). Overexpressing miR-208b improved myocardial functions, such as reducing the infarction area (P<0.05) and promoting LVEF and LVFS (P<0.01), and inhibited COL1 and ACTA2 (P<0.01). Luciferase reporter assay proved Gata4 to be the direct target of miR-208b, with the target sequence in the 3′UTR. Inhibiting GATA4 resulted in the down-regulation of COL1 and ACTA2, suggesting that the role of miR-208b was achieved via regulating GATA4. Conclusions This study demonstrates the protective function of miR-208b via GATA4 in post-infarction myocardial fibrosis, providing a potential therapeutic target for treating myocardial fibrosis. PMID:27236543

  20. Freqüência de dermatoses infecciosas em 208 pacientes transplantados renais Frequency of infectious dermatosis in 208 renal transplant recipients

    Directory of Open Access Journals (Sweden)

    Gérson Vettorato


    Full Text Available FUNDAMENTOS: Nos pacientes transplantados renais, a imunossupressão crônica acarreta maior suscetibilidade às dermatoses infecciosas. OBJETIVOS: avaliar a freqüência de dermatoses infecciosas em 208 pacientes transplantados renais no período de 12 meses e verificar a relação entre sua ocorrência e o período de tempo transcorrido desde o transplante. MÉTODO: 208 transplantados renais de uma população de 720 pacientes foram submetidos a exame dermatológico no período de um ano, tendo sido realizados exames anatomopatológico micológico, bacteriológico e/ou cultural das lesões suspeitas. RESULTADOS: a freqüência de dermatoses infecciosas nessa população foi de 89,4%. As infecções fúngicas, virais, bacterianas e parasitárias mais freqüentes foram pitiríase versicolor (17,8%, verruga vulgar (32,2%, foliculite (4,3% e escabiose (3,8%. CONCLUSÃO: as dermatoses infecciosas são freqüentes nos pacientes transplantados renais, e sua ocorrência aumenta progressivamente conforme o tempo transcorrido a partir do transplante, sendo importante o acompanhamento dermatológico desses pacientes.BACKGROUND: Chronic immunosuppressive therapy predisposes renal transplant recipients to a heightened susceptibility to infectious dermatoses. OBJECTIVES: evaluate the frequency of infectious dermatoses in 208 renal transplant recipients over a 12-month period and verify the relation between the onset of dermatoses and the time elapsed since transplantation. METHOD: 208 renal transplant recipients, taken from a population of 720 transplant recipients, received a dermatological examination for a year. Dermatopathological examination, mycological examination, bacteriologic examination, and cultures were taken from suspected lesions. RESULTS: the prevalence of infectious dermatosis was 89.4% in this population. The more frequent fungal, viral and bacterial infections were respectively pitiyriasis versicolor (17.8%, warts (32.2%, and folliculitis

  1. Schottky mass measurement of the 208Hg isotope: implication for the proton-neutron interaction strength around doubly magic 208Pb. (United States)

    Chen, L; Litvinov, Yu A; Plass, W R; Beckert, K; Beller, P; Bosch, F; Boutin, D; Caceres, L; Cakirli, R B; Carroll, J J; Casten, R F; Chakrawarthy, R S; Cullen, D M; Cullen, I J; Franzke, B; Geissel, H; Gerl, J; Górska, M; Jones, G A; Kishada, A; Knöbel, R; Kozhuharov, C; Litvinov, S A; Liu, Z; Mandal, S; Montes, F; Münzenberg, G; Nolden, F; Ohtsubo, T; Patyk, Z; Podolyák, Zs; Propri, R; Rigby, S; Saito, N; Saito, T; Scheidenberger, C; Shindo, M; Steck, M; Ugorowski, P; Walker, P M; Williams, S; Weick, H; Winkler, M; Wollersheim, H-J; Yamaguchi, T


    Time-resolved Schottky mass spectrometry has been applied to uranium projectile fragments which yielded the mass value for the 208Hg (Z=80, N=128) isotope. The mass excess value of ME=-13 265(31) keV has been obtained, which has been used to determine the proton-neutron interaction strength in 210Pb, as a double difference of atomic masses. The results show a dramatic variation of the strength for lead isotopes when crossing the N=126 neutron shell closure, thus confirming the empirical predictions that this interaction strength is sensitive to the overlap of the wave functions of the last valence neutrons and protons. PMID:19392270

  2. miR-208-3p promotes hepatocellular carcinoma cell proliferation and invasion through regulating ARID2 expression

    International Nuclear Information System (INIS)

    MicroRNAs (miRNAs) are small non-coding RNAs that negatively regulate gene expression at post-transcriptional level. miRNA dysregulation plays a causal role in cancer progression. In this study, miR-208-3p was highly expressed and directly repressed ARID2 expression. As a result, ARID2 expression in hepatocellular carcinoma (HCC) was decreased. In vitro, miR-208-3p down-regulation and ARID2 over-expression elicited similar inhibitory effects on HCC cell proliferation and invasion. In vivo test results revealed that miR-208-3p down-regulation inhibited HCC tumorigenesis in Hep3B cells. Moreover, ARID2 was possibly a downstream element of transforming growth factor beta1 (TGFβ1)/miR-208-3p/ARID2 regulatory pathway. These findings suggested that miR-208-3p up-regulation is associated with HCC cell progression and may provide a new target for liver cancer treatment. - Highlights: • miR-208-3p was highly expressed and directly repressed the expression of ARID2 in HCC. • miR-208-3p contributed to HCC cell progression both in vitro and in vivo. • Over-expression of ARID2 inhibited the HCC cell proliferation and invasion. • Restoration of ARID2 partly reversed the the effect of miR-208-3p down-regulation on HCC cells. • Newly regulatory pathway: miR-208-3p mediated the repression of ARID2 by TGFβ1 in HCC cells

  3. Intratumoral estrogen sulfotransferase induction contributes to the anti-breast cancer effects of the dithiocarbamate derivative TM208 (United States)

    Ji, Xi-wei; Chen, Guang-ping; Song, Yan; Hua, Ming; Wang, Li-jie; Li, Liang; Yuan, Yin; Wang, Si-yuan; Zhou, Tian-yan; Lu, Wei


    Aim: Sulfotransferase-catalyzed sulfation is the most important pathway for inactivating estrogens. Thus, activation of estrogen sulfotransferase (EST) may be an alternative approach for the treatment of estrogen-dependent breast cancer. In this study we investigated the involvement of EST in anti-breast cancer effects of the dithiocarbamate derivative TM208 in vitro and in vivo. Methods: The viability of human breast cancer MCF-7 cells was determined using a SBB assay. Nude mice bearing MCF-7 cells were orally administered TM208 (50 and 150 mg·kg−1·d−1) for 18 days. The xenograft tumors and uteri were collected. The mRNA expression of EST was examined with real-time PCR. EST protein was detected with Western blot, ELISA or immunohistochemical staining assays. A radioactive assay was used to measure the EST activity. Uterotropic bioassay was used to examine the uterine estrogen responses. Results: Treatment with TM208 (10, 15 and 20 μmol/L) concentration-dependently increased EST expression in MCF-7 cells in vitro. Co-treatment with triclosan, an inhibitor of sulfonation, abolished TM208-induced cytotoxicity in MCF-7 cells. TM208 exhibited an apparent anti-estrogenic property: it exerted more potent cytotoxicity in E2-treated MCF-7 cells. In the nude mice bearing MCF-7 cells, TM208 administration time-dependently increased the expression and activity of EST, and blocked the gradual increase of E2 concentration in the xenograft tumors. Furthermore, TM208 administration blocked the estrogens-stimulated uterine enlargement. Tamoxifen, a positive control drug, produced similar effects on the expression and activity of EST in vitro and in vivo. Conclusion: The induction of EST and reduction of estrogen concentration contribute to the anti-breast cancer action of TM208 and tamoxifen. TM208 may be developed as anticancer drug for the treatment of estrogen receptor-positive breast cancer. PMID:25937633

  4. miR-208-3p promotes hepatocellular carcinoma cell proliferation and invasion through regulating ARID2 expression

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Peng; Wu, Dingguo; You, Yu; Sun, Jing; Lu, Lele; Tan, Jiaxing; Bie, Ping, E-mail:


    MicroRNAs (miRNAs) are small non-coding RNAs that negatively regulate gene expression at post-transcriptional level. miRNA dysregulation plays a causal role in cancer progression. In this study, miR-208-3p was highly expressed and directly repressed ARID2 expression. As a result, ARID2 expression in hepatocellular carcinoma (HCC) was decreased. In vitro, miR-208-3p down-regulation and ARID2 over-expression elicited similar inhibitory effects on HCC cell proliferation and invasion. In vivo test results revealed that miR-208-3p down-regulation inhibited HCC tumorigenesis in Hep3B cells. Moreover, ARID2 was possibly a downstream element of transforming growth factor beta1 (TGFβ1)/miR-208-3p/ARID2 regulatory pathway. These findings suggested that miR-208-3p up-regulation is associated with HCC cell progression and may provide a new target for liver cancer treatment. - Highlights: • miR-208-3p was highly expressed and directly repressed the expression of ARID2 in HCC. • miR-208-3p contributed to HCC cell progression both in vitro and in vivo. • Over-expression of ARID2 inhibited the HCC cell proliferation and invasion. • Restoration of ARID2 partly reversed the the effect of miR-208-3p down-regulation on HCC cells. • Newly regulatory pathway: miR-208-3p mediated the repression of ARID2 by TGFβ1 in HCC cells.

  5. Time-dependent Hartree-Fock calculations for multinucleon transfer processes in $^{40, 48}$Ca+$^{124}$Sn, $^{40}$Ca+$^{208}$Pb, and $^{58}$Ni+$^{208}$Pb reactions

    CERN Document Server

    Sekizawa, Kazuyuki


    Multinucleon transfer processes in heavy-ion reactions at energies slightly above the Coulomb barrier are investigated in a fully microscopic framework of the time-dependent Hartree-Fock (TDHF) theory. Transfer probabilities are calculated from the TDHF wave function after collision using the projection operator method which has recently been proposed by Simenel (C. Simenel, Phys. Rev. Lett. 105, 192701 (2010)). We show results of the TDHF calculations for transfer cross sections of the reactions of $^{40,48}$Ca+$^{124}$Sn at $E_{lab}=$ 170, 174 MeV, $^{40}$Ca+$^{208}$Pb at $E_{lab}=$ 235, 249 MeV, and $^{58}$Ni+$^{208}$Pb at $E_{lab}=$ 328.4 MeV, for which measurements are available. We find the transfer processes show different behaviors depending on the $N/Z$ ratios of the projectile and the target, and the product of the charge numbers, $Z_P Z_T$. When the projectile and the target have different $N/Z$ ratios, fast transfer processes of a few nucleons towards the charge equilibrium of the initial system o...

  6. Event by Event Analysis of High Multiplicity Events Produced in 158 A GeV/c 208 Pb- 208 Pb Collisions

    CERN Document Server

    Ahmad, Shakeel; Kumar, Ashwini; Chaturvedi, O S K; Ahmad, A; Zafar, M; Irfan, M; Singh, B K


    An extensive analysis of individual high multiplicity events produced in 158 A GeV /c 208Pb- 208Pb collisions is carried by adopting different methods to examine the anomalous behavior of these rare events. A method of selecting the events with densely populated narrow regions or spikes out of a given sample of collision events is discussed.Employing this approach two events with large spikes in their eta- and phi- distributions are selected for further analysis. For the sake of comparison, another two events which do not exhibit such spikes are simultaneously analyzed. The findings suggest that the systematic studies of particle density fluctuations in one- and two-dimensional phase-spaces and comparison with those obtained from the studies of correlation free Monte Carlo events, would be useful for identifying the events with large dynamical fluctuations. Formation of clusters or jet like phenomena in multihadronic final states in individual events is also discussed and the experimental findings are compare...

  7. All-Solid-State Multi-wavelength Laser System from 208 to 830 nm

    Institute of Scientific and Technical Information of China (English)

    ZHAO Shang-Hong; CHEN Guo-Fu; ZHAO Wei; WANG Yi-Shan; YU Lian-Jun


    Four-wavelength lasers from the near-infrared to deep-ultraviolet range, 532, 830, 415 and 208nm, have been developed in one all-solid-state laser system. The laser system is pumped by a diode-Q-YLF laser at 532nm,a Ti:sapphire laser, and the nonlinear second-harmonic-generation crystals LBO and BBO are used to generate different wavelengths. Maximum average powers (repetition rate 1 kHz) of 1.1 W at 830nm, 380m W at 415nm and 39mW at 208nm are obtained when the pumping power is 3.6 W. The main characteristics of this system are presented.

  8. Broad spectrum moderators and advanced reflector filters using 208Pb

    DEFF Research Database (Denmark)

    Schönfeldt, Troels; Batkov, K.; Klinkby, Esben Bryndt;


    Cold and thermal neutrons used in neutrons scattering experiments are produced in nuclear reactors and spallation sources. The neutrons are cooled to thermal or cold temperatures in thermal and cold moderators, respectively. The present study shows that it is possible to exploit the poor...... thermalizing property of 208Pb to design a broad spectrum moderator, i.e. a moderator which emits thermal and cold neutrons from the same position. Using 208Pb as a reflector filter material is shown to be slightly less efficient than a conventional beryllium reflector filter. However, when surrounding the...... reflector filter by a cold moderator it is possible to regain the neutrons with wavelengths below the Bragg edge, which are suppressed in the beryllium reflector filter. In both the beryllium and lead case surrounding the reflector filter with a cold moderator increases the cold brightness significantly...

  9. A semiclassical estimate of the Coulomb excitation of the giant dipole resonance in 208 Pb

    International Nuclear Information System (INIS)

    A semiclassical approach to study pure Coulomb excitation of 208 Pb giant dipole isovector resonance is examined. Medium energy projectiles are considered and also the target excitation to be described by a simple Goldhaber-Teller model is assumed. It is shown that the main features concerning the angular distribution are obtained in the angular range described by the model and an estimate is made of the pure Coulomb dipole contribution to the measured cross sections. (author)

  10. Influence of Shell on Pre-scission Particle Emission of a Doubly Magic Nucleus 208Pb

    Institute of Scientific and Technical Information of China (English)

    YE Wei


    Using Smoluchowski equation, we study the shell effects on the emission of light particles in the fission process of a doubly magic nucleus 208 pb. Calculated results show that shell has a considerable effect on the neutron emission and that shell effect gradually becomes weak with increasing excitation energy. In addition, a dependence of shell effects in the neutron emission on the angular momentum has been found.

  11. Lowered fusion cross section in the quadruply magic heavy-ion system 48Ca+208Pb

    International Nuclear Information System (INIS)

    The results of radioanalytical mass yield distribution studies of the reaction of 48Ca with thick 208Pb targets at the effective laboratory energies of 255 and 300 MeV are reported. Complete fusion cross sections are found to be significantly lower than those found for 40Ar induced reactions with non-magic targets apparently showing the effect of the projectile and target nuclear structure on such cross sections. (Auth.)

  12. Forward angle measurements of 60 MeV/nucleon 40Ar peripheral interactions on 208Pb

    International Nuclear Information System (INIS)

    Velocity and angular distributions of projectile-like fragments were measured between θlab = O0 and 40 (inside the grazing angle) for the 40Ar + 208Pb system at 60 MeV/nucleon using a magnetic spectrometer. Velocity spectra are similar to those obtained at larger angles while the angular distributions, very forward peaked for light nuclei, tend to become flat for the heaviest fragments. The influence of the Coulomb and nuclear deflection of the fragments is discussed

  13. Is thyroid stunning clinically relevant? A retrospective analysis of 208 patients


    ELBA C. S. C. ETCHEBEHERE; Santos, Allan O.; de Matos, Patrícia S.; Lígia V. M. Assumpção; Maria Cecília V. L. Lima; Mariana C.L. Lima; Laura S. Ward


    Objective : Current guidelines have advised against the performance of 131I-iodide diagnostic whole body scintigraphy (dxWBS) to minimize the occurrence of stunning, and to guarantee the efficiency of radioiodine therapy (RIT). The aim of the study was to evaluate the impact of stunning on the efficacy of RIT and disease outcome.Subjects and methods : This retrospective analysis included 208 patients with differentiated thyroid cancer managed according to a same protocol and followed up for 1...

  14. A simple functional form for proton-208Pb total reaction cross sections

    International Nuclear Information System (INIS)

    A simple functional form has been found that gives a good representation of the total reaction cross sections for the scattering from 208Pb of protons with energies in the range 30 to 300 MeV. The ratios of the total reaction cross sections calculated under this approximations compared well (to within a few percent) to those determined from the microscopic optical model potentials

  15. Constraints on neutron skin thickness in 208Pb and density-dependent symmetry energy

    CERN Document Server

    Dong, Jianmin; Gu, Jianzhong


    Accurate knowledge about the neutron skin thickness $\\Delta R_{np}$ in $^{208}$Pb has far-reaching implications for different communities of nuclear physics and astrophysics. Yet, the novel Lead Radius Experiment (PREX) did not yield stringent constraint on the $\\Delta R_{np}$ recently. We employ a more practicable strategy currently to probe the neutron skin thickness of $^{208}$Pb based on a high linear correlation between the $\\Delta R_{np}$ and $J-a_{\\text{sym}}$, where $J$ and $a_{\\text{sym}}$ are the symmetry energy (coefficient) of nuclear matter at saturation density and of $^{208}$Pb. An accurate $J-a_{\\text{sym}}$ thus places a strong constraint on the $\\Delta R_{np}$. Compared with the parity-violating asymmetry $A_{\\text{PV}}$ in the PREX, the reliably experimental information on the $J-a_{\\text{sym}}$ is much more easily available attributed to a wealth of measured data on nuclear masses and on decay energies. The density dependence of the symmetry energy is also well constrained with the $J-a_{\\...

  16. Void effect analysis of Pb-208 of fast reactors with modified CANDLE burn-up scheme

    Energy Technology Data Exchange (ETDEWEB)

    Widiawati, Nina, E-mail:; Su’ud, Zaki, E-mail: [Nuclear Physics and Biophysics Research Group, Faculty of Mathematics and Natural Science, Bandung Institute of Technology Jalan Ganesha 10, Bandung (Indonesia)


    Void effect analysis of Pb-208 as coolant of fast reactors with modified candle burn-up scheme has been conducted. Lead cooled fast reactor (LFR) is one of the fourth-generation reactor designs. The reactor is designed with a thermal power output of 500 MWt. Modified CANDLE burn-up scheme allows the reactor to have long life operation by supplying only natural uranium as fuel cycle input. This scheme introducing discrete region, the fuel is initially put in region 1, after one cycle of 10 years of burn up it is shifted to region 2 and region 1 is filled by fresh natural uranium fuel. The reactor is designed for 100 years with 10 regions arranged axially. The results of neutronic calculation showed that the void coefficients ranged from −0.6695443 % at BOC to −0.5273626 % at EOC for 500 MWt reactor. The void coefficients of Pb-208 more negative than Pb-nat. The results showed that the reactors with Pb-208 coolant have better level of safety than Pb-nat.

  17. Void effect analysis of Pb-208 of fast reactors with modified CANDLE burn-up scheme (United States)

    Widiawati, Nina; Su'ud, Zaki


    Void effect analysis of Pb-208 as coolant of fast reactors with modified candle burn-up scheme has been conducted. Lead cooled fast reactor (LFR) is one of the fourth-generation reactor designs. The reactor is designed with a thermal power output of 500 MWt. Modified CANDLE burn-up scheme allows the reactor to have long life operation by supplying only natural uranium as fuel cycle input. This scheme introducing discrete region, the fuel is initially put in region 1, after one cycle of 10 years of burn up it is shifted to region 2 and region 1 is filled by fresh natural uranium fuel. The reactor is designed for 100 years with 10 regions arranged axially. The results of neutronic calculation showed that the void coefficients ranged from -0.6695443 % at BOC to -0.5273626 % at EOC for 500 MWt reactor. The void coefficients of Pb-208 more negative than Pb-nat. The results showed that the reactors with Pb-208 coolant have better level of safety than Pb-nat.

  18. Lead containing mainly isotope 208Pb. New neutron moderator, coolant and reflector for innovative nuclear reactors

    International Nuclear Information System (INIS)

    As a rule materials of small atomic weight (light and heavy water, graphite and so on) are used as neutron moderators and reflectors. A new very heavy atomic weight moderator is proposed - radiogenic lead consisting mainly of isotope 208Pb. It is characterized by extremely low neutron radioactive capture cross-section (0.23 mbarn for thermal neutrons, i.e. less than that for graphite and deuterium) and highest albedo of thermal neutrons. It is evaluated that use of the radiogenic lead enables a slowing of the chain reaction of prompt neutrons in a fast reactor. This can increase safety of the fast reactor as well reduce requirements pertaining to the technology of its fuel fabrication. Radiogenic lead with high 208Pb content as a liquid metal coolant of fast reactors helps to achieve a favorable (negative) coolant temperature reactivity coefficient. It is noteworthy that radiogenic lead with a large 208Pb content may be extracted from thorium (as well thorium-uranium) ores without isotope separation. This has been confirmed experimentally by an investigation performed at San Paula University, Brazil. (author)

  19. The First Outbreak Caused by Acinetobacter baumannii ST208 and ST195 in China

    Directory of Open Access Journals (Sweden)

    Junyan Qu


    Full Text Available This study aimed to analyze the clinical characteristics of patients and molecular mechanisms of the first outbreak mainly caused by sequence types (STs 208 multidrug resistant (MDR Acinetobacter baumannii in China. A total of 10 clinical samples were collected from 5 patients who were involved in the outbreak. Bacterial identification and antibiotic sensitivity tests were performed by the VITEK-2 COMPACT automated system. MICs of tigecycline for clinical isolates were determined using broth microdilution. The clonal relatedness of A. baumannii clinical isolates in our local settings was determinated by pulsed-field gel electrophoresis (PFGE and multilocus sequence typing (MLST. A total of 7 A. baumannii strains were isolated and all were MDR strains; two of them were carbapenem-nonsusceptible strains. blaOXA-23 was the only acquired carbapenemase gene in the isolates. The isolates belonged to a single clonal pulsotype determined by PFGE and two sequences types (STs determined by MLST. The isolates belonged to the globally disseminated clonal complex 92, among which ST195 and ST208 were the most common sequence types (71.43% and 28.57%. The outbreak was successfully controlled by stringent infection control measures, especially improving the hand hygiene compliance and enhancing antimicrobial stewardship. In conclusion, this is the first description of an outbreak caused mainly by A. baumannii of ST208 in China. Infection control measures should be strengthened when infection outbreaks in hospital.

  20. The First Outbreak Caused by Acinetobacter baumannii ST208 and ST195 in China (United States)

    Qu, Junyan; Du, Yu


    This study aimed to analyze the clinical characteristics of patients and molecular mechanisms of the first outbreak mainly caused by sequence types (STs) 208 multidrug resistant (MDR) Acinetobacter baumannii in China. A total of 10 clinical samples were collected from 5 patients who were involved in the outbreak. Bacterial identification and antibiotic sensitivity tests were performed by the VITEK-2 COMPACT automated system. MICs of tigecycline for clinical isolates were determined using broth microdilution. The clonal relatedness of A. baumannii clinical isolates in our local settings was determinated by pulsed-field gel electrophoresis (PFGE) and multilocus sequence typing (MLST). A total of 7 A. baumannii strains were isolated and all were MDR strains; two of them were carbapenem-nonsusceptible strains. blaOXA-23 was the only acquired carbapenemase gene in the isolates. The isolates belonged to a single clonal pulsotype determined by PFGE and two sequences types (STs) determined by MLST. The isolates belonged to the globally disseminated clonal complex 92, among which ST195 and ST208 were the most common sequence types (71.43% and 28.57%). The outbreak was successfully controlled by stringent infection control measures, especially improving the hand hygiene compliance and enhancing antimicrobial stewardship. In conclusion, this is the first description of an outbreak caused mainly by A. baumannii of ST208 in China. Infection control measures should be strengthened when infection outbreaks in hospital. PMID:27144176

  1. Symmetry energy at subsaturation densities and the neutron skin thickness of 208Pb (United States)

    Fan, XiaoHua; Dong, JianMin; Zuo, Wei


    The mass-dependent symmetry energy coefficients a sym(A) has been extracted by analysing the heavy nuclear mass differences reducing the uncertainties as far as possible in our previous work. Taking advantage of the obtained symmetry energy coefficient a sym(A) and the density profiles obtained by switching off the Coulomb interaction in 208Pb, we calculated the slope parameter L 0.11 of the symmetry energy at the density of 0.11 fm-3. The calculated L 0.11 ranges from 40.5 MeV to 60.3 MeV. The slope parameter L 0.11 of the symmetry energy at the density of 0.11 fm-3 is also calculated directly with Skyrme interactions for nuclear matter and is found to have a fine linear relation with the neutron skin thickness of 208Pb, which is the difference of the neutron and proton rms radii of the nucleus. With the linear relation the neutron skin thickness Δ R np of 208Pb is predicted to be 0.15-0.21 fm.

  2. Symmetry energy at subsaturation densities and the neutron skin thickness of 208Pb

    CERN Document Server

    Fan, Xiaohua; Zuo, Wei


    The mass-dependent symmetry energy coefficients $a_{sym}(A)$ has been extracted by analysing the heavy nuclear mass differences reducing the uncertainties as far as possible in our previous work. Taking advantage of the obtained symmetry energy coefficient $a_{sym}(A)$ and the density profiles obtained by switching off the Coulomb interaction in $^{208}\\text{Pb}$, we calculated the slope parameter $L_{0.11}$ of the symmetry energy at the density of $0.11\\text{fm}^{-3}$. The calculated $L_{0.11}$ ranges from 40.5 MeV to 60.3 MeV. The slope parameter $L_{0.11}$ of the symmetry energy at the density of $0.11\\text{fm}^{-3}$ is also calculated directly with Skyrme interactions for nuclear matter and is found to have a fine linear relation with the neutron skin thickness of $^{208}\\text{Pb}$, which is the difference of the neutron and proton rms radii of the nucleus. With the linear relation the neutron skin thickness $ \\Delta R_{np} $ of $^{208}\\text{Pb}$ is predicted to be 0.15 - 0.21 fm.

  3. Electric Dipole Polarizability in ${}^{208}$Pb: insights from the Droplet Model

    CERN Document Server

    Roca-Maza, X; Viñas, X; Brenna, M; Colò, G; Agrawal, B K; Paar, N; Piekarewicz, J; Vretenar, D


    We study the electric dipole polarizability $\\alpha_D$ in ${}^{208}$Pb based on the predictions of a large and representative set of relativistic and non-relativistic nuclear mean field models. We adopt the droplet model as a guide to better understand the correlations between $\\alpha_D$ and other isovector observables. Insights from the droplet model suggest that the product of $\\alpha_D$ and the nuclear symmetry energy at saturation density $J$ is much better correlated with the neutron skin thickness $\\Delta r_{np}$ of ${}^{208}$Pb than the polarizability alone. Correlations of $\\alpha_D J$ with $\\Delta r_{np}$ and with the slope of the symmetry energy $L$ suggest that $\\alpha_D J$ is a strong isovector indicator. Hence, we explore the possibility of constraining the isovector sector of thenuclear energy density functional by comparing our theoretical predictions against measurements of both $\\alpha_D$ and the parity-violating asymmetry in ${}^{208}$Pb. We find that the recent experimental determination of...

  4. Evaluation of SD-208, a TGF-β-RI Kinase Inhibitor, as an Anticancer Agent in Retinoblastoma. (United States)

    Fadakar, Puran; Akbari, Abolfazl; Ghassemi, Fariba; Mobini, Gholam Reza; Mohebi, Masoumeh; Bolhassani, Manzar; Abed Khojasteh, Hoda; Heidari, Mansour


    Retinoblastoma is the most common intraocular tumor in children resulting from genetic alterations and transformation of mature retinal cells. The objective of this study was to investigate the effects of SD-208, TGF-β-RI kinase inhibitor, on the expression of some miRNAs including a miR-17/92 cluster in retinoblastoma cells. Prior to initiate this work, the cell proliferation was studied by Methyl Thiazolyl Tetrazolium (MTT) and bromo-2'-deoxyuridine (BrdU) assays. Then, the expression patterns of four miRNAs (18a, 20a, 22, and 34a) were investigated in the treated SD-208 (0.0, 1, 2 and 3 µM) and untreated Y-79 cells. A remarkable inhibition of the cell proliferation was found in Y-79 cells treated with SD-208 versus untreated cells. Also, the expression changes were observed in miRNAs 18a, 20a, 22 and 34a in response to SD-208 treatment (Pretinoblastoma cell line. To the best of the researchers' knowledge, this is the first report demonstrating that the SD-208 could alter the expression of tumor suppressive miRNAs as well as oncomiRs in vitro. In conclusion, the present data suggest that SD-208 could be an alternative agent in retinoblastoma treatment. PMID:27306340

  5. Analysis of 208 Cases of Hand Foot and Mouth Disease%208例手足口病临床分析

    Institute of Scientific and Technical Information of China (English)



    目的分析我院手足口病的临床特点、治疗方法及预防措施。方法采集我院2008年5月~2011年12月住院的手足口病患儿208例进行临床分析。结果手足口病多发于<3岁儿童,多发生于5~7月份,临床以手、足、口、臀等部位皮肤、粘膜的斑丘疹或疱疹为主要特征。所有病例均治愈出院。结论手足口病大多临床表现症状轻,预后良好。少数患儿病情进展快,出现重症病例。早发现、早诊断、早隔离、早治疗是防治手足口病的关键。%Objective Clinical characteristics, treatment and prevention of hand foot and mouth disease. Methods Col ected from May to 2011 December in our hospital in 2008 HFMD patients clinical analysis of 208 cases. Results Foot and mouth disease often occurred in children under 3 years old, occurs in 5 to July, clinical by the hand, foot, mouth, but ocks and other parts of skin, mucous membrane spot papula or herpes as the main feature. Al patients were cured and discharged. Conclusion Hand foot and mouth disease are symptoms of light, the prognosis is good. A few children with the disease progress quickly, severe cases. Early discovery, early diagnosis, early isolation, early treatment is the key to prevention of hand foot and mouth disease.

  6. Neutron density distributions from antiprotonic 208Pb and 209Bi atoms


    Klos, B.; Trzcinska, A.; Jastrzebski, J.; Czosnyka, T.; Kisielinski, M.; Lubinski, P.; Napiorkowski, P.; Pienkowski, L.; Hartmann, F. J.; Ketzer, B.; Ring, P.; Schmidt, R.; von Egidy, T.; Smolanczuk, R.; S. Wycech


    The X-ray cascade from antiprotonic atoms was studied for 208Pb and 209Bi. Widths and shifts of the levels due to the strong interaction were determined. Using modern antiproton-nucleus optical potentials the neutron densities in the nuclear periphery were deduced. Assuming two parameter Fermi distributions (2pF) describing the proton and neutron densities the neutron rms radii were deduced for both nuclei. The difference of neutron and proton rms radii /\\r_np equal to 0.16 +-(0.02)_{stat} +-...

  7. On dipole polarization of deuteron for the scattering by 208 Pb

    International Nuclear Information System (INIS)

    The dipole polarization of deuteron by Coulomb field is studied by means of the algebraic version of the resonating group method. The simple asymptotic equations are obtained for the Fourier coefficients of the oscillator basis expansion. These equations describe the dynamics of the behaviour of the polarization deuteron far from the Coulomb center. As a specific application, the scattering of deuteron by Coulomb potential of 208 Pb is considered. The wave functions are built for different energies. The energy dependence of the elastic scattering phase-shift and of the inelasticity factor is found. The differential cross sections for different angles are compared with experimental data

  8. Escape and spreading properties of charge-exchange resonances in 208Bi

    International Nuclear Information System (INIS)

    The properties of charge-exchange excitations of 208Pb with ΔL = 0, i.e., the isobaric analog and Gamow-Teller resonances, are studied within a self-consistent model making use of an effective force of the Skyrme type. The well-known isobaric analog case is used to assess the reliability of the model. The calculated properties of the Gamow-Teller resonance are compared with recent experimental measurements with the aim of better understanding the microscopic structure of this mode. (authors). 30 refs., 5 figs., 6 tabs

  9. Measurement of the Neutron Radius of 208Pb Through Parity-Violation in Electron Scattering

    CERN Document Server

    Abrahamyan, S; Albataineh, H; Aniol, K; Armstrong, D S; Armstrong, W; Averett, T; Babineau, B; Barbieri, A; Bellini, V; Beminiwattha, R; Benesch, J; Benmokhtar, F; Bielarski, T; Boeglin, W; Camsonne, A; Canan, M; Carter, P; Cates, G D; Chen, C; Chen, J -P; Hen, O; Cusanno, F; Dalton, M M; De Leo, R; de Jager, K; Deconinck, W; Decowski, P; Deng, X; Deur, A; Dutta, D; Etile, A; Flay, D; Franklin, G B; Friend, M; Frullani, S; Fuchey, E; Garibaldi, F; Gasser, E; Gilman, R; Giusa, A; Glamazdin, A; Gomez, J; Grames, J; Gu, C; Hansen, O; Hansknecht, J; Higinbotham, D W; Holmes, R S; Holmstrom, T; Horowitz, C J; Hoskins, J; Huang, J; Hyde, C E; Itard, F; Jen, C -M; Jensen, E; Jin, G; Johnston, S; Kelleher, A; Kliakhandler, K; King, P M; Kowalski, S; Kumar, K S; Leacock, J; Leckey, J; Lee, J H; LeRose, J J; Lindgren, R; Liyanage, N; Lubinsky, N; Mammei, J; Mammoliti, F; Margaziotis, D J; Markowitz, P; McCreary, A; McNulty, D; Mercado, L; Meziani, Z -E; Michaels, R W; Mihovilovic, M; Muangma, N; Muñoz-Camacho, C; Nanda, S; Nelyubin, V; Nuruzzaman, N; Oh, Y; Palmer, A; Parno, D; Paschke, K D; Phillips, S K; Poelker, B; Pomatsalyuk, R; Posik, M; Puckett, A J R; Quinn, B; Rakhman, A; Reimer, P E; Riordan, S; Rogan, P; Ron, G; Russo, G; Saenboonruang, K; Saha, A; Sawatzky, B; Shahinyan, A; Silwal, R; Sirca, S; Slifer, K; Solvignon, P; Souder, P A; Sperduto, M L; Subedi, R; Suleiman, R; Sulkosky, V; Sutera, C M; Tobias, W A; Troth, W; Urciuoli, G M; Waidyawansa, B; Wang, D; Wexler, J; Wilson, R; Wojtsekhowski, B; Yan, X; Yao, H; Ye, Y; Ye, Z; Yim, V; Zana, L; Zhan, X; Zhang, J; Zhang, Y; Zheng, X; Zhu, P


    We report the first measurement of the parity-violating asymmetry A_PV in the elastic scattering of polarized electrons from 208Pb. A_PV is sensitive to the radius of the neutron distribution (Rn). The result A_PV = 0.656 \\pm 0.060 (stat) \\pm 0.013 (syst) corresponds to a difference between the radii of the neutron and proton distributions Rn - Rp = 0.33 +0.16 -0.18 fm and provides the first electroweak observation of the neutron skin which is expected in a heavy, neutron-rich nucleus.

  10. Elastic scattering of 9Li on 208Pb at energies around the Coulomb barrier

    International Nuclear Information System (INIS)

    We have studied the dynamical effects of the halo structure of 11Li on the scattering on heavy targets at energies around the Coulomb barrier. This experiment was performed at ISAC-II at TRIUMF with a world record in production of the post-accelerated 11Li beam. As part of this study we report here on the first measurement of the elastic cross section of the core nucleus, i.e. 9Li on 208Pb, at energies around the Coulomb barrier. A preliminary optical model analysis has been performed in order to extract a global optical potential to describe the measured angular distributions.

  11. Elastic ion scattering of 40Ca and 48Ca by 208Pb nuclei

    International Nuclear Information System (INIS)

    The elastic ion scattering of 40Ca and 40Ar at 302 MeV and of 48Ca and 48Ti at 252 MeV by 208Pb nuclei has been investigated. The data obtained have been analyzed in terms of the classical model for elastic scattering. The distances of closest approach for classical Rutherford trajectories have been measured for 40Ca and 48Ca to differ by 0.19 fm, which corresponds to the normal radius growth defined by the function R approximately r0Asup(1/3)

  12. Surface Diffuseness Anomaly in 16O+208pb Quasi-elastic Scattering at Backward Angle

    Institute of Scientific and Technical Information of China (English)

    JIA Hui-Ming; XU Xin-Xing; BAI Chun-Lin; YU Ning; LIN Cheng-Jian; ZHANG Huan-Qiao; LIU Zu-Hua; YANG Feng; JIA Fei; ZHANG Chun-Lei; AN Guang-Peng; WU Zhen-Dong


    @@ The quasi-elastic scattering excitation function of the doubly magic 16O+208pb system at a backward angle is measured at sub-barrier energies with high precision. The diffuseness parameters extracted from both the single-channel and the coupled-channels calculations give almost the same value α = 0.76±0.04 fm. The results show that the coupling effect is negligible for the spherical system. The obtained value is smaller than the extracted value from the fusion excitation function, but larger than the value of α = 0.63 fm, which is from the systematic analysis of elastic scattering data.

  13. Effect of nuclear matter incompressibility on the +Pb208O16 system (United States)

    Ghodsi, O. N.; Torabi, F.


    To analyze the property of nuclear matter in the +Pb208O16 collision system, the internuclear potential of the fusion reaction is calculated by using the Skyrme forces associated with an extensive nuclear matter incompressibility K range in the semiclassical energy-density formalism. Comparison of the experimental fusion cross sections and those obtained by using potentials derived from different forces with various K values shows that the incompressibility of nuclear matter changes during the fusion process at different bombarding energies. The results indicate that, as the energy increases, the nuclear matter becomes more incompressible.

  14. Recovery of lead-208 radiogenic of residues of thorium with rare earth

    International Nuclear Information System (INIS)

    In the middle of the years 1970 in IPEN, considerable work for the purification and conversion of uranium and thorium project, the production of thorium nitrate, a pilot scale from different compounds of Thorium was accomplished; This installation of thorium nitrate produced for national marketing, given the industry of incandescent lighting gas mangles.. The method used by this installation was the purification by solvent extraction with pulsed columns. The thorium was in the organic phase, which was reversed as of thorium nitrate with a high degree of purity. The aqueous phase of this chemical process, containing impurities, some not extracted thorium and virtually all rare earths was precipitated in the form of a hydroxide. This was called RETOTER hydroxide (residue of Thorium and Rare Earth). This residue containing thorium, rare earth and some impurities such as lead-208 product of the decay of thorium-232 were stored in the shed of safeguarding IPEN for further recovery of thorium and rare earth. In this work was studied the recovery of lead-208, nuclear material of interest, separating it by the technique of cementation , where it adds zinc metallic to an acid solution of RETOTER, holding up the lead on the surface of the metallic zinc. (author)

  15. The role of doubly magic 208Pb and its neighbour nuclei in cluster radioactivity

    International Nuclear Information System (INIS)

    Using the Coulomb and proximity potential model (CPPM) we have investigated the cluster decays of the isotopes 212-240Pa, 219-245Np, 228-246Pu, 230-249Am and 232-252Cm leading to doubly magic 208Pb and its neighboring nuclei, which are not experimentally detected but which may be detectable in the future. It is found that most of the decays are favourable for experimental measurements (i.e., T1/230 s) and this observation will serve as a guide to future experiments. Our study reveals the role of doubly magic 208Pb daughter nuclei and near doubly magic nuclei in the cluster decay process. In order to make a comparison with CPPM we also calculated the logarithmic half-lives using the Universal formula for the cluster decay (UNIV) by Poenaru et al., the Universal Decay Law (UDL) and the Scaling Law of Horoi et al., and they are found to be in good agreement. The Geiger-Nuttall plots of log10(T1/2) versus Q-1/2 for various clusters from different isotopes of heavy parent nuclei have been studied and are found to be linear. (orig.)

  16. Giant Quadrupole Resonances in 208Pb, the nuclear symmetry energy and the neutron skin thickness

    CERN Document Server

    Roca-Maza, X; Agrawal, B K; Bortignon, P F; Colò, G; Cao, Li-Gang; Paar, N; Vretenar, D


    Recent improvements in the experimental determination of properties of the Isovector Giant Quadrupole Resonance (IVGQR), as demonstrated in the A=208 mass region, may be instrumental for characterizing the isovector channel of the effective nuclear interaction. We analyze properties of the IVGQR in 208Pb, using both macroscopic and microscopic approaches. The microscopic method is based on families of non-relativistic and covariant Energy Density Functionals (EDF), characterized by a systematic variation of isoscalar and isovector properties of the corresponding nuclear matter equations of state. The macroscopic approach yields an explicit dependence of the nuclear symmetry energy at some subsaturation density, for instance S(\\rho=0.1 fm^{-3}), or the neutron skin thickness \\Delta r_{np} of a heavy nucleus, on the excitation energies of isoscalar and isovector GQRs. Using available data it is found that S(\\rho=0.1 fm{}^{-3})=23.3 +/- 0.6 MeV. Results obtained with the microscopic framework confirm the correla...

  17. Neutron total cross sections of 204Pb, 206Pb, 207Pb and 208Pb and the neutron electric polarizability

    International Nuclear Information System (INIS)

    The neutron total cross sections have been measured for lead isotopes 208Pb, 206Pb and 207Pb in the range from 1 eV to 20 keV and for 204Pb in the range from 1 eV to 100 eV using the time-of-flight facility GNEIS in Gatchina. An accuracy of the measured neutron total cross section (Δσ/σ) is about 10-3 for 208Pb, 10-2 for 206Pb and 207Pb, 5·10-2 for 204Pb. An estimated value of the neutron electric polarizability from analysis of total cross section of 208Pb is αn=(2.4 ± 1.1)·10-3fm3. (author)

  18. Elastic and inelastic scattering of 86Kr on 208Pb at Elab = 43 MeV/nucleon

    International Nuclear Information System (INIS)

    Elastic and inelastic angular distributions of 43 MeV/nucleon 86Kr on 208Pb have been measured. Coulomb excitation of the low-lying collective states has a much smaller effect on the elastic angular distribution than observed at low bombarding energy. The inelastic angular distributions to the first 2+ states in 86Kr and 208Pb are well reproduced by coupled-channel calculations using adopted B(E2) values. Above E*=7 MeV the inelastic spectra are dominated by Coulomb excitation of the isovector giant dipole and isoscalar giant quadrupole resonances. (orig.)

  19. Neutron-skin thickness of 208Pb from the energy of the anti-analog giant dipole resonance

    CERN Document Server

    Krasznahorkay, A; Vretenar, D; Harakeh, M N


    The energy of the charge-exchange Anti-analog Giant Dipole Resonance (AGDR) has been calculated for the 208Pb isotope using the state-of-the-art fully self-consistent relativistic proton-neutron quasiparticle random-phase approximation based on the Relativistic Hartree-Bogoliubov model. It is shown that the AGDR centroid energy is very sensitively related to the corresponding neutron-skin thickness. The neutron-skin thickness of 208Pb has been determined very precisely by comparing the theoretical results with the available experimental data on E(AGDR). The result DR(pn)= 0.161(42) agrees nicely with the previous experimental results.

  20. Search for mixed-symmetry states of nuclei in the vicinity of the double-magic nucleus 208Pb

    Directory of Open Access Journals (Sweden)

    Kocheva D.


    Full Text Available In this work we present the results from two experiments dedicated to search for quadrupolecollective isovector valence-shell excitation, the states with so-called mixed proton-neutron symmetry (MSS, in nuclei around the doubly magic nucleus 208Pb. 212Po was studied in an α-transfer reaction. 204Hg was studied in an inverse kinematics Coulomb excitation reaction on a carbon target. Both experiments provide indications for existence of one-phonon MSSs. Those are the first experimentally identified MSSs in the mass A ≈ 208 region.

  1. Alpha-decay properties of /sup 205-208/Fr: Identification of 206Fr/sup m/

    International Nuclear Information System (INIS)

    Alpha-particle and γ-ray spectral measurements were made for /sup 205-208/Fr. A new a emitter (T/sub 1/2/ = 0.7 +- 0.1 sec and E/sub a/ = 6.930 +- 0.005 MeV) was observed and identified with the decay of a previously unknown isomer in 206Fr. From the a particle and g ray intensities, a decay branching ratios were deduced for /sup 205-208/Fr utilizing available information concerning the nuclides' (electron capture+positron) decay properties. Reduced widths were calculated and compared with those of neighboring nuclei

  2. 40 CFR 600.208-08 - Calculation of FTP-based and HFET-based fuel economy values for a model type. (United States)


    ...-based fuel economy values for a model type. 600.208-08 Section 600.208-08 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures...

  3. 40 CFR 600.208-12 - Calculation of FTP-based and HFET-based fuel economy and carbon-related exhaust emission values... (United States)


    ...-based fuel economy and carbon-related exhaust emission values for a model type. 600.208-12 Section 600.208-12 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and...

  4. Search for resonant nu production at $\\sqrt{s}$ = 183 to 208 GeV

    CERN Document Server

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alderweireld, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Bugge, L; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F R; Chapkin, M M; Charpentier, P; Checchia, P; Chierici, R; Chliapnikov, P V; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, G; Costa, M J; Crawley, B; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Da Silva, W; Dalmau, J; De Maria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; Della Ricca, G; Di Ciaccio, Lucia; Di Simone, A; Doroba, K; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J A; Gandelman, M; García, C; Gavillet, P; Gazis, E N; Geralis, T; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Hansen, J; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Hultqvist, K; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, P D; Johansson, E K; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E C; Kernel, G; Kersevan, Borut P; Kiiskinen, A P; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, M; Mazzucato, F; McNulty, R; Meroni, C; Meyer, W T; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L M; Murray, W; Muryn, B; Myatt, Gerald; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V F; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Prorok, Dariusz; Pukhaeva, N; Pullia, Antonio; Rames, J; Ramler, L; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, R N; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Rosenberg, E I; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Savoy-Navarro, A; Schwickerath, U; Segar, A; Sekulin, R L; Siebel, M; Sissakian, A N; Smadja, G; Smirnova, O G; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomaradze, A G; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Lysebetten, A; Van Vulpen, I B; Vegni, G; Veloso, F; Venus, W A; Verbeure, F; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zimin, N I; Zinchenko, A I; Zupan, M


    Searches for resonant nu production in e/sup +/e/sup -/ collisions under the assumption that R-parity is not conserved and that the dominant R-parity violating coupling is lambda /sub 121/or lambda /sub 131/ used data recorded by DELPHI in 1997 to 2000 at centre-of- mass energies of 183 to 208 GeV. No deviation from the standard model was observed. Upper limits are given for the lambda /sub lambda 121/ and lambda /sub 131/ couplings as a function of the sneutrino mass and total width. The limits are especially stringent for sneutrino masses equal to the centre-of-mass energies with the highest integrated luminosities recorded.

  5. Experimental determination of charge density of 208Pb, by electron scattering at high momentum transfer

    International Nuclear Information System (INIS)

    After having recalled that elastic electron scattering allows the determination of nucleus charge density with a high precision, and that a sufficiently high momentum transfer is required for the precision of analysis methods, this research thesis presents the results obtained by an experiment performed on 208Pb with a high momentum transfer. This nucleus meets at best the approximations required by theoretical calculations. In a first part, the author discusses the use of this nucleus, discusses the available data and outlines the lacking ones. He presents the experimental installation and aspects: the linear accelerator, the scattering angle, the solid angle, the number of incident neutrons, the target thermal toughness, and the number of elastically scattered neutrons. He reports the reduction of data: experiment-based corrections, radiative corrections, spectrum deconvolution methods, data normalisation, diaphragm aperture corrections and multiple scattering corrections. The next part proposes an analysis of data, and the last one compares the obtained results with theoretical ones

  6. Monopole giant resonance in $^{100-132}$Sn, $^{144}$Sm and $^{208}$Pb

    CERN Document Server

    Kvasil, J; Repko, A; Reinhard, P -G; Nesterenko, V O; Kleinig, W


    The isoscalar giant monopole resonance (GMR) in spherical nuclei $^{100-132}$Sn, $^{144}$Sm, and $^{208}$Pb is investigated within the Skyrme random-phase-approximation (RPA) for a variety of Skyrme forces and different pairing options. The calculated GMR strength functions are directly compared to the available experimental distributions. It is shown that, in accordance to results of other groups, description of GMR in Sn and heavier Sm/Pb nuclei needs different values of the nuclear incompressibilty, $K \\approx$ 200 or 230 MeV, respectively. Thus none from the used Skyrme forces is able to describe GMR in these nuclei simultaneously. The GMR peak energy in open-shell $^{120}$Sn is found to depend on the isoscalar effective mass, which might be partly used for a solution of the above problem. Some important aspects of the problem (discrepancies of available experimental data, proper treatment of the volume and surface compression in finite nuclei, etc) are briefly discussed.

  7. Semi-microscopic interpretation of fast neutron scattering from 208Pb

    International Nuclear Information System (INIS)

    Angular distributions for elastic and inelastic neutron scattering on 208Pb have been measured for the ground state and for excited states at 2.164 MeV (3-), 3.198 MeV (5-), 4.076 MeV (2+) and 4.323 MeV (4+) + 4.425 MeV (6+), at incident energis between 7.5 and 15.5 MeV. Semi-microscopic folding-model calculations of the cross sections have been performed with the microscopic optical model of Jeukenne, Lejeune and Mahaux together with a Hartree-Fock-Bogoluybov ground state nucleon density and RPA transition densities. The nucleon excitation strengths deduced in this study will be compared to values obtained at higher energies and with other projectiles

  8. Modifications of the tensor and spin-orbit interactions and the stretched states in 208Pb

    International Nuclear Information System (INIS)

    We have reanalyzed the (e,e') and (p,p') data at 318 MeV on the stretched, 121,2- and 14-, states of 208Pb using the ideas of G. Brown and co-workers on the reduction of meson and nucleon masses in the nuclear medium. The reaction calculations are compared with new, large basis random-phase-approximation calculations using a residual interaction, also modified, in a consistent way. The resulting interaction, based on the one boson exchange (π+ρ) model, has reduced tensor and enhanced spin-orbit strengths. Agreement between electron and proton quenching factors is found for effective masses, m*/m congruent 0.79--0.86. The reduction or enhancement factors for the modified interaction are in qualitative agreement with those found in other analyses

  9. Two-phonon giant resonances in 136Xe, 208Pb, and 238U

    International Nuclear Information System (INIS)

    The excitation of the double-phonon giant dipole resonance was observed in heavy projectile nuclei impinging on targets of high nuclear charge with energies of 500-700 MeV/nucleon. New experimental data are presented for 136Xe and 238U together with further analysis of earlier data on 208Pb. Differential cross sections dσ/dE* and dσ/dθ for electromagnetic excitations were deduced. Depending on the isotope, cross sections appear to be enhanced in comparison to those expected from a purely harmonic nuclear dipole response. The cumulative effect of excitations of two-phonon states composed of one dipole and one quadrupole phonon, of predicted anharmoniticies in the double-phonon dipole response, and of damping of the dipole resonance during the collision may account for the discrepancy. In addition, decay properties of two-phonon resonances were studied and compared to that of a statistical decay. (orig.)

  10. The investigation of inhalational allergen in 208 asthmatic infants and children

    International Nuclear Information System (INIS)

    The aim of the study was to investigate the inhalational allergen in 208 asthmatic infants and children with allergen steep puncturing skin. The positive cases were 169(81.25%). There were 18 inhalational allergens in allergen steep. The positive rate of the dust acarus was 78.85%, and the dust was 35.58%, the smoke was 32.69% among the allergens. There was not any positive reaction in other allergens. There were no sexual differences in the positive rate. There was nothing with hypersusceptibility of the individual and the family. The positive rate of the infant was less than the child. There was significant difference of the positive rate in the age group (P < 0.01). The result indicated that dust acarus, air pollution or passive smoke was the quite dangerous factor in the many factors of the asthma. It was very important to strengthen the study of the infant and child prevention and cure

  11. LANDSAT supports data needs for EPA 208 planning. [water quality control and waste treatment management (United States)


    Excerpts from federal legislation and regulations mandating areawide waster treatment management as a means of restoring and maintaining the integrity of the nation's water are presented along with requirements for grants to the states for water quality planning, management, and implementation. Experiences using LANDSAT to identify nonpoint sources of water pollution as well as land/use/land cover features in South Dakota, Kentucky, Georgia, New Jersey, and Texas are described. Present activities suggest that this type of remote sensing is an efficient, effective tool for areawide water quality planning. Interaction with cognizant federal, state, and local government personnel involved in EPA section 208 planning activities can guide the development of new capabilities and enhance their utility and prospect for use.

  12. Single-pass high-harmonic generation at 20.8 MHz repetition rate. (United States)

    Vernaleken, Andreas; Weitenberg, Johannes; Sartorius, Thomas; Russbueldt, Peter; Schneider, Waldemar; Stebbings, Sarah L; Kling, Matthias F; Hommelhoff, Peter; Hoffmann, Hans-Dieter; Poprawe, Reinhart; Krausz, Ferenc; Hänsch, Theodor W; Udem, Thomas


    We report on single-pass high-harmonic generation (HHG) with amplified driving laser pulses at a repetition rate of 20.8 MHz. An Yb:YAG Innoslab amplifier system provides 35 fs pulses with 20 W average power at 1030 nm after external pulse compression. Following tight focusing into a xenon gas jet, we observe the generation of high-harmonic radiation of up to the seventeenth order. Our results show that state-of-the-art amplifier systems have become a promising alternative to cavity-assisted HHG for applications that require high repetition rates, such as frequency comb spectroscopy in the extreme UV. PMID:21886233

  13. Large-scale configuration interaction description of the structure of nuclei around $^{100}$Sn and $^{208}$Pb

    CERN Document Server

    Qi, Chong


    In this contribution I would like to discuss briefly the recent developments of the nuclear configuration interaction shell model approach. As examples, we apply the model to calculate the structure and decay properties of low-lying states in neutron-deficient nuclei around $^{100}$Sn and $^{208}$Pb that are of great experimental and theoretical interests.

  14. An investigation of the influence of the pairing correlations on the properties of the isobar analog resonances in = 208 nuclei

    Indian Academy of Sciences (India)

    A Küçükbursa; D I Salamov; T Babacan; H A Aygör


    Within the quasi-particle random phase approximation (QRPA), the method of the self-consistent determination of the isovector effective interaction which restores a broken isotopic symmetry for the nuclear part of the Hamiltonian is given. The effect of the pairing correlations between nucleons on the following quantities were investigated for the = 208 nuclei: energies of the isobar analog 0+ states, the isospin admixtures in the ground state of the even–even nuclei, and the differential cross-section for the 208Pb(3He,)208Bi reaction at E(3He) = 450 MeV. Both couplings of the excitation branches with z = 0 ± 1, and the analog state with isovector monopole resonance (IVMR) in the quasi-particle representation were taken into account in our calculations. As a result of these calculations, it was seen that the pairing correlations between nucleons have no considerable effect on the = 23 isospin admixture in the ground state of the 208Pb nucleus, and they cause partially an increase in the isospin impurity of the isobar analog resonance (IAR). It was also established that these correlations have changed the isospin structure of the IAR states, and shifted the energies of the IVMR states to the higher values.

  15. 8 CFR 208.31 - Reasonable fear of persecution or torture determinations involving aliens ordered removed under... (United States)


    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Reasonable fear of persecution or torture... Persecution § 208.31 Reasonable fear of persecution or torture determinations involving aliens ordered removed... persecution or torture. The alien's representative may present a statement at the end of the interview....

  16. 11Li Breakup on 208Pb at Energies Around the Coulomb Barrier

    DEFF Research Database (Denmark)

    Fernández-García, J.P.; Cubero, M.; Rodríguez-Gallardo, M.;


    The inclusive breakup for the 11Li+208Pb reaction at energies around the Coulomb barrier has been measured for the first time. A sizable yield of 9Li following the 11Li dissociation has been observed, even at energies well below the Coulomb barrier. Using the first-order semiclassical perturbatio...

  17. 31 CFR 538.208 - Prohibited grant or extension of credits or loans to the Government of Sudan. (United States)


    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Prohibited grant or extension of... TREASURY SUDANESE SANCTIONS REGULATIONS Prohibitions § 538.208 Prohibited grant or extension of credits or loans to the Government of Sudan. Except as otherwise authorized, the grant or extension of credits...

  18. 48 CFR 208.602-70 - Acquisition of items for which FPI has a significant market share. (United States)


    ... SOURCES OF SUPPLIES AND SERVICES Acquisition From Federal Prison Industries, Inc. 208.602-70 Acquisition... 827 of the National Defense Authorization Act for Fiscal Year 2008 (Pub. L. 110-181). (b) prison. (c) Policy. (1) When acquiring...

  19. 12 CFR 208.100 - Sale of bank's money orders off premises as establishment of branch office. (United States)


    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Sale of bank's money orders off premises as... SYSTEM (REGULATION H) Interpretations § 208.100 Sale of bank's money orders off premises as establishment... deposits are received, or checks paid, or money lent.” The basic question is whether the sale of a...

  20. 7 CFR 1710.208 - RUS criteria for approval of all load forecasts by power supply borrowers and by distribution... (United States)


    ... 7 Agriculture 11 2010-01-01 2010-01-01 false RUS criteria for approval of all load forecasts by... COMMON TO ELECTRIC LOANS AND GUARANTEES Load Forecasts § 1710.208 RUS criteria for approval of all load... analytical techniques and models; (f) The borrower provided RUS with adequate documentation and assistance...

  1. 22 CFR 208.875 - May I ask the debarring official to reconsider a decision to debar me? (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false May I ask the debarring official to reconsider... DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT) Debarment § 208.875 May I ask the debarring official to reconsider a decision to debar me? Yes, as a debarred person you may ask the...

  2. 22 CFR 208.525 - Whom do I ask if I have questions about a person in the EPLS? (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Whom do I ask if I have questions about a... GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT) Excluded Parties List System § 208.525 Whom do I ask if I have questions about a person in the EPLS? If you have questions about a person in the EPLS,...

  3. Density-constrained time-dependent Hartree-Fock calculation of $^{16}$O+$^{208}$Pb fusion cross sections


    Umar, A. S.; Oberacker, V. E.


    We present a fully microscopic study of the $^{16}$O+$^{208}$Pb fusion using the density-constrained time-dependent Hartree-Fock theory. The calculated fusion cross-sections are in good agreement with the experimental data for the entire energy range indicating that the incorporation of dynamical effects is crucial in describing heavy-ion fusion.

  4. An EP4 antagonist ONO-AE3-208 suppresses cell invasion, migration, and metastasis of prostate cancer. (United States)

    Xu, Song; Zhang, Zhengyu; Ogawa, Osamu; Yoshikawa, Takeshi; Sakamoto, Hiromasa; Shibasaki, Noboru; Goto, Takayuki; Wang, Liming; Terada, Naoki


    EP4 is one of the prostaglandin E2 receptors, which is the most common prostanoid and is associated with inflammatory disease and cancer. We previously reported that over-expression of EP4 was one of the mechanisms responsible for progression to castration-resistant prostate cancer, and an EP4 antagonist ONO-AE3-208 in vivo suppressed the castration-resistant progression regulating the activation of androgen receptor. The aim of this study was to analyze the association of EP4 with prostate cancer metastasis and the efficacy of ONO-AE3-208 for suppressing the metastasis. The expression levels of EP4 mRNA were evaluated in prostate cancer cell lines, LNCaP, and PC3. EP4 over-expressing LNCaP was established, and their cell invasiveness was compared with the control LNCaP (LNCaP/mock). The in vitro cell proliferation, invasion, and migration of these cells were examined under different concentrations of ONO-AE3-208. An in vivo bone metastatic mouse model was constructed by inoculating luciferase expressing PC3 cells into left ventricle of nude mice. Their bone metastasis was observed by bioluminescent imaging with or without ONO-AE3-208 administration. The EP4 mRNA expression levels were higher in PC3 than in LNCaP, and EP4 over-expression of LNCaP cells enhanced their cell invasiveness. The in vitro cell invasion and migration were suppressed by ONO-AE3-208 in a dose-dependent manner without affecting cell proliferation. The in vivo bone metastasis of PC3 was also suppressed by ONO-AE3-208 treatment. EP4 expression levels were correlated with prostate cancer cell invasiveness and EP4 specific antagonist ONO-AE3-208 suppressed cell invasion, migration, and bone metastasis, indicating that it is a potential novel therapeutic modality for the treatment of metastatic prostate cancer. PMID:24744183

  5. Neutron fluence rate measurements in a PGNAA 208-liter drum assay system using silicon carbide detectors

    Energy Technology Data Exchange (ETDEWEB)

    Dulloo, A.R. E-mail:; Ruddy, F.H.; Seidel, J.G.; Lee, S.; Petrovic, B.; McIlwain, M.E


    Pulsed prompt gamma neutron activation analysis (PGNAA) is being implemented for the nondestructive assay (NDA) of mercury, cadmium and lead in containers of radioactive waste. A PGNAA prototype system capable of assaying 208-liter (55-gallon) drums has already been built and demonstrated. As part of the evaluation of this system, the thermal neutron fluence rate distribution in a drum containing a combustible waste surrogate was measured during PGNAA runs using a silicon carbide neutron detector. The fast charge-collection time of this detector type enabled the investigation of the neutron kinetics at various locations within the matrix during and between pulses of the system's 14-MeV neutron source. As expected, the response of a SiC detector equipped with a lithium-6 fluoride layer is dominated by thermal neutron-induced events between pulses. The measurement results showed that the thermal neutron fluence rate is relatively uniform over a radial depth of several centimeters in the matrix region that contributes a significant fraction of the prompt gamma radiation incident on the system's photon detector.

  6. Neutron fluence rate measurements in a PGNAA 208-liter drum assay system using silicon carbide detectors (United States)

    Dulloo, A. R.; Ruddy, F. H.; Seidel, J. G.; Lee, S.; Petrović, B.; McIlwain, M. E.


    Pulsed prompt gamma neutron activation analysis (PGNAA) is being implemented for the nondestructive assay (NDA) of mercury, cadmium and lead in containers of radioactive waste. A PGNAA prototype system capable of assaying 208-liter (55-gallon) drums has already been built and demonstrated. As part of the evaluation of this system, the thermal neutron fluence rate distribution in a drum containing a combustible waste surrogate was measured during PGNAA runs using a silicon carbide neutron detector. The fast charge-collection time of this detector type enabled the investigation of the neutron kinetics at various locations within the matrix during and between pulses of the system's 14-MeV neutron source. As expected, the response of a SiC detector equipped with a lithium-6 fluoride layer is dominated by thermal neutron-induced events between pulses. The measurement results showed that the thermal neutron fluence rate is relatively uniform over a radial depth of several centimeters in the matrix region that contributes a significant fraction of the prompt gamma radiation incident on the system's photon detector.

  7. Neutron fluence rate measurements in a PGNAA 208-liter drum assay system using silicon carbide detectors

    International Nuclear Information System (INIS)

    Pulsed prompt gamma neutron activation analysis (PGNAA) is being implemented for the nondestructive assay (NDA) of mercury, cadmium and lead in containers of radioactive waste. A PGNAA prototype system capable of assaying 208-liter (55-gallon) drums has already been built and demonstrated. As part of the evaluation of this system, the thermal neutron fluence rate distribution in a drum containing a combustible waste surrogate was measured during PGNAA runs using a silicon carbide neutron detector. The fast charge-collection time of this detector type enabled the investigation of the neutron kinetics at various locations within the matrix during and between pulses of the system's 14-MeV neutron source. As expected, the response of a SiC detector equipped with a lithium-6 fluoride layer is dominated by thermal neutron-induced events between pulses. The measurement results showed that the thermal neutron fluence rate is relatively uniform over a radial depth of several centimeters in the matrix region that contributes a significant fraction of the prompt gamma radiation incident on the system's photon detector

  8. Isomers in neutron-rich A ∼ 190 nuclides from 208Pb fragmentation

    International Nuclear Information System (INIS)

    Relativistic projectile fragmentation of 208Pb has been used to produce isomers in neutron-rich, A ∼ 190 nuclides. A forward-focusing spectrometer provided ion-by-ion mass and charge identification. The detection of gamma-rays emitted by stopped ions has led to the assignment of isomers in 188Ta, 190W, 192Re, 193Re, 195Os, 197Ir, 198Ir, 200Pt, 201Pt, 202Pt and 203Au, with half-lives ranging from approximately 10 ns to 1 ms. Tentative isomer information has been found also for 174Er, 175Er, 185Hf, 191Re, 194Re and 199Ir. In most cases, time-correlated, singles gamma-ray events provided the first spectroscopic data on excited states for each nuclide. In 200Pt and 201Pt, the assignments are supported by gamma-gamma coincidences. Isomeric ratios provide additional information, such as half-life and transition energy constraints in particular cases. The level structures of the platinum isotopes are discussed, and comparisons are made with isomer systematics

  9. Isomers in Neutron-Rich A ?? 190 NNuclides from 208Pb Fragmentation

    Energy Technology Data Exchange (ETDEWEB)

    Caamano, M. [University of Surrey, UK; Walker, P. M. [University of Surrey, UK; Regan, P. H. [University of Surrey, UK; Pfutzner, M. [University of Warsaw; Podolyak, Zs. [University of Surrey, UK; Gerl, J. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Hellstrom, M. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Mayet, P. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Mineva, M. N. [Lund University, Sweden; Aprahamian, A. [University of Notre Dame, IN; Benlliure, J. [University of Santiago de Compostela, Spain; Bruce, A. M. [University of Brighton, UK; Butler, P. A. [Oliver Lodge Laboratory, University of Liverpool, UK; Cortina Gil, D. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Cullen, D. M. [Oliver Lodge Laboratory, University of Liverpool, UK; Doring, J. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Enqvist, T. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Fox, C. [Oliver Lodge Laboratory, University of Liverpool, UK; Garces Narro, J. [University of Surrey, UK; Geissel, H. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Gelletly, W. [University of Surrey, UK; Giovinazzo, J. [CEN Bordeaux-Gradignan/CNRS, France; Gorska, M. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Grawe, H. [GSI-Hemholtzzentrum fur Schwerionenforschung, Darmstadt, Germany; Grzywacz, R. [University of Tennessee, Knoxville (UTK); Kleinbohl, A. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Korten, W. [CEA, Saclay, France; Lewitowicz, M. [Grand Accelerateur National d' Ions Lourds (GANIL); Lucas, R. [CEA, Saclay, France; Mach, H. [Uppsala University, Uppsala, Sweden; O' Leary, C. D. [Oliver Lodge Laboratory, University of Liverpool, UK; De Oliveira, F. [Grand Accelerateur National d' Ions Lourds (GANIL); Pearson, C. J. [University of Surrey, UK; Rejmund, F. [IPN, Cedex, France; Rejmund, M. [IPN, Cedex, France; Sawicka, M. [University of Warsaw; Schaffner, H. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Schlegel, C. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Schmidt, K. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Schmidt, K.-H. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Stevenson, P. D. [University of Surrey, UK; Theisen, Ch. [CEA, Saclay, France; Vives, F. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Warner, D. D. [Daresbury Laboratory, UK; Wheldon, C. [University of Surrey, UK; Wollersheim, H. J. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Wooding, S. [University of Surrey, UK; Xu, F. [University of Surrey, UK; Yordanov, O. [Gesellschaft fur Schwerionenforschung (GSI), Germany


    Relativistic projectile fragmentation of {sup 208}Pb has been used to produce isomers in neutron-rich, A {approx} 190 nuclides. A forward-focusing spectrometer provided ion-by-ion mass and charge identification. The detection of gamma-rays emitted by stopped ions has led to the assignment of isomers in {sup 188}Ta, {sup 190}W, {sup 192}Re, {sup 193}Re, {sup 195}Os, {sup 197}Ir, {sup 198}Ir, {sup 200}Pt, {sup 201}Pt, {sup 202}Pt and {sup 203}Au, with half-lives ranging from approximately 10 ns to 1 ms. Tentative isomer information has been found also for {sup 174}Er, {sup 175}Er, {sup 185}Hf, {sup 191}Re, {sup 194}Re and {sup 199}Ir. In most cases, time-correlated, singles gamma-ray events provided the first spectroscopic data on excited states for each nuclide. In {sup 200}Pt and {sup 201}Pt, the assignments are supported by gamma-gamma coincidences. Isomeric ratios provide additional information, such as half-life and transition energy constraints in particular cases. The level structures of the platinum isotopes are discussed, and comparisons are made with isomer systematics.

  10. Elastic Neutron Scattering at 96 MeV from {sup 12}C and {sup 208}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Klug, J.; Blomgren, J.; Atac, A. [and others


    A facility for detection of scattered neutrons in the energy interval 50-130 MeV, SCANDAL (SCAttered Nucleon Detection AssembLy), has recently been installed at the 20-180 MeV neutron beam line of the The Svedberg Laboratory, Uppsala. Elastic neutron scattering from {sup 12}C and {sup 208}Pb has been studied at 96 MeV in the 10-70 deg interval. The achieved energy resolution, 3.7 MeV, is about an order of magnitude better than for any previous experiment above 65 MeV incident energy. The present experiment represents the highest neutron energy where the ground state has been resolved from the first excited state in neutron scattering. A novel method for normalization of the absolute scale of the cross section has been used. The estimated uncertainty, 3 %, is unprecedented for a neutron-induced differential cross section measurement on a nuclear target. The results are compared with modern optical model predictions, based on phenomenology or microscopic nuclear theory.

  11. Relativistic particles produced in 208Pb induced nuclear collisions at 158 A GeV/c

    International Nuclear Information System (INIS)

    The angular structures of relativistic particles produced in 208Pb+Ag(Br) collisions in emulsion detector at 158 A GeV/c have been studied. Three different methods of analysis have been used - scaled factorial moments, wavelets and parameter S2. An evidence for nonstatistical fluctuations has been shown using the method of scaled factorial moments in pseudorapidity phase space. The comparative study has been done for different beam energies and masses and Pb+Em events with different degree of centrality. No clear minimum has been found in the dependences of intermittency parameter λq on q. The continuous wavelet transform has been applied to the pseudorapidity spectra of produced particles. Some irregularities have been revealed mainly in the scale range a ≤ 0.5 which can be interpreted as the preferred pseudorapidities of groups of emitted particles. The nonstatistical ring-like structures of produced particles in azimuthal plane of a collision have been found and their parameters have been determined when the azimuthal structures of produced particles have been investigated using the S2 method

  12. Low-metallicity Young Clusters in the Outer Galaxy. II. Sh 2-208

    CERN Document Server

    Yasui, Chikako; Saito, Masao; Izumi, Natsuko


    We obtained deep near-infrared images of Sh 2-208, one of the lowest-metallicity HII regions in the Galaxy, [O/H] = -0.8 dex. We detected a young cluster in the center of the HII region with a limiting magnitude of K = 18.0 mag (10sigma), which corresponds to a mass detection limit of ~0.2 M_sun. This enables the comparison of star-forming properties under low metallicity with those of the solar neighborhood. We identified 89 cluster members. From the fitting of the K-band luminosity function (KLF), the age and distance of the cluster are estimated to be ~0.5 Myr and ~4 kpc, respectively. The estimated young age is consistent with the detection of strong CO emission in the cluster region and the estimated large extinction of cluster members (Av ~ 4--25 mag). The observed KLF suggests that the underlying initial mass function (IMF) of the low-metallicity cluster is not significantly different from canonical IMFs in the solar neighborhood in terms of both high-mass slope and IMF peak (characteristic mass). Desp...

  13. Isomers in neutron-rich A∼190 nuclides from 208Pb fragmentation

    International Nuclear Information System (INIS)

    Relativistic projectile fragmentation of 208Pb has been used to produce isomers in neutron-rich, A∼190 nuclides. A forward-focusing spectrometer provided ion-by-ion mass and charge identification. The detection of γ-rays emitted by stopped ions has led to the assignment of isomers in 188Ta, 190W, 192Re, 193Re, 195Os, 197Ir, 198Ir, 200Pt, 201Pt, 202Pt and 203Au, with half-lives ranging from approximately 10 ns to 1 ms. Tentative isomer information has been found also for 174Er, 175Er, 185Hf, 191Re, 194Re and 199Ir. In most cases, time-correlated, singles γ-ray events provided the first spectroscopic data on excited states for each nuclide. In 200Pt and 201Pt, the assignments are supported by γ-γ coincidences. Isomeric ratios provide additional information, such as half-life and transition energy constraints in particular cases. The level structures of the platinum isotopes are discussed, and comparisons are made with isomer systematics. (orig.)

  14. Isomers in neutron-rich A{approx}190 nuclides from {sup 208}Pb fragmentation

    Energy Technology Data Exchange (ETDEWEB)

    Caamano, M.; Podolyak, Z.; Garces Narro, J. [University of Surrey, Department of Physics, Guildford (United Kingdom); Walker, M. [University of Surrey, Department of Physics, Guildford (United Kingdom)]|[TRIUMF, Vancouver (Canada); Regan, P.H. [University of Surrey, Department of Physics, Guildford (United Kingdom)]|[Yale University, Wright Nuclear Structure Laboratory, New Haven (United States); Pfuetzner, M. [Warsaw University, Institute of Experimental Physics, Warsaw (Poland); Gerl, J.; Cortina Gil, D.; Doering, J.; Geissel, H. [GSI, Darmstadt (Germany); Hellstroem, M. [GSI, Darmstadt (Germany)]|[Lund University, Div. of Nuclear Physics (Sweden); Mayet, P. [GSI, Darmstadt (Germany)]|[KU Leuven, IKS, Leuven (Belgium); Mineva, M.N. [Lund University, Division of Nuclear Physics (Sweden); Aprahamian, A. [University of Notre Dame, Department of Physics, South Bend (United States); Benlliure, J. [University of Santiago de Compostela, Departamento de Fisica de Particulas, Santiago de Compostela (Spain); Bruce, A.M. [University of Brighton, School of Engineering, Brighton (United Kingdom); Butler, P.A. [University of Liverpool, Oliver Lodge Laboratory, Liverpool (United Kingdom); Cullen, D.M. [University of Liverpool, Oliver Lodge Laboratory, Liverpool (United Kingdom)]|[University of Manchester, Schuster Lab., Manchester (United Kingdom); Enqvist, T. [GSI, Darmstadt (Germany)]|[Univ. of Jyvaeskylae, Dept. of Physics, Jyvaeskylae (Finland); Fox, C. [Univ. of Liverpool, Oliver Lodge Lab., Liverpool (United Kingdom)]|[Duke Univ., TUNL, Durham (United States); Gelletly, M.; Giovinazzo, J.; Gorska, M.; Grawe, H.; Grzywacz, R.; Kleinboehl, A.H.; Korten, A.; Lewitowicz, M.; Lucas, R.; Mach, H.; O' Leary, C.D.; De Oliveira, F.; Pearson, C.J.; Rejmund, F.; Rejmund, M.; Sawicka, M.; Schaffner, H.; Schlegel, C.; Schmidt, K.; Schmidt, K.H.; Stevenson, P.D.; Theisen, C.; Vives, F.; Warner, D.D.; Wheldon, C.; Wollersheim, S.; Wooding, S.; Xu, F.; Yordanov, O.


    Relativistic projectile fragmentation of {sup 208}Pb has been used to produce isomers in neutron-rich, A{approx}190 nuclides. A forward-focusing spectrometer provided ion-by-ion mass and charge identification. The detection of {gamma}-rays emitted by stopped ions has led to the assignment of isomers in {sup 188}Ta, {sup 190}W, {sup 192}Re, {sup 193}Re, {sup 195}Os, {sup 197}Ir, {sup 198}Ir, {sup 200}Pt, {sup 201}Pt, {sup 202}Pt and {sup 203}Au, with half-lives ranging from approximately 10 ns to 1 ms. Tentative isomer information has been found also for {sup 174}Er, {sup 175}Er, {sup 185}Hf, {sup 191}Re, {sup 194}Re and {sup 199}Ir. In most cases, time-correlated, singles {gamma}-ray events provided the first spectroscopic data on excited states for each nuclide. In {sup 200}Pt and {sup 201}Pt, the assignments are supported by {gamma}-{gamma} coincidences. Isomeric ratios provide additional information, such as half-life and transition energy constraints in particular cases. The level structures of the platinum isotopes are discussed, and comparisons are made with isomer systematics. (orig.)

  15. Elastic Neutron Scattering at 96 MeV from 12C and 208Pb

    International Nuclear Information System (INIS)

    A facility for detection of scattered neutrons in the energy interval 50-130 MeV, SCANDAL (SCAttered Nucleon Detection AssembLy), has recently been installed at the 20-180 MeV neutron beam line of the The Svedberg Laboratory, Uppsala. Elastic neutron scattering from 12C and 208Pb has been studied at 96 MeV in the 10-70 deg interval. The achieved energy resolution, 3.7 MeV, is about an order of magnitude better than for any previous experiment above 65 MeV incident energy. The present experiment represents the highest neutron energy where the ground state has been resolved from the first excited state in neutron scattering. A novel method for normalization of the absolute scale of the cross section has been used. The estimated uncertainty, 3 %, is unprecedented for a neutron-induced differential cross section measurement on a nuclear target. The results are compared with modern optical model predictions, based on phenomenology or microscopic nuclear theory

  16. Dipole response in 208Pb within a self-consistent multiphonon approach

    CERN Document Server

    Knapp, F; Vesely, P; Andreozzi, F; De Gregorio, G; Porrino, A


    Background: The electric dipole strength detected around the particle threshold and commonly associated to the pygmy dipole resonance offers a unique information on neutron skin and symmetry energy, and is of astrophysical interest. The nature of such a resonance is still under debate. Purpose: We intend to describe the giant and pygmy resonances in 208 Pb by enhancing their fragmentation with respect to the random-phase approximation. Method: We adopt the equation of motion phonon method to perform a fully self-consistent calculation in a space spanned by one-phonon and two-phonon basis states using an optimized chiral two-body potential. A phenomenological density dependent term, derived from a contact three-body force, is added in order to get single-particle spectra more realistic than the ones obtained by using the chiral potential only. The calculation takes into full account the Pauli principle and is free of spurious center of mass admixtures. Results: We obtain a fair description of the giant resonan...

  17. Weak charge form factor and radius of 208Pb through parity violation in electron scattering

    CERN Document Server

    Horowitz, C J; Jen, C -M; Rakhman, A; Souder, P A; Dalton, M M; Liyanage, N; Paschke, K D; Saenboonruang, K; Silwal, R; Franklin, G B; Friend, M; Quinn, B; Kumar, K S; McNulty, D; Mercado, L; Riordan, S; Wexler, J; Michaels, R W; Urciuoli, G M


    We use distorted wave electron scattering calculations to extract the weak charge form factor F_W(q), the weak charge radius R_W, and the point neutron radius R_n, of 208Pb from the PREX parity violating asymmetry measurement. The form factor is the Fourier transform of the weak charge density at the average momentum transfer q=0.475 fm$^{-1}$. We find F_W(q) =0.204 \\pm 0.028 (exp) \\pm 0.001 (model). We use the Helm model to infer the weak radius from F_W(q). We find R_W= 5.826 \\pm 0.181 (exp) \\pm 0.027 (model) fm. Here the exp error includes PREX statistical and systematic errors, while the model error describes the uncertainty in R_W from uncertainties in the surface thickness \\sigma of the weak charge density. The weak radius is larger than the charge radius, implying a "weak charge skin" where the surface region is relatively enriched in weak charges compared to (electromagnetic) charges. We extract the point neutron radius R_n=5.751 \\pm 0.175 (exp) \\pm 0.026 (model) \\pm 0.005 (strange) fm$, from R_W. Her...

  18. Electromagnetic M1 Transition Strengths from Inelastic Proton Scattering: The Cases of 48Ca and 208Pb

    CERN Document Server

    Birkhan, J; von Neumann-Cosel, P; Pietralla, N; Ponomarev, V Yu; Richter, A; Tamii, A


    Inelastic proton scattering at energies of a few 100 MeV/A and extreme forward angles selectively excites the isovector spin-flip magnetic dipole (M1) resonance. A novel method to extract its electromagnetic transition strength is presented based on isospin symmetry, which relates the (p,p') cross sections to those of the (p,n) reaction exciting the analog Gamow-Teller resonance. Application to 48Ca and 208Pb provides new information on two key cases for an interpretation of the quenching phenomenon of the spin-isospin response in nuclei: In 48Ca, the result agrees with the M1 strength deduced from a previous (e,e') experiment and excludes the almost two times larger value from a recent (gamma,n) experiment. In 208Pb, the excitation energy region above 8 MeV inaccessible to previous experiments could be studied for the first time and significant M1 strength is found.

  19. Search for single top production via FCNC at LEP at $\\sqrt{s}$ = 189-208 GeV

    CERN Document Server

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alderweireld, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Bugge, L; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F R; Chapkin, M M; Charpentier, P; Checchia, P; Chierici, R; Shlyapnikov, P; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crawley, B; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Dalmau, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L S; Di Ciaccio, Lucia; Di Simone, A; Doroba, K; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J A; Gandelman, M; García, C; Gavillet, P; Gazis, E N; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Hultqvist, K; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Johansson, P D; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E C; Kernel, G; Kersevan, Borut P; Kerzel, U; Kiiskinen, A P; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Meyer, W T; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L M; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, R; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V F; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, Antonio; Rames, J; Ramler, L; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Rosenberg, E I; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Savoy-Navarro, A; Schwickerath, U; Segar, A; Sekulin, R L; Siebel, M; Sissakian, A N; Smadja, G; Smirnova, O G; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Veloso, F; Venus, W A; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zinchenko, A I; Zupan, M


    A search for single top production (e+e- -> t cbar) via Flavour Changing Neutral Currents (FCNC) was performed using the data taken by the DELPHI detector at LEP2. The data analysed have been accumulated at centre-of-mass energies ranging from 189 to 208 GeV. Limits at 95% confidence level were obtained on the anomalous coupling parameters kappa_gamma and kappa_Z.

  20. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    International Nuclear Information System (INIS)

    The study of the reactions between heavy ions and 208Pb, 209Bi, 238U, and 248 Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the 238U(18O,xn)256-xFm, 238U(22Ne,xn)260-xNo, and 248Cm(15N,xn)263-xLr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The 208Pb(48Ca,xn)256-xNo, 208Pb(50Ti,xn)258-xRf, 208Pb(51V,xn)259-xDb, 209Bi(50Ti,xn)259-xDb, and 209Bi(51V,xn)260-xSg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics

  1. Can three-neutron forces be constrained by empirical information on the neutron skin of 48Ca and 208Pb?


    Sammarruca, Francesca


    We calculate the neutron matter equation of state from two-neutron forces up to ?fifth order of the chiral expansion and investigate the order-by-order convergence of the predictions. Based on these equations of state, we derive the binding energies and the neutron and proton density distributions in 208Pb and 48Ca, with particular attention to the neutron skins. Anticipating future experiments which will provide reliable information on the weak charge density in nuclei, we discuss the theore...

  2. Is the simultaneous pick-up mechanism predominant in hte 208Pb(p, t) 3+ transition

    International Nuclear Information System (INIS)

    The roles of simultaneous (one-step) and sequential (two-step) transfer processes in the reaction 208Pb(p, t)206Pb(3+, 1.34 MeV.) are investigated. Both processes are accurately evaluated employing realistic wave functions and finite-range interactions. The sequential transfer process is found to be dominant in this reaction, contrary to the conclusion of Nagarajan et al. The comparison of the polarization asymmetry calculation with the data confirms this result. (author)

  3. Total fission cross section of {sup 181}Ta and {sup 208}Pb induced by protons at relativistic energies

    Energy Technology Data Exchange (ETDEWEB)

    Ayyad, Y.; Benlliure, J.; Casarejos, E. [Group GENP, Dpto. Fisica de Particulas, Universidade de Santiago de Compostela, 15782 Santiago de Compostela (Spain); Schmidt, K. H. [GSI, Planckstrasse 1, 64941, Darmstadt (Germany); Jurado, B. [Universite Bordeaux I, CNRS/IN2 P3, CENBG, BP 120, F-33175 Gradignan (France); Kelic-Heil, A. [GSI, Planckstrasse 1, 64941, Darmstadt (Germany); Pol, H. A. [Group GENP, Dpto. Fisica de Particulas, Universidade de Santiago de Compostela, 15782 Santiago de Compostela (Spain); Ricciardi, M. V.; Pleskac, R. [GSI, Planckstrasse 1, 64941, Darmstadt (Germany); Enqvist, T. [CUPP Project, P.O. Box 22, FI-86801, Pyhsalmi (Finland); Rejmund, F. [Grand Accelerateur National D Ions Lourds, BP 55027, F-14076 Caen Cedex 05 (France); Giot, L. [Subatech - Ecole des Mines de Nantes (France); Henzl, V. [Massachusetts Inst. of Technology, 77, Massachusetts Ave, Cambridge, MA 02139 (United States); Lukic, S. [Karlsruhe Inst. of Technology, D-76021 Karlsruhe (Germany); Ngoc, S. N. [Dept. of Nuclear Physics, Inst. of Physics, National Centre for Natural Science and Technology, NgiaDo-TuLiem, Hanoi (Viet Nam); Boudard, A. [DSM/IRFU/CEA, 91191 Gif-sur-Ivette (France); Universite Louis Pasteur, Strasbourg (France); Leray, S. [DSM/IRFU/CEA, 91191 Gif-sur-Ivette (France); Fernandez, M. [Entro de Investigaciones Energticas Medioambientales Y Tecnolgicas, Madrid (Spain); Kurtukian, T. [Universite Bordeaux I, CNRS/IN2 P3, CENBG, BP 120, F-33175 Gradignan (France); Nadtochy, P. [Omsk State Univ., Dept. of Theoretical Physics, RU-644077 Omsk (Russian Federation); Schmitt, C. [Grand Accelerateur National D' Ions Lourds, BP 55027, F-14076 Caen Cedex 05 (France); Henzlova, D. [Los Alamos National Laboratory, Safeguards Science and Technology Group N-1, Los Alamos, NM 87545 (United States); Paradela, C. [Group GENP, Dpto. Fisica de Particulas, Universidade de Santiago de Compostela, 15782 Santiago de Compostela (Spain); Bacquias, A. [DSM/IRFU/CEA, 91191 Gif-sur-Ivette (France); Universite Louis Pasteur, Strasbourg (France); Loureiro, D. P. [Group GENP, Dpto. Fisica de Particulas, Universidade de Santiago de Compostela, 15782 Santiago de Compostela (Spain); Foehr, V. [GSI, Planckstrasse 1, 64941, Darmstadt (Germany); Tarrio, D. [Group GENP, Dpto. Fisica de Particulas, Universidade de Santiago de Compostela, 15782 Santiago de Compostela (Spain); Kezzar, K. [DSM/IRFU/CEA, 91191 Gif-sur-Ivette (France)


    Total fission cross section induced by protons in {sup 181}Ta and {sup 208}Pb at energies in the range of 300 to 1000 A MeV have been measured at GSI (Germany) using the inverse kinematics technique. A dedicated setup with high efficiency made it possible to determine these cross sections with high accuracy. The new data seed light in the controversial results obtained so far and contribute to the understanding of the fission process at high excitation energies. (authors)

  4. Study of elastic pion scattering from 9Be, 28Si, 58Ni, and 208Pb at 162 MeV

    International Nuclear Information System (INIS)

    Elastic pion scattering from 9Be, 28Si, 58Ni, and 208Pb at 162 MeV is analyzed and compared with an optical model theory which incorporates a pion--nucleon range. Excellent fits to the data are obtained in all but one case. The fitted values of the pion--nucleon range, as well as other fitted values are listed. 108 references

  5. Probing Shell Correction at High Spin by Neutron Emission of Doubly Magic Nuclei 208pb and 132Sn

    Institute of Scientific and Technical Information of China (English)



    Shell effects in particle emission for two doubly magic nuclei 132Sn and 208pb were studied in the framework of Smoluchowski equation taking into account temperature and spin-dependent shell correction. It is shown that the shelle ffects in the emission of pre-scission neutrons are sensitive to the spin dependence of the shell correction at a moderate excitation energy. Therefore, we propose to use neutron multiplicity as an observable to probe the shell correction at high spins.

  6. Probing Shell Correction at High Spin by Neutron Emission of Doubly Magic Nuclei 208pb and 132Sn

    Institute of Scientific and Technical Information of China (English)

    YE Wei


    Shell effects in particle emission for two doubly magic nuclei 132 Sn and 208 Pb were studied in the framework of Smoluchowski equation taking into account temperature and spin-dependent shell correction. It is shown that the shell effects in the enission of pre-scission neutrons are sensitive to the spin dependence of the shell correction at a moderate excitation energy. Therefore, we propose to use neutron multiplicity as an observable to probe the shell correction at high spins.



    Arriagada, Gloria; Paredes, Roberto; Olate, Juan; van Wijnen, Andre; Lian, Jane B.; Stein, Gary S.; Stein, Janet L.; Onate, Sergio; Montecino, Martin


    Upon ligand binding the 1α,25-dihydroxy vitamin D3 receptor (VDR) undergoes a conformational change that allows interaction with coactivator proteins including p160/SRC family members and the multimeric DRIP complex through the DRIP205 subunit. Casein kinase II (CKII) phosphorylates VDR both in vitro and in vivo at serine 208 within the hinge domain. This phosphorylation does not affect the ability of VDR to bind DNA, but increases its ability to transactivate target promoters. Here, we have ...

  8. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    Energy Technology Data Exchange (ETDEWEB)

    Patin, Joshua B.


    The study of the reactions between heavy ions and {sup 208}Pb, {sup 209}Bi, {sup 238}U, and {sup 248} Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the {sup 238}U({sup 18}O,xn){sup 256-x}Fm, {sup 238}U({sup 22}Ne,xn){sup 260-x}No, and {sup 248}Cm({sup 15}N,xn){sup 263-x}Lr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The {sup 208}Pb({sup 48}Ca,xn){sup 256-x}No, {sup 208}Pb({sup 50}Ti,xn){sup 258-x}Rf, {sup 208}Pb({sup 51}V,xn){sup 259-x}Db, {sup 209}Bi({sup 50}Ti,xn){sup 259-x}Db, and {sup 209}Bi({sup 51}V,xn){sup 260-x}Sg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics.

  9. Study of shell evolution around the doubly magic $^{208}$Pb via a multinucleon transfer reaction with an unstable beam

    CERN Multimedia

    This proposal aims at the study of the neutron-rich region around the doubly-magic nucleus $^{208}$Pb populated via a multinucleon transfer reaction. An unstable $^{94}$Rb beam will be delivered by HIE-ISOLDE at 5.5 MeV$\\cdot$u onto a $^{208}$Pb 13.0 mg/cm$^{2}$ target. The $\\gamma$- rays will be recorded by the MINIBALL $\\gamma$-ray spectrometer. The aim of the experiment is twofold: \\\\ \\\\ i) firstly it will represent the proof of principle that multinucleon transfer reactions with neutron-rich unstable beams is efficient to populate neutron-rich heavy binary partners and represents a competitive method to cold fragmentation \\\\ ii) secondly we aim at populating medium- to high-spin states in $^{212;214}$Pb and $^{208;210}$Hg to elucidate the existence of the 16$^{+}$ isomer in the lead isotopes and at the same time to disentangle the puzzling case of a very low energy 3$^{-}$ state in $^{210}$Hg not described by any nuclear model. \\\\ \\\\ The experimental results will be compared with large-scale shell-model ...

  10. Low-energy 9 Be + 208 Pb scattering, breakup and fusion within a four-body model (United States)

    Hussein, Mahir; Descouvemont, Pierre; Druet, T.; Canto, L. Felipe


    We investigate the 9 Be elastic scattering, breakup and fusion at energies around the Coulomb barrier. The three processes are described simultaneously, with identical conditions of calculations. The 9 Be nucleus is defined in an α + α + n three-body model, using the hyperspherical coordinate method. We first analyze spectroscopic properties of 9 Be, and show that the model provides a fairly good description of the low-lying states. The scattering with 208 Pb is then studied with the Continuum Discretized Coupled Channel (CDCC) method, where the α + α + n continuum is approximated by a discrete number of pseudostates. The use of a three-body model for 9 Be improves previous theoretical works, where 9 Be is assumed to have a two-body structure (9 Be +n or α + 5 He), although neither 8 Be nor 5 He are bound. Optical potentials for the α+208 Pb and n+208 Pb systems are taken from the literature. Scattering, breakup and fusion cross sections are calculated. In general, a good agreement with experiment is obtained, considering that there is no parameter fitting. We show that continuum effects increase at low energies, and confirm that breakup channels enhance the fusion cross Supported by CNPq, FAPESP, FAPERJ, CAPES/ITA.

  11. Gamma strength function and level densities of $^{208}$Pb from forward-angle proton scattering at 295 MeV

    CERN Document Server

    Bassauer, S; Tamii, A


    Gamma strength functions (GSFs) and level densities (LDs) are essential ingredients of statistical nuclear reaction theory with many applications in astrophysics, reactor design, and waste transmutation. The aim of the present work is a test of systematic parametrizations of the GSF recommended by the RIPL-3 data base for the case of $^{208}$Pb. The upward GSF and LDs in $^{208}$Pb are compared to gamma decay data from an Oslo-type experiment to examine the validity of the Brink-Axel (BA) hypothesis. The E1 and M1 parts of the total GSF are determined from high-resolution forward angle inelastic proton scattering data taken at 295 MeV at RCNP, Osaka, Japan. Total LDs in $^{208}$Pb are derived from $1^-$ LDs extracted with a fluctuation analysis in the energy region of the isovector giant dipole resonance. The E1 GSF is compared to parametrizations recommended by the RIPL-3 data base showing systematic deficiencies of all models in the energy region around neutron threshold. The new data for the poorly known s...

  12. Elastic and inelastic scattering of polarized protons from lead-206 and lead-208 near isobaric analog resonances

    International Nuclear Information System (INIS)

    Excitation functions have been measured for elastic scattering of polarized protons from 206Pb and 208Pb, and for inelastic scattering to collective states in 206Pb (2+, 0.8033 MeV; 3-, 2.647 MeV) and 208Pb (3-, 2.6145 MeV). Both differential cross sections and analyzing powers were measured at theta/sub lab/ = 1200, 1350, 1500, and 1650, for E/sub p/ = 14.25 to 18 MeV. Fits to the excitation-function data were obtained using scattering amplitudes consisting of sums of resonant and non-resonant parts. The resonances are the isobaric analogs (IARs) of 7 low-lying states in 209Pb and 35 in 207Pb. The fits to the elastic-scattering data are excellent; for the inelastic scattering the fit is very good for the 2+ state but only fair for the 3- states. For each IAR, the energy, the total width, and the partial width and mixing phase in each channel were obtained. Also, new spin assignments were made for a number of parent states in 207Pb. The theory of Bund and Blair was used to find the spectroscopic amplitudes, which provide information on the wave functions for the parent states in 207Pb and 209Pb and for the 3- states in 206Pb and 208Pb. These spectroscopic amplitudes were then checked for internal consistency and compared with the results of other experiments and with theoretical predictions

  13. Radiogenic Lead with Dominant Content of 208Pb: New Coolant and Neutron Moderator for Innovative Nuclear Facilities

    Directory of Open Access Journals (Sweden)

    A. N. Shmelev


    Full Text Available As a rule materials of small atomic weight (light and heavy water, graphite, and so on are used as neutron moderators and reflectors. A new very heavy atomic weight moderator is proposed—radiogenic lead consisting mainly of isotope 208Pb. It is characterized by extremely low neutron radiative capture cross-section (0.23 mbarn for thermal neutrons, i.e., less than that for graphite and deuterium and highest albedo of thermal neutrons. It is evaluated that the use of radiogenic lead makes it possible to slow down the chain fission reaction on prompt neutrons in a fast reactor. This can increase safety of the fast reactors and reduce as well requirements pertaining to the fuel fabrication technology. Radiogenic lead with high 208Pb content as a liquid-metal coolant of fast reactors helps to achieve a favorable (negative reactivity coefficient on coolant temperature. It is noteworthy that radiogenic lead with high 208Pb content may be extracted from thorium (as well as thorium-uranium ores without isotope separation. This has been confirmed experimentally by the investigations performed at San Paulo University, Brazil.

  14. The neutron skin thickness from the measured electric dipole polarizability in $^{68}$Ni, $^{120}$Sn, and $^{208}$Pb

    CERN Document Server

    Roca-Maza, X; Centelles, M; Agrawal, B K; Colo', G; Paar, N; Piekarewicz, J; Vretenar, D


    The information on the symmetry energy and its density dependence is deduced by comparing the available data on the electric dipole polarizability $\\alpha_D$ of ${}^{68}$Ni, ${}^{120}$Sn, and ${}^{208}$Pb with the predictions of Random Phase Approximation, using a representative set of nuclear energy density functionals. The calculated values of $\\alpha_D$ are used to validate different correlations involving $\\alpha_D$, the symmetry energy at the saturation density $J$, corresponding slope parameter $L$ and the neutron skin thickness $\\Delta r_{\\!np}$, as suggested by the Droplet Model. A subset of models that reproduce simultaneously the measured polarizabilities in ${}^{68}$Ni, ${}^{120}$Sn, and ${}^{208}$Pb are employed to predict the values of symmetry energy parameters at saturation density and $\\Delta r_{\\!np}$. The resulting intervals are: $J\\!=\\!30 \\text{-}35$ MeV, $L\\!=\\!20 \\text{-} 66$ MeV; and the values for $\\Delta r_{\\!np}$ in ${}^{68}$Ni, ${}^{120}$Sn, and ${}^{208}$Pb are in the ranges: 0.15\\t...

  15. 基于SSI208接口模块的光电编码器数据采集设计

    Institute of Scientific and Technical Information of China (English)

    靳红涛; 陈朝基; 赵勇进; 席丹; 赵娜



  16. Pharmacokinetic-pharmacodynamic modeling of the antitumor effect of TM208 and EGFR-TKI resistance in human breast cancer xenograft mice (United States)

    Ji, Xi-wei; Ji, Shuang-min; Li, Run-tao; Wu, Ke-hua; Zhu, Xiao; Lu, Wei; Zhou, Tian-yan


    Aim: The novel anticancer compound TM208 is an EGFR tyrosine kinase inhibitor (EGFR-TKI). Since the development of resistance to EGFR-TKIs is a major challenge in their clinical usage, we investigated the profiles of resistance following continuous treatment with TM208 in human breast cancer xenograft mice, and identified the relationship between the tumor pEGFR levels and tumor growth inhibition. Methods: Female BALB/c nude mice were implanted with human breast cancer MCF-7 cells, and the xenograft mice received TM208 (50 or 150 mg·kg−1·d−1, ig) or vehicle for 18 d. The pharmacokinetics (PK) and pharmacodynamics (PD) of TM208 were evaluated. Results: The PK properties of TM208 were described by a one-compartment model with first-order absorption kinetics. Our study showed the inhibitory effects of TM208 on tumor pEGFR levels gradually reached a maximum effect, after which it became weaker over time, which was characterized by a combined tolerance/indirect response PD model with an estimated EC50 (55.9 μg/L), as well as three parameters ('a' of 27.2%, 'b' of 2730%, 'c' of 0.58 h−1) denoting the maximum, extent and rate of resistance, respectively. The relationship between the tumor pEGFR levels and tumor growth inhibition was characterized by a combined logistic tumor growth/transit compartment model with estimated parameters associated with tumor growth characteristics kng (0.282 day−1), drug potency kTM208 (0.0499 cm3/day) and the kinetics of tumor cell death k1 (0.141 day−1), which provided insight into drug mechanisms and behaviors. Conclusion: The proposed PK/PD model provides a better understanding of the pharmacological properties of TM208 in the treatment of breast cancer. Furthermore, simulation based on a tolerance model allows prediction of the occurrence of resistance. PMID:27133303

  17. Dipole response in 208Pb within a self-consistent multiphonon approach (United States)

    Knapp, F.; Lo Iudice, N.; Veselý, P.; Andreozzi, F.; De Gregorio, G.; Porrino, A.


    Background: The electric dipole strength detected around the particle threshold and commonly associated with the pygmy dipole resonance offers unique information on neutron skin and symmetry energy, and is of astrophysical interest. The nature of such a resonance is still under debate. Purpose: We intend to describe the giant and pygmy resonances in 208Pb by enhancing their fragmentation with respect to the random-phase approximation. Method: We adopt the equation of motion phonon method to perform a fully self-consistent calculation in a space spanned by one-phonon and two-phonon basis states using an optimized chiral two-body potential. A phenomenological density-dependent term, derived from a contact three-body force, is added to get single-particle spectra more realistic than the ones obtained by using the chiral potential only. The calculation takes into full account the Pauli principle and is free of spurious center-of-mass admixtures. Results: We obtain a fair description of the giant resonance and obtain a dense low-lying spectrum in qualitative agreement with the experimental data. The transition densities as well as the phonon and particle-hole composition of the most strongly excited states support the pygmy nature of the low-lying resonance. Finally, we obtain realistic values for the dipole polarizability and the neutron skin radius. Conclusions: The results emphasize the role of the two-phonon states in enhancing the fragmentation of the strength in the giant resonance region and at low energy, consistently with experiments. For a more detailed agreement with the data, the calculation suggests the inclusion of the three-phonon states as well as a fine tuning of the single-particle spectrum to be obtained by a refinement of the nuclear potential.

  18. Favorable features in kinetics of fast reactors with physically thick 208Pb-reflector

    International Nuclear Information System (INIS)

    Light materials with small atomic mass (light or heavy water, graphite and so on) are usually used as a neutron reflector and moderator. The present paper proposes to use a new, very heavy neutron moderator and reflector, namely 'radiogenic lead' with dominant content of isotope 208Pb. Radiogenic lead is a stable natural lead contained in the ore deposits with thorium component, usually, they are poly-metallic ores of rare earth elements. The lead is actually a final product of radioactive decay chains starting from uranium and thorium (see appendix bellow). This isotope is characterized by extremely low micro cross-section of radiative neutron capture (∼0.23 mb for thermal neutrons, smaller than graphite and deuterium cross-sections) and large albedo for thermal neutrons. The following mathematical models of neutron kinetics are applied to analyze the quick-proceeding processes initiated by reactivity jump in the reactor cores surrounded by physically thick, weakly absorbing neutron reflector: one-point, two-point, multi-point and continuous models. It was revealed that the results of one-point and two-point models differed substantially from those obtained by multi-point and continuous kinetic models which were developed by authors and described in the paper. Also, the paper demonstrates that only multi-point and continuous models are able to follow up adequately neutron kinetics in the fast reactor core surrounded by a physically thick and weakly absorbing neutron reflector. The summand of the 'inverse-hour' equation defining kinetic effects of the neutron reflector was analyzed in detail. It is evaluated that the use of radiogenic lead makes it possible to slow down the chain fission reaction on prompt neutrons in the fast reactor. This can improve the fast reactor safety and reduce some requirements to the technologies used to fabricate fuel for the fast reactor. (author)

  19. Study of binary fragmentation and compound nucleus sion in the fission reaction 50Ti + 208Pb

    International Nuclear Information System (INIS)

    The synthesis of super-heavy elements (She's) continues to be one of premiere frontiers of nuclear physics. There have been several reports on the production of super-heavy nuclei using different target-projectile combinations using cold fusion reactions by the observation of evaporation residues. However, the sion path in these reactions has not been investigated in full detail. The sion characteristics of the super-heavy nuclei can be studied through binary fragmentation reactions in the exit channel of suitably selected heavy ion reactions, provided that the binary fragmentations resulting from the f sion of compound nucleus can be separated from those resulting from non-compound processes. Further recent experimental data on cold fusion reactions leading to the formation of super-heavy nuclei with Z≤ 113 shows a strong dependence on coulomb parameter. In order to further investigate the dynamics of binary fragmentation and fusion-fission of super-heavy systems, we carried out detailed investigation of fragment mass vs total kinetic energy distribution and neutron emission in the 294 MeV 50Ti + 208Pb reaction, leading to the formation of the super-heavy nucleus 258Rf, for which residues have been experimentally observed. Two Time of Flight arms based on position sensitive MCP detectors were used to catch the two complementary fragments providing a full kinematics reconstruction of the event. The emitted neutrons were detected by using an array of BC501 liquid scintillators. The neutron energy was determined by measuring the time of flight (TOF) with respect to the MCP start signal. A custom digital acquisition system was used. Preliminary results will be presented and discussed

  20. 208例护理人员职业暴露的监测分析与防护%208 cases of nursing personnel professional exposure monitoring analysis and protection

    Institute of Scientific and Technical Information of China (English)

    曾伟杰; 杨翠华; 徐晓芸


    Objective:Monitoring the nurse occupational exposures risk factors, and constantly improve the protection measures. Methods :Occu-pational exposure to 208 cases of the medical personnel to occupational exposure mode, occupational exposures source, exposed as post—processing, monitoring analysis of follow—up. Results:Occupational exposures occurred in medical 99 cases (47. 6%), surgical 82 cases (39. 4%), Infectious Disease Dept.27 cases (13. 0% ). Occupational exposures way for needle stabbing 171 cases (82. 2%), Blood or body fluid spitting pollution skin/mucosa 25 cases (12. 0%), sharp cuts in 12 cases (5. 8%) . Exposure of the first four respectively of hepatitis b. c, syphilis and HIV positive. After exposure to standard the emergency treatment standard, non-standard 201 cases 7 cases. Pertinent measures to prevent drug 32 cases and 208 research objects not related to infections disease. Conclusion:The nurse active self — protection and department functions actively monitoring steering can create an occupational exposure control work is rigorous and loose favorable working environment.%目的:监测护士职业暴露的危险因素,不断完善防护措施.方法:对208例职业暴露的医务人员的职业暴露方式、职业暴露源、暴露后处理、随访等进行监测分析.结果:职业暴露发生在内科99例(47.6%),外科82例(39.4%),感染科27例(13.0%).职业暴露的方式为针刺伤171例(82.2%),血液或体液喷溅污染皮肤/粘膜25例(12.0%),锐器割伤12例(5.8%).暴露源占前四位的分别是乙肝、丙肝、梅毒和HIV阳性;暴露后进行规范的应急处理规范201例,不规范7例.针对性实施预防用药32例,208名研究对象没有感染相关的疾病.结论:护士主动的自我防范意识和职能科室积极的监测督导能为职业暴露防治工作创造一个既严谨又宽松有利的工作环境.

  1. Quasifission role in the anisotropy of fragment angular distribution of 19F+208Pb reaction

    International Nuclear Information System (INIS)

    Full text: Role of quasifission was analyzed in the angular anisotropy of the fission-like reaction fragments in the framework of the model based on the conception of dinuclear system (DNS) and used to calculate the partial capture and complete fusion cross sections [1,2,3]. This model allows us to calculate the entrance channel dynamics of the nuclei to be captured with different orientation angles of their axes. We theoretically analyzed the experimental data for mean square values 2> and the angular anisotropy A for the 19F+208Pb reaction which was studied in Ref. [4, 5]. The experimental studies of fission angular distributions in heavy ion reactions show distinct deviation from the SSM theory. Our results of the reaction cross sections showed the presence of quasifission process. Considering the quasifission as 'fission' of the dinuclear system from a non compact shape we estimated mean square values of the angular momentum and anisotropy of the angular distribution of reaction fragments. This was possible with the known angular momentum distributions of complete fusion and quasifission calculated in our model. Comparison of the results with the experimental data shows that the fission data presented in Ref. [4, 5] are in good agreement with our fusion cross sections at energies near the barrier and contain contributions of quasifission at higher energies. Our results of the mean square values of the angular momentum and anisotropy of the angular distributions of reaction fragments are in good agreement with the experimental data if we include quasifission contributions. From a fit of the experimental data for fusion-fission cross section we found which part of quasifission fragments is mixed with the fragments from the compound nucleus fission. So, we conclude that the main reason of the failure of the standard statistical model for the description of the angular anisotropy of the fission fragments at higher than Coulomb barrier is the presence of the

  2. The roles of bacterial biofilm and oxidizing enzymes in the biodegradation of plastic by the bacterium Rhodococcus ruber (C208) (United States)

    Sivan, A.; Gilan, I.; Santo, M.


    Synthetic polymers such as polyethylene are amongst the most durable plastic materials and, therefore are resistant to natural biodegradation resulting in their accumulation in the environment posing a global hazard. We have carried out a two-step enrichment procedure aimed at the isolation of polyethylene-degrading bacteria from soil. The initial enrichment was carried out in soil and the second, in a liquid mineral medium supplemented with linear low-density polyethylene (LDPE; MW 191,000) as the sole carbon source. UV-photooxidation may enhance biodegradation by the formation of carbonyl residues that can be utilized by microorganisms. This screening gave rise to several bacterial strains that were capable of degrading polyethylene. One of these strains (C208), identified as the actinomycete Rhodococcus ruber, colonized the polyethylene producing a biofilm which eventually lead to the degradation of the polyethylene. Adherence and colonization of planktonic C208 cells to the polyethylene surface occurred within minutes from exposure to the polyolefin. This resulted in formation of an initial biofilm that differentiated into cell-aggregation-forming microcolonies. Further organization yielded three-dimensional sessile structures as the mature biofilm. The ratio between the population densities, of the biofilm and planktonic, was about 60:1, indicating a high preference for the biofilm mode of growth. Analysis of the extra-cellular polymeric substances (EPS) in the biofilm of C208 revealed that the polysaccharides level was up to 2.5 folds higher than that of the protein. Surprisingly, the EPS also contained DNA that is actively excreted from live bacterial cells. This is supported by the reduction in biofilm content (but not in viability) following addition, of DNase 1 and RNAse A. The biofilm showed a high viability even after 60 days of incubation in a carbon free medium. This durability of the biofilm, can be attributed to biodegradation of polyethylene. A

  3. (π±, π±' N) reactions on 12C and 208Pb near the giant resonance region

    International Nuclear Information System (INIS)

    Angular distributions for the 12C(π±, π±' p) and 208Pb(π±, π±' p or n) reactions near the giant resonance region have been measured at Tπ = 180 MeV, and found different between π+ and π- data. This observation is interpreted as evidence for different excitation mechanisms dominating the π--nucleus and π+-nucleus interactions in the giant resonance region of these targets. A comparison with the single-nucleon knock-out distorted-wave impulse approximation calculations shows, even though these calculations underestimate (π±, π±' N) data for both targets, the dominance of direct process for (π+, π+' p) or (π-, π-' n) in contrast to (π-, π-' p) or (π+, π+' n). In the (π+, π+' p) reaction proton-proton hole states are excited directly and appear to have a large probability for direct decay with escape width, whereas in (π-, π-' p) the preferentially excited neutron-neutron hole doorway states couple to resonance states and decay with spreading width. This interpretation led us to suggest that the ratio of cross-sections for inelastic scattering to the giant resonance region should be written in terms of an incoherent sum of cross-sections to neutron and proton doorway states. In a heavy nucleus such as 208Pb, neutron and proton doorway states. In a heavy nucleus such as 208Pb, neutron and proton doorway states contribute incoherently because the different decay processes do not populate the same final states of the residual nucleus

  4. Measurement of the Neutron Radius of 208Pb Through Parity Violation in Electron Scattering

    Energy Technology Data Exchange (ETDEWEB)

    Saenboonruang, Kiadtisak [Univ. of Virginia, Charlottesville, VA (United States)


    In contrast to the nuclear charge densities, which have been accurately measured with electron scattering, the knowledge of neutron densities still lack precision. Previous model-dependent hadron experiments suggest the difference between the neutron radius, Rn, of a heavy nucleus and the proton radius, Rp, to be in the order of several percent. To accurately obtain the difference, Rn-Rp, which is essentially a neutron skin, the Jefferson Lab Lead (208Pb) Radius Experiment (PREX) measured the parity-violating electroweak asymmetry in the elastic scattering of polarized electrons from 208Pb at an energy of 1.06 GeV and a scattering angle of 5° . Since Z0 boson couples mainly to neutrons, this asymmetry provides a clean measurement of Rn with respect to Rp. PREX was conducted at the Jefferson lab experimental Hall A, from March to June 2010. The experiment collected a final data sample of 2x 107 helicity-window quadruplets. The measured parity-violating electroweak asymmetry APV = 0.656 ± 0.060 (stat) ± 0.014 (syst) ppm corresponds to a difference between the radii of the neutron and proton distributions, Rn-Rp = 0.33+0.16-0.18 fm and provides the first electroweak observation of the neutron skin as expected in a heavy, neutron-rich nucleus. The value of the neutron radius of 208Pb has important implications for models of nuclear structure and their application in atomic physics and astrophysics such as atomic parity non-conservation (PNC) and neutron stars.

  5. Interaction of 8.5 MeV per nucleon 208Pb with natural lead studied with mica track detectors

    International Nuclear Information System (INIS)

    The interaction of 8.5 MeV per nucleon 208Pb with a natural Pb target was studied with mica solid-state nuclear track detectors in 2 π geometry. Three-dimensional analysis of the components of the events was performed, and the track parameters were converted to reaction product parameters. Reaction parameters such as the total reaction cross-section, the maximum angular momentum, the interaction radius and the partial reaction cross-sections for the emission of 2, 3 and 4 heavy charged particles were obtained. Attempts were made to discuss the possible modes of interaction. (orig.)

  6. Can three-neutron forces be constrained by empirical information on the neutron skin of 48Ca and 208Pb?

    CERN Document Server

    Sammarruca, Francesca


    We calculate the neutron matter equation of state from two-neutron forces up to ?fifth order of the chiral expansion and investigate the order-by-order convergence of the predictions. Based on these equations of state, we derive the binding energies and the neutron and proton density distributions in 208Pb and 48Ca, with particular attention to the neutron skins. Anticipating future experiments which will provide reliable information on the weak charge density in nuclei, we discuss the theoretical uncertainties and the possibility of constraining the size of three-neutron forces in neutron matter.

  7. Response function of the magnetic spectrometer PRISMA for the multinucleon transfer reaction {sup 40}Ar+{sup 208}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Mijatovic, T.; Szilner, S.; Corradi, L.; Courtin, S.; Farnea, E.; Fioretto, E.; Gadea, A.; Goasduff, A.; Haas, F.; Jelavic-Malenica, D.; Lunardi, S.; Mengoni, D.; Montagnoli, G.; Montanari, D.; Pollarolo, G.; Recchia, F.; Sahin, E.; Scarlassara, F.; Soic, N.; Stefanini, A. M. [Ruder Boskovic Institute, Zagreb (Croatia); INFN, Laboratori Nazionali di Legnaro, Legnaro (Italy); IPHC, CNRS-IN2P3, Universite de Strasbourg, Strasbourg (France); and others


    Multinucleon transfer reaction {sup 40}Ar+{sup 208}Pb has been investigated with the PRISMA-CLARA experimental setup in LNL, INFN, Italy. The experimental differential cross sections have been obtained for different transfer channels by measuring more than {Delta}{theta}{sub lab} = 20 Degree-Sign covered by three angular settings of PRISMA. Results have been compared with the semiclassical calculation GRAZING. Since the understanding of the reaction mechanism depends strongly on the determination of absolute cross section, effect of transport of ions through PRISMA has been studied via a Monte Carlo simulation code.

  8. Elastic scattering and α-particle production in 6He + 208Pb collisions at 22 MeV (United States)

    Acosta, L.; Sánchez-Benítez, A. M.; Gómez, M. E.; Martel, I.; Pérez-Bernal, F.; Pizarro, F.; Rodríguez-Quintero, J.; Rusek, K.; Alvarez, M. A. G.; Andrés, M. V.; Espino, J. M.; Fernández-García, J. P.; Gómez-Camacho, J.; Moro, A. M.; Angulo, C.; Cabrera, J.; Casarejos, E.; Demaret, P.; Borge, M. J. G.; Escrig, D.; Tengblad, O.; Cherubini, S.; Figuera, P.; Gulino, M.; Freer, M.; Metelko, C.; Ziman, V.; Raabe, R.; Mukha, I.; Smirnov, D.; Kakuee, O. R.; Rahighi, J.


    Experimental results of the elastic scattering of 6He on 208Pb at ELAB=22 MeV, measured at the CRC facility (Louvain-la-Neuve, Belgium), are presented, including results on the 4He production channel. These data were taken with full angular coverage and high angular resolution. Both experimental cross sections are compared with continuum discretized coupled channels and distorted-wave Born approximation calculations, where direct breakup and transfer to the continuum processes are considered. The elastic data confirm the absence of the Coulomb rainbow, while the distribution of α particles indicates that such production is mostly generated by transfer to the continuum.

  9. Study of the γ decay of high-lying states in 208Pb via inelastic scattering of 17O ions

    Directory of Open Access Journals (Sweden)

    Crespi F.C.L.


    Full Text Available A measurement of the high-lying states in 208Pb has been made using 17O beams at 20 MeV/u. The gamma decay following inelastic excitation was measured with the detector system AGATA Demonstrator based on segmented HPGe detectors, coupled to an array of large volume LaBr3:Ce scintillators and to an array of Si detectors. Preliminary results in comparison with (γ,γ’ data, for states in the 5-8 MeV energy interval, are presented.

  10. Study of '8.5 MeV/nucleon 208Pb+Pb (natural)' interaction using mica track detectors

    International Nuclear Information System (INIS)

    Interaction of 8.5. MeV/nucleon- 208Pb with Pb (natural) has been studied using mica track detectors in 2Π -geometry. Multiprong events have been analysed for track parameters and their inter-correlation. The data so obtained have been used to obtain the partial cross-sections and the total reaction cross-section. Value of the total reaction cross-section has also been calculated and compared with the one obtained experimentally. Possible modes of interaction have been discussed in the light of the experimental data. (author)

  11. Cross-sections of spallation residues produced in 1A GeV 208Pb on proton reactions

    International Nuclear Information System (INIS)

    Spallation residues produced in 1 GeV per nucleon 208Pb on proton reactions have been studied using the fragment separator facility at GSI. Isotopic production cross-sections of elements from 61Pm to 82Pb have been measured down to 0.1 mb with a high accuracy. The recoil kinetic energies of the produced fragments were also determined. The obtained cross-sections agree with most of the few existing gamma-spectroscopy data. Data are compared with different intranuclear-cascade and evaporation-fission models. Drastic deviations were found for a standard code used in technical applications. (orig.)

  12. Quantum molecular dynamics approach to estimate spallation yield from + 208Pb reaction at 800 MeV

    Indian Academy of Sciences (India)

    P K Sarkar; Maitreyee Nandy


    The spallation yield of neutrons and other mass fragments produced in 800 MeV proton induced reaction on 208Pb have been calculated in the framework of quantum molecular dynamics (QMD) model. The energy spectra and angular distribution have been calculated. Also, multiplicity distributions of the emitted neutrons and kinetic energy carried away by them have been estimated and compared with the available experimental data. The agreement is satisfactory. A major contribution to the neutron emission comes from statistical decay of the fragments. For mass and charge distributions of spallation productsthe QMD process gives rise to target-like and projectile-like fragments only.

  13. Study of the elastic scattering of 6He on 208Pb at energies around the Coulomb barrier

    International Nuclear Information System (INIS)

    The elastic scattering of 6He on 208Pb has been measured at laboratory energies of 14, 16, 18 and 22 MeV. These data were analyzed using phenomenological Woods-Saxon form factors and optical model calculations. A semiclassical polarization potential was used to study the effect of the Coulomb dipole polarizability. Evidence for long range absorption, partially arising from Coulomb dipole polarizability, is reported. The energy variation of the optical potential was found to be consistent with the dispersion relations which connect the real and imaginary parts of the potential

  14. Tl-208, Pb-212, Bi-212, Ra-226 and Ac-228 adsorption onto polyhydroxyethylmethacrylate-bentonite composite

    International Nuclear Information System (INIS)

    The adsorption of naturally occurring radionuclides (208Tl+, 212Pb2+, 226Ra2+, 212Bi3+ and 228Ac3+) onto Polyhydroxyethylmethacrylate-bentonite (PHEMA-B) composite was investigated. Experimentally obtained isotherms were evaluated with reference to Langmuir, Freundlich and Dubinin-Radushkevich (DR) models. The adsorption isotherms were L type of Giles classification proving that PHEMA-B had a high affinity adsorbent for the studied radionuclides. The Langmuir adsorption capacities (XL) were in the order of 226Ra (2.8 MBq kg-1)>212Bi (0.4 MBq kg-1)>212Pb (0.3 MBq kg-1)>228Ac and 208Tl (0.2 MBq kg-1). The adsorption process was physical via complex formation after proton exchanger for which the adsorption energies obtained from DR model was evidence. The enthalpy and entropy changes were positive and the negative free enthalpy change was proof for the spontaneity of adsorption. The reusability tests for PHEMA-B for five uses demonstrated that the adsorbent could be reused after complete recovery of the loaded radionuclide ions by 1 M HCl. The chemical structure of the composite did not change after the reuses and storage foregoing.

  15. Study of the γ decay of high-lying states in 208Pb via inelastic scattering of 17O ions

    Directory of Open Access Journals (Sweden)

    Crespi F.C.L.


    Full Text Available High-lying states in 208Pb nucleus were populated via inelastic scattering of a 17O beam at bombarding energy of 20 MeV/u. Their subsequent gamma decay was measured with the detector system AGATA Demonstrator based on HPGe detectors, coupled to an array of large volume LaBr3:Ce scintillators. Preliminary results in comparison with (γ,γ′ data, for states in the 5–8 MeV energy interval, seem to indicate that in that region the states belong to two different groups one with a isoscalar character and the other with a isovector nature. This is similar to what was observed in other stable nuclei with (α,α′γ experiments. The multipolarity of the observed gamma transitions is determined with remarkable sensitivity thanks to angular distribution measurements. Data aiming at studying the neutron decay of the Giant Quadrupole Resonance in the 208Pb by the high resolution measurement of the following gamma decay are also presented in their preliminary form.

  16. Constraints on the Neutron Skin and the Symmetry Energy from the Anti-analog Giant Dipole Resonance in 208Pb

    CERN Document Server

    Cao, L G; Colo', G; Sagawa, H


    We investigate the impact of the neutron-skin thickness Delta(R) on the energy difference between the anti-analog giant dipole resonance (AGDR), E(AGDR), and the isobaric analog state (IAS), E(IAS), in a heavy nucleus such as 208Pb. For guidance, we first develop a simple and analytic, yet physical, approach based on the Droplet Model that linearly connects the energy difference E(AGDR)-E(IAS) with Delta(R). To test this correlation on more fundamental grounds, we employ a family of systematically varied Skyrme energy density functionals where variations on the value of the symmetry energy at saturation density J are explored. The calculations have been performed within the fully self consistent Hartree-Fock (HF) plus charge-exchange random phase approximation (RPA) framework. We confirm the linear correlation within our microscopic apporach and, by comparing our results with available experimental data in 208Pb, we find that our analysis is consistent with Delta(R) = 0.204 \\pm 0.009 fm, J = 31.4 \\pm 0.5 MeV ...

  17. Study of quasielastic scattering of electrons on a heavy ion 208Pb. Separation of longitudinal and transverse inclusive cross section

    International Nuclear Information System (INIS)

    This thesis presents the results of the deep inelastic scattering cross section study on 208Pb. The measurement of these cross sections has been performed from 140 MeV to 645 MeV incident energy for these five values of the scattering angle: 35, 60, 75, 90 and 143 degrees. We have performed the separation of the measured cross section in one longitudinal and one transverse structure functions with the Rosenbluth Diagram method after performing radiative corrections and corrections from the coulomb distortion effects, between 300 and 650 MeV/c for the effective momentum transfer and up to 350 MeV for the energy transfer. The transverse response function shows a disagreement with the independent particle models predictions. The contribution of the exchange currents and the pion electroproduction processes have not been estimated for 208Pb, but will make an explanation for the observed disagreement. The longitudinal response function disagrees also with classical models predictions. The explanation of the longitudinal response reduction in terms of nucleon-nucleon correlations is not satisfying since the strength is only pushed towards higher values of the energy transfer, and the resulting coulomb sum rule (integration over the quasi-elastic peak) still overestimating the experimental values. The particle-hole correlations in the Random Phase Approximation framework, do not improve the disagreement with the experiment. While the modification of the nucleon properties in the nuclear medium would be one better explanation of the result of our experiment

  18. Complete files of neutron- and proton-induced nuclear data to 1 GeV for {sup 208}Pb target

    Energy Technology Data Exchange (ETDEWEB)

    Grudzevich, O.; Martirosyan, J. [State Technical Univ., Obninsk (Russian Federation); Yavshits, S. [Khlopin Radium Institute, St. Petersburg (Russian Federation)


    Nuclear data for high projectile energies are needed to design an Accelerator Driven System (target, material activation, heating, shielding, etc.). The files of evaluated neutron and proton nuclear data were created in Endf-6 format for the projectile particle energies from 20 MeV to 1000 MeV. The evaluated data of the files are based mainly on the modern theoretical model calculations with MCFx code. Three mechanism of nuclear reaction were modeled in computing: i) intranuclear cascade; ii) preequilibrium exciton multiparticle emission and iii) statistical decay of excited nuclei. The experimental data available were used to benchmark the model calculation results. The data on neutron total and reaction cross sections were used to create and check the set of the optical model parameters in wide energy region. The experimental spectra of {sup 208}Pb(p,xn) reaction for projectile energies up to 160 MeV were described with one set of the model parameter. The measured fission cross sections of {sup 208}Pb by protons and neutrons were described without fitting practically. The files contain total cross sections, fission cross sections, elastic scattering cross sections and angular distributions, proton- and neutron energy-angular distributions. (authors)

  19. Sub-barrier interaction of deuterons with 58,62Ni, 124Sn and 208Pb nuclei

    International Nuclear Information System (INIS)

    The elastic scattering and (d, p) reaction on nuclei 58,62Ni, 124Sn and 208Pb have been studied in order to determine the features of sub-barrier interaction of deuterons with nuclei of different masses. Experimental data were obtained at electrostatic tandem accelerator EGP-10K of the Institute for Nuclear Research (Kyiv) using the deuteron beam with energy in the range Ed = 3.5 - 7.3 MeV. The calculations of differential and integral (over the neutron emission angles) cross sections of reactions A(d, p)nA were performed. Analysis of the calculations and the measured inclusive spectra of protons and their integrated over the energy yields showed that the differences of experimental and theoretical cross sections of deuteron elastic scattering on the 58,62Ni, 124Sn and 208Pb nuclei are mainly caused by the process of neutron transfer to the target nuclei (reaction A(d, p)A + 1), which was not included in the calculations, but not by deuteron break-up reaction A(d, p)nA

  20. Investigation of the wave functions of low-lying states in 208Pb by the elastic and inelastic scattering of polarized protons from 207Pb

    International Nuclear Information System (INIS)

    The excitation functions of the differential cross section and the analyzing power of the scattering 207Pb(anti p, p') were measured in an energy range from 13.5 to 18 MeV at THETAlab = 1400 and 1600. By analyzing the elastic scattering 38 of in this range appearing isobar analog resonances (IAR) in 208 Bi were identified and their spins determined. The partly hypothetical spin relations out of literature for the states in the parent nucleus 208Pb had to be corrected in many cases. (orig.)

  1. Mass distributions of the system 136Xe + 208Pb at lab energies around the Coulomb barrier: a candidate reactions for production neutron-rich nuclei at N=126


    Kozulin, E. M.; Vardaci, E.; Knyazheva, Galina; Bogachev, Alexey; Dmitriev, S.N.; Itkis, Ioulia; Itkis, M.G.; Knyazev, A.G.; Loktev, T. A.; Novikov, K.V.; Razinkov, E.A.; Rudakov, O.V.; Smirnov, S. V.; Trzaska, Wladyslaw; Zagrebaev, V.I.


    Reaction products from the system 136Xe+208Pb at 136Xe ions laboratory energies of 700, 870, and 1020 MeV were studied by two-body kinematics and by a catcher-foil activity analysis to explore the theoretically proposed suitability of such reaction as a means to produce neutron-rich nuclei in the neutron shell closure N=126. Cross sections for products heavier than 208Pb were measured and were found sensibly larger than new theoretical predictions. Transfers of up to 16 nucleons from Xe to Pb...

  2. Cenozoic variations in the South Atlantic carbonate saturation profile: Insights from the Walvis depth-transect (ODP Leg 208) (United States)

    Schellenberg, S. A.; Nielsen, J. L.


    Ocean Drilling Program Leg 208 Science Party (D. Kroon, J. C. Zachos, P. Blum, J. Bowles, P. Gaillot, T. Hasegawa, E. C. Hawthorne, D. A. Hodell, D. C. Kelly, J. Jung, S. M. Keller, Y. Lee, D. C. Leuschner, Z. Liu, K. C. Lohmann, L. Lourens, S. Monechi, M. Nicolo, I. Raffi, C. Riesselman, U. Röhl, D. Schmidt, A. Sluijs, D. Thomas, E. Thomas, H. Vallius) Carbonate saturation profiles are complex and dynamic products of processes operating on temporospatial scales from the "short-term local" (e.g. carbonate export production) to the "long-term global" (e.g. carbonate-silicate weathering, shelf:basin carbonate partitioning). Established, if admittedly crude, proxies for reconstructing carbonate saturation from sediments include wt% carbonate, where values of 0-20% are typically attributed to deposition below the carbonate compensation depth (CCD), and planktonic foraminifer fragmentation, where enhanced fragmentation is typically attributed to deposition below the lysocline. Ocean Drilling Program Leg 208 successfully drilled a six-site Walvis Ridge depth-transect spanning modern water depths from 2,717 to 4,755 m. Exceptional core recovery, well-constrained biomagnetostratigraphy, and standard crustal subsidence corrections provide a working age-depth framework for contouring ship-board wt% carbonate determinations and identifying the following first-order features of the regional CCD: (1) >3.5 km position from 60-48 Ma punctuated by a major transient shoaling to 4.25 km from 37 to 28 Ma; (4) marked high amplitude fluctuations from 28 to 20 Ma followed by deepening to >4.75 km; (5) transient shoaling to ˜4 km around 15 Ma followed by deepening to >4.75 km by ˜12 Ma. These first-order features are broadly congruent with classic Atlantic CCD reconstructions by van Andel (1975) and Berger and Roth (1975). A wealth of higher frequency variation in carbonate saturation is clearly preserved within the Leg 208 depth-transect. Ongoing shore-based analyses aim to transform

  3. Multinucleon transfer in O,1816,19F+208Pb reactions at energies near the fusion barrier (United States)

    Rafferty, D. C.; Dasgupta, M.; Hinde, D. J.; Simenel, C.; Simpson, E. C.; Williams, E.; Carter, I. P.; Cook, K. J.; Luong, D. H.; McNeil, S. D.; Ramachandran, K.; Vo-Phuoc, K.; Wakhle, A.


    Background: Nuclear reactions are complex, involving collisions between composite systems where many-body dynamics determines outcomes. Successful models have been developed to explain particular reaction outcomes in distinct energy and mass regimes, but a unifying picture remains elusive. The irreversible transfer of kinetic energy from the relative motion of the collision partners to their internal states, as is known to occur in deep inelastic collisions, has yet to be successfully incorporated explicitly into fully quantal reaction models. The influence of these processes on fusion is not yet quantitatively understood. Purpose: To investigate the population of high excitation energies in transfer reactions at sub-barrier energies, which are precursors to deep inelastic processes, and their dependence on the internuclear separation. Methods: Transfer probabilities and excitation energy spectra have been measured in collisions of O,1816,19F+208Pb , at various energies below and around the fusion barrier, by detecting the backscattered projectile-like fragments in a Δ E -E telescope. Results: The relative yields of different transfer outcomes are strongly driven by Q values, but change with the internuclear separation. In 16O+208Pb , single nucleon transfer dominates, with a strong contribution from -2 p transfer close to the Coulomb barrier, though this channel becomes less significant in relation to the -2 p 2 n transfer channel at larger separations. For 18O+208Pb , the -2 p 2 n channel is the dominant charge transfer mode at all separations. In the reactions with 19F,-3 p 2 n transfer is significant close to the barrier, but falls off rapidly with energy. Multinucleon transfer processes are shown to lead to high excitation energies (up to ˜15 MeV), which is distinct from single nucleon transfer modes which predominantly populate states at low excitation energy. Conclusions: Kinetic energy is transferred into internal excitations following transfer, with this

  4. 208例骨瓜提取物注射剂严重不良反应报告分析%Analysis of 208 Cases of Serious Adverse Drug Reactions Induced by Gugua Extracts Injection

    Institute of Scientific and Technical Information of China (English)

    沈晓华; 罗凌凤; 黄亦彬


    目的:探讨骨瓜提取物注射剂致严重药品不良反应的规律及特点。方法采用回顾性研究方法,对208份骨瓜提取物注射剂的严重不良反应报告进行统计分析。结果骨瓜提取物注射剂严重不良反应主要表现为过敏性休克、过敏样反应、寒战、呼吸困难和发热等;严重不良反应多在30 min 内发生,其中过敏性休克主要集中在15 min 内发生。结论有必要对骨瓜提取物注射剂说明书进行修改和完善。%Objective To explore the characters of the serious adverse reactions caused by Gugua extracts injection. Methods 208 reports of the serious adverse reactions caused by Gugua extracts injection were analyzed via retrospective study. Results Gugua extracts injection may lead to serious adverse reactions such as anaphylactic shock, anaphylactoid reaction,rigors,dyspnea,fever, etc. The serious adverse reactions occurred within 30 min, and anaphylactic shock occurred within 15 min. Conclusion It is necessary to re-evaluate the risk of serious adverse reactions caused by Gugua extracts injection and modify the drug instructions on this basis.

  5. Coulomb excitation of giant resonances in 208Pb by E = 84 MeV/nucleon 17O projectiles

    International Nuclear Information System (INIS)

    Inelastic scattering of 84 MeV/nucleon 17O on 208Pb has been measured between 1.50 ≤ θCM ≤ 5.00. The giant resonance structure near 12 MeV is excited with a differential cross section of more than 2b/sr and exhibits a peak-to-continuum ratio as large as 6 to 1. The major part of the cross section can be ascribed to Coulomb excitation of the isovector giant dipole and the giant quadrupole resonance. From the Coulomb excitation of the GQR we deduce a B(E2)↑ = 0.53±0.11 e2b2 which is that expected for a nearly pure isoscalar resonance which exhausts ≅ 60% of the EWSR. (orig.)

  6. Optimization of the growth conditions for amylase production by bacillus licheniformis 208 isolated from local hotsprings of karachi

    International Nuclear Information System (INIS)

    Studies on the optimum conditions for the production of extracellular amylase were carried out with a newly isolated strain of Bacillus 208 from the hotsprings in Karachi. The optimum temperature, initial medium pH and incubation period for amylase production were 50 degree C, 7.0 and 24 hrs respectively. Furthermore, cells when grown in the complex media showed high amylase production compared to the minimal medium. Effect of different carbon sources revealed that soluble starch (1%) increased the amylase yield significantly. Peptone (as nitrogen source) gave higher yield as compared to other nitrogen sources tested. Under optimized conditions, the organism entered the stationary phase after 12 hrs and amylase production was observed to be maximum at 24th hrs of cultivation. Enzyme production regulation is influenced by catabolite repression. Reduction in enzyme production was observed in the presence of EDTA while addition of tween 20 and CaCl/sub 2/ helped to enhance the enzyme production. (author)

  7. Draft genome sequence of a multidrug-resistant blaOXA-23-producing Acinetobacter baumannii ST208 isolate from China. (United States)

    Chen, Yan; Wu, Liyan; Chen, Yu; Xu, Zhijun; Xu, Liqun


    Acinetobacter baumannii has emerged worldwide as an important opportunistic nosocomial pathogen and has become a major public health concern. In this study, the draft genome sequence of A. baumannii TCM331 (ST208/CC92), a multidrug-resistant (MDR) isolate harbouring the blaOXA-23 gene isolated in China, was determined. The genome of TCM331 was sequenced via Illumina HiSeq™ 2000, and bioinformatics analysis was performed. Important antimicrobial resistance determinants were observed in an estimated genome size of 4,058,691bp with 3838 predicted coding regions. In conclusion, these data might facilitate further understanding of the specific genomic features of MDR A. baumannii in China. PMID:27436391

  8. Measurement of the Thallium 208 and Bismuth 214 radiopurities of a molybdenum foil with the NEMO detector

    International Nuclear Information System (INIS)

    The NEMO 2 detector consists of a tracking volume to reconstruct electron trajectories associated with plastic scintillators. The purpose of the R and D is to aid in studies of neutrinoless double β decay. Using the first nine months of data from the NEMO 2 detector, a method of measurement of the 208Tl and 214Bi radiopurities is presented. These isotopes contribute to the background in the 3 MeV region corresponding to the Q of 2β(0ν) for molybdenum. The channel 1e1γ is used. Monte Carlo simulations with GEANT give the corresponding efficiencies. Radiopurities for a standard Molybdenum foil and for two high purity molybdenum samples have been measured. The results are in good agreement with γ-spectroscopy measurements using an HPGe crystal. 2000 hours of data yields a sensitivity of .3 events/min/kg

  9. Extending and refining the mass surface around $^{208}$Pb by high-precision Penning-trap mass spectrometry with ISOLTRAP

    CERN Multimedia

    Herfurth, F; Stora, T; Blaum, K; Beck, D; Kowalska, M; Schwarz, S; Stanja, J; Herlert, A J; Yamaguchi, T

    We propose high-precision mass spectrometry of nuclides around the doubly magic $^{208}$Pb. On the neutron-rich side, we aim to extend the knowledge of Fr, At, Hg, and Au masses to study the robustness of the N = 126 shell closure and to provide mass data necessary for modeling the rapid-neutron-capture process. On the proton-rich side, we aim at high-resolution mass spectrometry of selected Au, At, and Fr isotopes to verify the predicted existence of very low-lying isomeric states. The proposal will make use of newly-available laser-ionization schemes for Au and At. Finally, the recently implemented multi-reflection time-of-flight mass separator for auxiliary isobaric purification now allows measurements which were not feasible before.

  10. Finite Range Effects on Fusion and/or Breakup of 6He+238U and 11Li+208Pb Systems

    Institute of Scientific and Technical Information of China (English)

    Sukhvinder S. Duhan; Manjeet Singh; Rajesh Kharab; H.C. Sharma


    We have studied the effects of the finite range of the interaction between the fragments of the projectile on the fusion and/or breakup of 6He+238U and 11 Li+208 Pb systems at near barrier energies within the framework of dynamic polarization potential approach.It has been found that at near barrier energies the maximum flux is lost to the breakup channel and at energies well above the Coulomb barrier the fusion coupled with the breakup channel opens up, initially with sharp rise and later becoming saturated at energy nearly twice of the Coulomb barrier.Further, it is found that the breakup cross section increases with the increasing range of the interaction between the fragments of the projectile while the fusion coupled with the breakup channel cross section decreases with the increasing range.

  11. Nuclear tracks in PADC induced by neutron, heavy ion and energetic fragments formed in the reaction {sup 54}Cr + {sup 208}Pb, at 320 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Barbui, M. [INFN Laboratori Nazionali di Legnaro, I-35020 Legnaro (Pd) (Italy); Fabris, D.; Moretto, S.; Nebbia, G. [Dipartimento di Fisica and Sezione INFN Padova, I-35131 Padova (Italy); Nemeth, P. [Departamento de Fisica, Universidad Simon Bolivar, Caracas 1080A (Venezuela, Bolivarian Republic of); Palfalvi, J. [Atomic Energy Research Institute P.O. Box 49, H-1525 Budapest (Hungary); Pesente, S. [Dipartimento di Fisica and Sezione INFN Padova, I-35131 Padova (Italy); Prete, G. [INFN Laboratori Nazionali di Legnaro, I-35020 Legnaro (Pd) (Italy); Sajo-Bohus, L., E-mail: [Departamento de Fisica, Universidad Simon Bolivar, Caracas 1080A (Venezuela, Bolivarian Republic of); Viesti, G. [Dipartimento di Fisica and Sezione INFN Padova, I-35131 Padova (Italy)


    Passive nuclear track detectors in the study of multi fragmentation and compound nucleus fission in the fusion reaction {sup 54}Cr + {sup 208}Pb, leading to composite systems with Z = 106 is given. Results indicate that mostly nuclear tracks are related to fragments with low atomic number and less than 11% to beam like particles in opposition to the expected distribution.

  12. Nuclear tracks in PADC induced by neutron, heavy ion and energetic fragments formed in the reaction 54Cr + 208Pb, at 320 MeV

    International Nuclear Information System (INIS)

    Passive nuclear track detectors in the study of multi fragmentation and compound nucleus fission in the fusion reaction 54Cr + 208Pb, leading to composite systems with Z = 106 is given. Results indicate that mostly nuclear tracks are related to fragments with low atomic number and less than 11% to beam like particles in opposition to the expected distribution.

  13. Isoscalar octupole transition rates in 50Ti, 52Cr and 208Pb from model-independent analyses of 104 MeV α-particle scattering

    International Nuclear Information System (INIS)

    Applying a recently proposed method for model-independent analyses experimental differential cross sections for 104 MeV α-particle scattering have been analyzed. Reliable values of isoscalar (0+-3-1) octupole transition rates in 50Ti, 52Cr and 208 Pb are presented and compared with electromagnetic rates. (orig.)

  14. Proton-induced fission at 190 MeV of W-nat, Au-197, Pb-nat, Pb-208, and Th-232

    NARCIS (Netherlands)

    Duijvestijn, MC; Koning, AJ; Beijers, JPM; Gastal, M; van Klinken, J; Ostendorf, RW


    Proton-induced fission at 190 MeV of W-nat, Au-197, Pb-nat, Pb-208, and Th-232 is studied by means of an innovative method based on activation analysis. The fission-product mass distribution is reconstructed from the fission-product yields, which are obtained from off-line observed gamma-ray spectra

  15. Reduction of the calorimeter data with 208Pb projectiles at 158 GeV/Nucleon in the CERN experiment NA49

    International Nuclear Information System (INIS)

    The first heavy ion run involving a 208Pb beam at ELAB = 158 GeV/Nucleon was performed at the CERN Super Proton Synchrotron (SPS) in November-December 1994. The calibration procedures and the analysis of the calorimeter data are present

  16. Reaction cross sections for protons on {sup 12}C, {sup 40}Ca, {sup 90}Zr and {sup 208}Pb at energies between 80 and 180 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Auce, A.; Ingemarsson, A.; Johansson, R. [and others


    Results of reaction cross section measurements on {sup 12}C, {sup 40}Ca, {sup 90}Zr and {sup 208}Pb at incident proton energies between 80 and 180 MeV and for {sup 58}Ni at 81 MeV are presented. The experimental procedure is described and the results are compared with earlier measurements and predictions using macroscopic and microscopic models.

  17. Design of hydrogen volume fraction detector based on TCS208F*%基于TCS208F的氢气体积分数检测仪的设计

    Institute of Scientific and Technical Information of China (English)

    徐海滨; 孙冬梅; 程明霄


    This system uses micro-flow gas thermal conductive sensor TCS208F for hydrogen volume fraction detection. The signal conditioning circuit and environment temperature control circuit in the external of the sensor are designed in order to achieve constant temperature detection. The weak signal outputed by the sensor is sent off through the measuring bridge. It is primarily amplified by the integrated chip AD708, secondary and amplified by the subtraction circuit. Finally the standard voltage signal is carried into the measurement system of MCU C8051F020 for following-up treatment to complete the hydrogen volume fraction detection. Theoretical study and experimental results show that the detector overcomes many difficult problems of the traditional thermal conductive sensor such as large error detection, environmental temperature compensation and so on, it has broad application prospects.%系统采用微流量气体热导传感器TCS208F进行氢气体积分数检测,设计信号调理电路,并在传感器外部设计环境温度控制电路,以实现传感器的恒温检测.传感器输出的微弱信号经测量电桥调理输出,通过集成芯片AD708进行初级放大,经减法电路进行二次放大,最后把标准电压信号送入单片机C8051F020的测量系统进行后续处理,完成氢气体积分数检测.理论研究和实验表明:该检测仪克服了传统热导传感器检测误差大、环境温度补偿困难等诸多问题,具有广阔的应用前景.

  18. Study of electrostatic discharges under separate and combined radiation of CMG and K-208 glass by electrons and protons (United States)

    Khasanshin, Rashid; Novikov, Lev


    It is known that irradiation of low-conductive dielectric by charged particles which track lengths do not excess the sample dimensions results in formation of areas with high density charge. The field induced by the accumulated charge can initiate the electrostatic discharge between the charge location area and surface of the dielectric. The study of electrostatic discharges in low-conductive dielectrics under radiation is essential both from a scientific point of view and for the solution of applied problems. In particular, interaction of a spacecraft with ambient plasma causes accumulation of electric charges on its surface producing, as a consequence, electric potential between the spacecraft surface and the plasma. Initiation conditions and features of evolution of electrostatic discharges on surface of K-208 glass used as the protective covering of spacecraft solar arrays, under combined irradiation by electrons and protons in vacuum were studied in this work. Energies of electrons and protons were 20-40 keV and 20 keV respectively. The particles beam current was varied within 1.5 ÷ 200 nA. Surfaces of irradiated samples were studied by AFM methods. It was shown that changes of sample morphology due to radiation are determined by radiation annealing of defects in the near-surface layer of the glass, mass transfer processes accompanying by forming various structures on its surface and electrostatic discharges, surface modification having depended on radiation type and intensity. It was ascertained that microprotrusions either presenting on glass surface due to the process of its fabrication or appeared at the early stage of irradiation promotes discharge development. Changes of glass surface morphology due to radiation, as was shown, are stipulated both radiation annealing and electrostatic discharges, surface modification having depended on radiation type and intensity. The observed differences in the development of discharges in the K-208 and CMG glass are

  19. Double-Magic Nature of Sn132 and Pb208 through Lifetime and Cross-Section Measurements (United States)

    Allmond, J. M.; Stuchbery, A. E.; Beene, J. R.; Galindo-Uribarri, A.; Liang, J. F.; Padilla-Rodal, E.; Radford, D. C.; Varner, R. L.; Ayres, A.; Batchelder, J. C.; Bey, A.; Bingham, C. R.; Howard, M. E.; Jones, K. L.; Manning, B.; Mueller, P. E.; Nesaraja, C. D.; Pain, S. D.; Peters, W. A.; Ratkiewicz, A.; Schmitt, K. T.; Shapira, D.; Smith, M. S.; Stone, N. J.; Stracener, D. W.; Yu, C.-H.


    Single-neutron states in Sn133 and Pb209, which are analogous to single-electron states outside of closed atomic shells in alkali metals, were populated by the (Be9, Be8) one-neutron transfer reaction in inverse kinematics using particle-γ coincidence spectroscopy. In addition, the s1/2 single-neutron hole-state candidate in Sn131 was populated by (Be9, Be10). Doubly closed-shell Sn132 (radioactive) and Pb208 (stable) beams were used at sub-Coulomb barrier energies of 3 MeV per nucleon. Level energies, γ-ray transitions, absolute cross sections, spectroscopic factors, asymptotic normalization coefficients, and excited-state lifetimes are reported and compared with shell-model expectations. The results include a new transition and precise level energy for the 3p1/2 candidate in Sn133, new absolute cross sections for the 1h9/2 candidate in Sn133 and 3s1/2 candidate in Sn131, and new lifetimes for excited states in Sn133 and Pb209. This is the first report on excited-state lifetimes of Sn133, which allow for a unique test of the nuclear shell model and Sn132 double-shell closure.

  20. Double-magic nature of 132Sn and 208Pb through lifetime and cross-section measurements. (United States)

    Allmond, J M; Stuchbery, A E; Beene, J R; Galindo-Uribarri, A; Liang, J F; Padilla-Rodal, E; Radford, D C; Varner, R L; Ayres, A; Batchelder, J C; Bey, A; Bingham, C R; Howard, M E; Jones, K L; Manning, B; Mueller, P E; Nesaraja, C D; Pain, S D; Peters, W A; Ratkiewicz, A; Schmitt, K T; Shapira, D; Smith, M S; Stone, N J; Stracener, D W; Yu, C-H


    Single-neutron states in (133)Sn and (209)Pb, which are analogous to single-electron states outside of closed atomic shells in alkali metals, were populated by the ((9)Be, (8)Be) one-neutron transfer reaction in inverse kinematics using particle-γ coincidence spectroscopy. In addition, the s(1/2) single-neutron hole-state candidate in (131)Sn was populated by ((9)Be, (10)Be). Doubly closed-shell (132)Sn (radioactive) and (208)Pb (stable) beams were used at sub-Coulomb barrier energies of 3 MeV per nucleon. Level energies, γ-ray transitions, absolute cross sections, spectroscopic factors, asymptotic normalization coefficients, and excited-state lifetimes are reported and compared with shell-model expectations. The results include a new transition and precise level energy for the 3p(1/2) candidate in (133)Sn, new absolute cross sections for the 1h(9/2) candidate in (133)Sn and 3s(1/2) candidate in (131)Sn, and new lifetimes for excited states in (133)Sn and (209)Pb. This is the first report on excited-state lifetimes of (133)Sn, which allow for a unique test of the nuclear shell model and (132)Sn double-shell closure. PMID:24836240

  1. Measurement of isotopic cross sections of the fission fragments produced in 500 AMeV 208Pb + p reaction

    International Nuclear Information System (INIS)

    The aim of this work is the study of the fission fragments produced in the spallation reaction 208Pb + p at 500 AMeV. The fission fragments from Z=23 up to Z=59 have been detected and identified by using the inverse kinematics technique with the high-resolution spectrometer FRS. The production cross sections and the recoil velocities of 430 nuclei have been measured. The measured data have been compared with previous data. The isotopic distributions show a high precision. However, the absolute value of the fission cross section is higher than expected. From the experimental data the characteristics of the average fissioning system have been reconstructed (Zfis, Afis, E*fis). In addition, the number of post-fission neutrons emitted from the fission fragments, vpost, has been determined by using a new method. The experimental data have been compared to the two-steps models describing the spallation reaction. The impact of the model parameters on the observables has been analysed and the reasons Leading to the observed differences between the codes are also presented. This analyse shows a good agreement with the INCL4+ABLA code. (author)

  2. Diversities in the properties of neutron stars at a fixed neutron-skin thickness in $^{208}$Pb nucleus

    CERN Document Server

    Alam, N; Agrawal, B K


    We study the diversities in the properties of the neutron stars arising due to the different choices for the cross-coupling between various mesons which governs the density dependence of the nuclear symmetry energy in the extended relativistic mean-field(RMF) model. For this purpose, we obtain two different families of the extended RMF model corresponding to different non-linear cross-coupling term in the isovector part of the effective Lagrangian density. The lowest order contributions for the $\\delta$ mesons are also included. The different models within the same family are so obtained that they yield wide variation in the value of neutron-skin thickness in the $^{208}$Pb nucleus. These models are employed to compute the neutron star properties such as, core-crust transition density, radius and red shift at canonical mass ($1.4M_{\\odot}$), tidal polarizability parameter, and threshold mass required for the enhanced cooling through direct Urca process. Most of the neutron star properties considered are signi...

  3. A Study of the Nuclear Resonance Fluorescence Reaction Yield Dependence on the Target Thickness of 208PB (United States)

    Negm, Hani; Daito, Izuru; Zen, Heishun; Kii, Toshiteru; Masuda, Kai; Hori, Toshitada; Ohgaki, Hideaki; Hajima, Ryoichi; Shizuma, Toshiyuki; Hayakawa, Takehito; Kikuzawa, Nobuhiro; Toyokawa, Hiroyuki


    We have been developing an active, non-destructive detection system based on nuclear resonance fluorescence (NRF) for inspecting special nuclear materials (SNMs) such as 235U in a container at a seaport. The study of the NRF yield dependence on the target thickness of SNMs is required to evaluate the performance of the inspection system. To this end, an NRF experiment has been performed using a laser Compton backscattering γ-ray beam line at New SUBARU in 208Pb. Cylindrical shaped natural lead targets with a 0.5 cm radius and varying thicknesses of 1.0, 1.44, and 3.05 cm were irradiated at a resonance energy of 7.332 MeV. The NRF yield was detected using two HPG detectors with relative efficiencies of 120% and 100% positioned at scattering angles of 90° and 130°, respectively, relative to the incident γ-ray beam. As a result, the NRF yield exhibited a saturation behavior for the thick lead target. An analytic treatment and Monte Carlo simulation using GEANT4 was performed to interpret the reaction yield (RY) of the NRF interaction. The simulation result is in good agreement with the experimental data for the target thickness dependence. The analytic treatment, the NRF RY model, is also in reasonable agreement.

  4. Low-lying dipole response: isospin character and collectivity in ${}^{68}$Ni, ${}^{132}$Sn and ${}^{208}$Pb

    CERN Document Server

    Roca-Maza, X; Brenna, M; Mizuyama, K; Colò, G


    The isospin character, the collective or single-particle nature, and the sensitivity to the slope of the nuclear symmetry energy of the low-energy isovector dipole response (known as pygmy dipole resonance) are nowadays under debate. In the present work we study, within the fully self-consistent non-relativistic mean field (MF) approach based on Skyrme Hartree-Fock plus Random Phase Approximation (RPA), the measured even-even nuclei ${}^{68}$Ni, ${}^{132}$Sn and ${}^{208}$Pb. To analyze the model dependence in the predictions of the pygmy dipole strength, we employ three different Skyrme parameter sets. We find that both the isoscalar and the isovector dipole responses of all three nuclei show a low-energy peak that increases in magnitude, and is shifted to larger excitation energies, with increasing values of the slope of the symmetry energy at saturation. We highlight the fact that the collectivity associated with the RPA state(s) contributing to this peak is different in the isoscalar and isovector case, o...

  5. Population data of mitochondrial DNA HVS-I and HVS-II sequences for 208 Henan Han Chinese. (United States)

    Xu, Kaikai; Hu, Shengping


    The two hypervariable segments (HVS-I and HVS-II) of mitochondrial DNA (mtDNA) control region were sequenced for a population of 208 unrelated healthy individuals sampled from Suiping County, Henan Province, China. A total of 192 different haplotypes were identified, of which 179 haplotypes were unique (93.23%). The variation of the mtDNA HVS-I and HVS-II was confined to 166 nucleotide positions, of which 115 were observed in the HVS-I and 51 in the HVS-II. The haplotype diversity and random match probability were 0.9991 and 0.0061, respectively. Following the principle of the updated East Asian mtDNA phylogeny tree, individual samples were assigned to the specific haplogroups based on the information both from control region and coding-region obtained. Haplogroup D was the most common haplogroup (25.96%). The northern China-prevalent haplogroups (A, C, D, G, M8, Y, and Z) and the southern China-prevalent haplogroups (B, F, M7, N9, and R9) accounted for 48.56% and 46.63%, respectively, of the Henan Han mtDNA gene pool. The mtDNA hypervariable region was highly polymorphic in Henan Han population. These sequences could serve as mtDNA reference data for forensic casework in Henan population as well as for population genetic study. PMID:25759193

  6. Analysis of light particles correlation selected by neutron calorimetry in the reaction 208 Pb+93 Nb at 29 MeV/u

    International Nuclear Information System (INIS)

    This work deals with the analysis of light particles correlation selected by neutrons calorimetry in the reaction : 208 Pb+93 Nb at 29 MeV/u. In the first part are described the interest of correlation functions, the proton-proton correlation function study, the classical model developed for describing the correlations of two light particles emitted by a nucleus in thermal equilibrium, the quantum model and some notions about exclusive sources and measures. The second part is a description of the experience : 208 Pb+93 Nb at 29 MeV/u. The analysis of experimental data and of experimental correlation functions are given respectively in the third and the fourth parts. (O.L.). 38 refs., 82 figs., 11 tabs

  7. The determination of maximum safe bombarding energies and B(E3) values in re-orientation experiments with 204Pb, 206Pb, 208Pb

    International Nuclear Information System (INIS)

    Data are presented which display the onset of Coulomb-nuclear interference in the inelastic scattering of 4He, 12C and 16O projectiles from 204Pb and 206Pb. These results were used to determine maximum safe bombarding energies in a recent re-orientation effect determination of the quadrupole moments of the first 2+ states in these nuclei. We also present similar data for the excitation by 16O projectiles of the first 3- states in 204Pb, 206Pb and 208Pb. The results are used to determine B(E3;0+ → 3-) values for the first 3- states of 204Pb and 206Pb; these are found to be remarkably similar to each other and to the corresponding value for the first 3- state in 208Pb

  8. Relevance of single-particle and collective excitations in zirconium isotopes populated by neutron transfer reactions in the {sup 90}Zr+{sup 208}Pb system

    Energy Technology Data Exchange (ETDEWEB)

    Pajtler, M. Varga, E-mail: [Department of Physics, University of Osijek, Trg Ljudevita Gaja 6, 31000 Osijek (Croatia); Szilner, S.; Malenica, D. Jelavić; Mijatović, T.; Soić, N. [Ruer Bošković Institute, HR-10001, Zagreb (Croatia); Corradi, L.; Angelis, G. de; Fioretto, E.; Montanari, D.; Stefanini, A. M.; Valiente-Dobón, J. J. [Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Legnaro, I-35020 Legnaro (Italy); Gadea, A. [IFIC, CSIC-Universidad de Valencia, E-46071 Valencia (Spain); Haas, F. [Institut Pluridisciplinaire Hubert Curien, CNRS-IN2P3 and Université de Strasbourg, F-67037 Strasbourg (France); Lunardi, S.; Mengoni, D.; Montagnoli, G.; Recchia, F.; Scarlassara, F. [Dipartimento di Fisica, Universitá di Padova, and Istituto Nazionale di Fisica Nucleare, I-35131 Padova (Italy); Märginean, N. [Horia Hulubei National Institute of Physics and Nuclear Engineering, RO-077125 Bucharest-Magurele (Romania); Pollarolo, G. [Dipartimento di Fisica Teorica, Universitá di Torino,and Istituto Nazionale di Fisica Nucleare, I-10125 Torino (Italy); and others


    Multineutron transfer reaction {sup 90}Zr+{sup 208}Pb has been studied at the energy close to the Coulomb barrier energy by using the PRISMA + CLARA set-up. In this fragment-γ coincidence measurement, the selective properties of the reaction mechanism in the population of the specific states have been discussed. Based on the observed γ transitions of neutron transfer channels, namely {sup 89–94}Zr isotopes, their level schemes have been constructed and updated.

  9. Study of collisions of the radioactive {sup 24}Ne beam at 7.9 MeV/u on {sup 208}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Benzoni, G. [INFN sezione di Milano, Milano (Italy); Azaiez, F.; Franchoo, S.; Verney, D. [IPN, IN2P3-CNRS, Orsay Cedex (France); Stefan, G.I. [IPN, IN2P3-CNRS, Orsay Cedex (France); GANIL, B. P. 55027, Caen Cedex 5 (France); Battacharyya, S.; France, G. de; Grevy, S.; Ibrahim, F.; Mukherjee, G. [GANIL, B. P. 55027, Caen Cedex 5 (France); Borcea, R. [Horia Hulubei National Institute of Physics and Nuclear Engineering, Bucharest (Romania); Bracco, A.; Leoni, S.; Montanari, D. [INFN sezione di Milano, Milano (Italy); Universita degli Studi di Milano, Milano (Italy); Corradi, L.; Fioretto, E. [INFN-Laboratori Nazionali di Legnaro (Italy); Curien, D. [IN2P3-CNRS et Universite Louis Pasteur, IPHC, Strasbourg Cedex 2 (France); Dombradi, Zs.; Sohler, D. [Institute of Nuclear Research of the Hungarian Academy of Sciences, P.O. Box 51, Debrecen (Hungary); Pollarolo, G. [Universita di Torino (Italy); INFN sezione di Torino, Dipartimento di fisica Teorica, Torino (Italy); Redon, N. [IN2P3-CNRS et Universite Claude Bernard, IPNL, Villeurbanne Cedex (France); Regan, P.H. [University of Surrey, Department of Physics, Guildford (United Kingdom); Schmitt, C. [GANIL, B. P. 55027, Caen Cedex 5 (France); IN2P3-CNRS et Universite Claude Bernard, IPNL, Villeurbanne Cedex (France); Sletten, G. [University of Copenhagen, Niels Bohr Institute, Copenhagen (Denmark); Stanoiu, M. [IPN, IN2P3-CNRS, Orsay Cedex (France); Horia Hulubei National Institute of Physics and Nuclear Engineering, Bucharest (Romania); Szilner, S. [Ruder Boskovic Institute, Zagreb (Croatia)


    Cross-sections of the main reaction channels for the collision {sup 24}Ne+{sup 208}Pb at 7.9MeV/u were studied using the radioactive ion beam delivered by the SPIRAL facility and the VAMOS-EXOGAM experimental set-up. Angular distributions for the elastic and inelastic channels were extracted, together with distributions for the +1n and -1p channels. A comprehensive description of the present data is made within the GRAZING model approach. (orig.)

  10. Excitation of giant resonances in {sup 208}Pb, {sup 120}Sn, {sup 90}Zr and {sup 60}Ni by 84 Mev/nucleon {sup 17}O ions

    Energy Technology Data Exchange (ETDEWEB)

    Alamanos, N.; Liguori-Neto, R.; Roussel-Chomaz, P.; Rochais, L.; Auger, F.; Fernandez, B.; Gillibert, A.; Lacey, R. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (FR). Direction des Sciences de la Matiere; Blumenfeld, Y.; Frascaria, N.; Garon, J.P.; Roynette, J.C.; Scarpacci, J.A.; Suomijarvi, T. [Paris-11 Univ., 91 - Orsay (FR). Inst. de Physique Nucleaire; Barrette, J.; Mark, S.K.; Turcotte, R. [McGill Univ., Montreal, PQ (CA). Foster Radiation Lab.; Van der Woude, A.; Van der Berg, A.M. [Rijksuniversiteit Groningen (NL). Kernfysisch Versneller Inst.


    Elastic and inelastic scattering of 1435 MeV {sup 17}O ions on {sup 208}Pb, {sup 120}Sn, {sup 90}Zr and {sup 60}Ni have been measured. Parameters of the isoscalar giant monopole and quadrupole resonances are obtained. The quadrupole resonance exhausts {approx} 60% of the energy weighted sum rule while the observed monopole resonance corresponds to more than 100% of the sum rule.

  11. Cross Sections of the (HI, αn) Channel in the Cold-Fusion-Type Reactions 209 Bi + 40 Ar and 208 Pb + 37 Cl

    International Nuclear Information System (INIS)

    By using an off-line radiochemistry technique, production cross sections of 240 Cm(T1/2 = 27 d) in the 209 Bi + 40 Ar and 208 Pb + 37 Cl reactions at the bombarding energy Elab ≤ 230 MeV were determined to be 0,5 ± 0,2 and 0,6 ± 0,3 n b, respectively. The production of 240 Cm was attributed to the 1 n-deexcitation channel of the composite systems 249 Md and 245 Es. The measured 240 Cm production cross sections represent upper cross section limits for the (HI, αn) channel of the reactions under study, which limits are about 100 times lower than the section values reported by Nomura et al. for the (40 Ar, αx n) channels with x = 1,2 of the 209 Bi + 40 Ar reaction at Elab208 MeV. In this connection, presented and discussed is an up-to-date summary of the available data on cross sections of the (HI, αx n) channels in the cold-fusion-type reactions induced by projectiles 37 Cl to 50 Ti on targets of 203,205 Tl, 208 Pb and 209 Bi. Appreciable E C(β+)-delayed fission effects were detected in the 209 Bi + 40 Ar and 206,208 Pb + 37 Cl reactions. In particular, our data reveal the occurrence of E C(β+)-delayed fission in the decay chains 242 Es(E C, ∼7 s) 242 Cf and 238 Bk(E C, ∼2 m) 238 Cm. 28 refs., 4 figs., 4 tabs

  12. Complete genome sequence of Acinetobacter baumannii XH386 (ST208, a multi-drug resistant bacteria isolated from pediatric hospital in China

    Directory of Open Access Journals (Sweden)

    Youhong Fang


    Full Text Available Acinetobacter baumannii is an important bacterium that emerged as a significant nosocomial pathogen worldwide. The rise of A. baumannii was due to its multi-drug resistance (MDR, while it was difficult to treat multi-drug resistant A. baumannii with antibiotics, especially in pediatric patients for the therapeutic options with antibiotics were quite limited in pediatric patients. A. baumannii ST208 was identified as predominant sequence type of carbapenem resistant A. baumannii in the United States and China. As we knew, there was no complete genome sequence reproted for A. baumannii ST208, although several whole genome shotgun sequences had been reported. Here, we sequenced the 4087-kilobase (kb chromosome and 112-kb plasmid of A. baumannii XH386 (ST208, which was isolated from a pediatric hospital in China. The genome of A. baumannii XH386 contained 3968 protein-coding genes and 94 RNA-only encoding genes. Genomic analysis and Minimum inhibitory concentration assay showed that A. baumannii XH386 was multi-drug resistant strain, which showed resistance to most of antibiotics, except for tigecycline. The data may be accessed via the GenBank accession number CP010779 and CP010780.

  13. The power of two: Assessing the impact of a second measurement of the weak-charge form factor of 208Pb

    CERN Document Server

    Piekarewicz, J; Giuliani, P; Chicken, E


    [Background] Besides its intrinsic value as a fundamental nuclear-structure observable, the weak-charge density of 208Pb - a quantity that is closely related to its neutron distribution - is of fundamental importance in constraining the equation of state of neutron-rich matter. [Purpose] To assess the impact that a second electroweak measurement of the weak-charge form factor of 208Pb may have on the determination of its overall weak-charge density. [Methods] Using the two putative experimental values of the form factor, together with a simple implementation of Bayes' theorem, we calibrate a theoretically sound - yet surprisingly little known - symmetrized Fermi function, that is characterized by a density and form factor that are both known exactly in closed form. [Results] Using the charge form factor of 208Pb as a proxy for its weak-charge form factor, we demonstrate that using only two experimental points to calibrate the symmetrized Fermi function is sufficient to accurately reproduce the experimental ch...

  14. Neutron-scattering cross section and analyzing-power measurements for 208Pb from 6 to 10 MeV and optical model analyses

    International Nuclear Information System (INIS)

    Differential cross sections and analyzing powers have been obtained for the scattering of neutrons from the ground and first excited states of 208Pb. These new measurements include differential cross sections for elastic and inelastic neutron scattering at 8.0 MeV, and analyzing powers for elastic and inelastic neutron scattering at 6.0, 7.0, 8.0, 9.0, and 10.0 MeV. The present elastic scattering data have been combined with the previously measured TUNL data and data measured elsewhere in order to obtain a detailed and high accuracy data set for neutron elastic scattering from 208Pb over the 4.0 to 40.0 MeV energy range. This comprehensive data set has been described using the spherical optical model in which constant geometry fits, energy-dependent geometry fits, and fits incorporating the dispersion relation were performed. Although the overall description of the elastic n+208Pb scattering data was reasonably good using the various optical potentials, small systematic discrepancies remained at the backward angles of both the cross section and analyzing power data, and no optical model solution based on conventional Woods-Saxon form factors was found which could describe all of the details seen in the scattering data. To relax the constraint of having a Woods-Saxon form factor, the real central part of the optical model potential was modified using a Fourier-Bessel expansion of the real central potential. Individual fits at 6.0, 7.0, 8.0, 9.0, and 10.0 MeV, and fits to the combined 6.0 to 10.0 MeV data set were obtained using a Fourier-Bessel expansion of the real central potential and compared to fits using a conventional Woods-Saxon form factor

  15. Search for supersymmetric particles assuming R-parity non-conservation in $e^+e^-$ collisions at $\\sqrt{s}$ = 192 to 208 GeV

    CERN Document Server

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alderweireld, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barbier, R; Bardin, Dimitri Yuri; Barker, G J; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Bugge, L; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F R; Chapkin, M M; Charpentier, P; Checchia, P; Chierici, R; Shlyapnikov, P; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Dalmau, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L S; Di Ciaccio, L; Di Simone, A; Doroba, K; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J A; Gandelman, M; García, C; Gavillet, P; Gazis, E N; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Hultqvist, K; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Johansson, P D; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E C; Kernel, G; Kersevan, B P; Kerzel, U; Kiiskinen, A P; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, R; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V F; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, Antonio; Rames, J; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Roudeau, P; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Sander, C; Savoy-Navarro, A; Schwickerath, U; Segar, A; Sekulin, R L; Siebel, M; Sissakian, A N; Smadja, G; Smirnova, O G; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I; Vegni, G; Veloso, F; Venus, W A; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O P; Zalewska-Bak, A; Zalewski, P; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zintchenko, A; Zupan, M


    Searches for pair-production of supersymmetric particles under the assumption of non-conservation of R-parity with a dominant LLEbar or UbarDbarDbar term have been performed using the data collected by the DELPHI experiment at LEP in e+e- collisions at centre-of-mass energies from 192 up to 208 GeV. No excess of data above Standard Model expectations was observed. The results were used to constrain the MSSM parameter space and to derive limits on the masses of supersymmetric particles.

  16. Searches for supersymmetric particles in $e^{+} e^{-}$ collisions up to 208 GeV and interpretation of the results within the MSSM

    CERN Document Server

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alderweireld, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Bugge, L; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F R; Chapkin, M M; Charpentier, P; Checchia, P; Chierici, R; Shlyapnikov, P; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crawley, B; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Dalmau, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L S; Di Ciaccio, Lucia; Di Simone, A; Doroba, K; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J A; Gandelman, M; García, C; Gavillet, P; Gazis, E N; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Hultqvist, K; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Johansson, P D; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E C; Kernel, G; Kersevan, Borut P; Kerzel, U; Kiiskinen, A P; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Meyer, W T; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L M; Murray, W; Muryn, B; Myatt, Gerald; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V F; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Pukhaeva, N; Pullia, Antonio; Rames, J; Ramler, L; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Rosenberg, E I; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Savoy-Navarro, A; Schwickerath, U; Segar, A; Sekulin, R L; Siebel, M; Sissakian, A N; Smadja, G; Smirnova, O G; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Veloso, F; Venus, W A; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zinchenko, A I; Zupan, M


    DELPHI data collected at centre-of-mass energies up to 208 GeV have been analysed to search for charginos, neutralinos and sfermions in the framework of the Minimal Supersymmetric Standard Model (MSSM) with R-parity conservation. No evidence for a signal was found in any of the channels. The results of each search were used to derive limits on production cross-sections and particle masses. In addition, the combined result of all searches excludes regions in the parameter space of the constrained MSSM, leading to limits on the mass of the Lightest Supersymmetric Particle and other supersymmetric particles.

  17. Search for a lepton flavor violation signal in e+e- collisions at √s = 192 - 208 GeV at LEP

    International Nuclear Information System (INIS)

    The search for LFV signal in e+e- → l+l- is suggested by theoretical predictions in the frame of supersymmetry models. We looked for charged lepton flavor violation (LFV) at energies between 192 and 208 GeV in e+e- interactions at LEP2. A Standard Model simulation has been analyzed in order to find preselection and selection criteria. Upper limits for cross sections in eμ, eτ, μτ channels have been found and compared with other experimental results and theoretical predictions. (authors)

  18. Completion Report for Wells ER-20-8 and ER-20-8#2 Corrective Action Units 101 and 102: Central and Western Pahute Mesa

    Energy Technology Data Exchange (ETDEWEB)

    NSTec Environmental Management


    Wells ER-20-8 and ER-20-8#2 were drilled for the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office in support of the Nevada Environmental Restoration Project at the Nevada National Security Site (formerly Nevada Test Site), Nye County, Nevada. The holes were drilled in July and August 2009, as part of the Pahute Mesa Phase II drilling program. The primary purpose of these wells was to provide detailed hydrogeologic information in the Tertiary volcanic section that will help address uncertainties within the Pahute Mesa–Oasis Valley hydrostratigraphic framework model. They may also be used as long-term monitoring wells.

  19. Selective properties of neutron transfer reactions in the {sup 90}Zr + {sup 208}Pb system for the population of excited states in zirconium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Varga Pajtler, M., E-mail: [Department of Physics, University of Osijek, HR-31000 Osijek (Croatia); Szilner, S. [Rudjer Bošković Institute, HR-10001 Zagreb (Croatia); Corradi, L.; Angelis, G. de; Fioretto, E. [Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Legnaro, I-35020 Legnaro (Italy); Gadea, A. [IFIC, CSIC-Universidad de Valencia, E-46071 Valencia (Spain); Haas, F. [Institut Pluridisciplinaire Hubert Curien, CNRS-IN2P3 and Université de Strasbourg, F-67037 Strasbourg (France); Lunardi, S. [Dipartimento di Fisica, Universitá di Padova, and Istituto Nazionale di Fisica Nucleare, I-35131 Padova (Italy); Jelavić Malenica, D. [Rudjer Bošković Institute, HR-10001 Zagreb (Croatia); Mărginean, N. [Horia Hulubei National Institute of Physics and Nuclear Engineering, RO-077125 Bucharest-Magurele (Romania); Mengoni, D. [Dipartimento di Fisica, Universitá di Padova, and Istituto Nazionale di Fisica Nucleare, I-35131 Padova (Italy); Mijatović, T. [Rudjer Bošković Institute, HR-10001 Zagreb (Croatia); Montagnoli, G. [Dipartimento di Fisica, Universitá di Padova, and Istituto Nazionale di Fisica Nucleare, I-35131 Padova (Italy); Montanari, D. [Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Legnaro, I-35020 Legnaro (Italy); Pollarolo, G. [Dipartimento di Fisica Teorica, Universitá di Torino, and Istituto Nazionale di Fisica Nucleare, I-10125 Torino (Italy); and others


    Nuclei produced via multineutron transfer channels have been studied in {sup 90}Zr + {sup 208}Pb close to the Coulomb barrier energy in a fragment-γ coincident measurement employing the PRISMA magnetic spectrometer coupled to the CLARA γ-array. The selective properties of the reaction mechanism have been discussed in terms of states and their strength excited in the neutron transfer channels leading to {sup 89–94}Zr isotopes. A strong population of yrast states, with energies up to ∼7.5 MeV has been observed.

  20. Neutron and proton optical potentials for 12C, 16O, 27Al, 56Fe, 90Zr and 208Pb up to 250 MeV

    International Nuclear Information System (INIS)

    In order to perform nuclear data evaluation without unphysical discontinuities, optical models should cover the whole mass and energy range of interest continuously. In this work, the best set of optical model parameters were obtained with energy dependent potential forms which incorporate effects of dispersion relationship for neutron and proton up to 250 MeV on 12C, 16O, 27Al, 56Fe, 90Zr and 208Pb. Applicability of adopting an identical geometrical factor for the real volume, imaginary volume and imaginary surface potentials has been investigated as well in the process of parameter search. (author)

  1. High-resolution inelastic electron scattering on 208Pb at 50 and 63.5 MeV and fragmentation of the magnetic quadrupole strength

    International Nuclear Information System (INIS)

    High-resolution inelastic electron scattering (FWHM approximately equal to 33 keV) with 50 MeV and 63.5 MeV electrons on 208Pb has been used to study magnetic excitations between Esub(x) = 6 MeV and 8 MeV. Angular distributions were analyzed in terms of the DWBA with RPA wave functions. Eight Isup(π) = 2- states carrying a total strength ΣB(M2) = 8500 μ2sub(K) fm2 have been found. The strong fragmentation is in qualitative agreement with theoretical predictions. (orig.)

  2. Excitation of giant resonances in [sup 208]Pb, [sup 120]Sn, [sup 90]Zr and [sup 60]Ni by 84 MeV/nucleon [sup 17]O ions

    Energy Technology Data Exchange (ETDEWEB)

    Liguori Neto, R. (DAPNIA/SPhN, Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France)); Roussel-Chomaz, P. (DAPNIA/SPhN, Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France)); Rochais, L. (DAPNIA/SPhN, Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France)); Alamanos, N. (DAPNIA/SPhN, Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France)); Auger, F. (DAPNIA/SPhN, Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France)); Fernandez, B. (DAPNIA/SPhN, Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France)); Gastebois, J. (DAPNIA/SPhN, Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France)); Gillibert, A. (DAPNIA/SPhN, Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France)); Lacey, R. (DAPNIA/SPhN, Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France)); Miczaika, A. (DAPNIA/SPhN, Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France)); Pierroutsakou, D. (DAPNI


    Elastic and inelastic scattering of 1435 MeV [sup 17]O ions on [sup 208]Pb, [sup 120]Sn, [sup 90]Zr and [sup 60]Ni have been measured. Hindrance in the excitation of the first 3[sup -] states is observed. Parameters of the isoscalar giant monopole and quadrupole resonances are obtained. The quadrupole resonance exhausts [approx]55% of the energy-weighted sum rule while the observed monopole resonance corresponds to more than 100% of the sum rule. Strength is also observed at high excitation energy in all targets. (orig.)

  3. Irradiation creep and swelling of the fusion heats of HT9 and 9Cr-1Mo to 208 DPA at ∼400 degrees C

    International Nuclear Information System (INIS)

    The irradiation creep behavior of the fusion heats of HT9 and 9Cr-1Mo at ∼400 degrees C has been measured to exposures as large as 208 dpa. HT9 is somewhat nonlinear in its response to hoop stress level in the range 0-200 MPa, but 9Cr-1Mo exhibits only slightly greater than linear behavior with stress level. The strain data of both alloys appear to include some contributions from precipitate-related density changes. Swelling may have occurred in 9Cr-1Mo

  4. Dominant winter-time mesospheric wave signatures over a low latitude station, Hawaii (20.8°N): An investigation

    Indian Academy of Sciences (India)

    A Taori; M Taylor


    We utilize mesospheric O2 airglow emission intensity and temperature data collected during January–February 2003 on 17 consecutive nights from Maui, Hawaii (20.8°N, 156.2°W) to study the dominant and long period wave features at mesospheric altitudes. Apart from large day-to-day variability, it is found that nocturnal data for the period under consideration was dominated by a terdiurnal tide-like wave. Together, a quasi 5-day wave is also noticed with significant amplitude.

  5. Selective properties of neutron transfer reactions in the 90Zr + 208Pb system for the population of excited states in zirconium isotopes

    International Nuclear Information System (INIS)

    Nuclei produced via multineutron transfer channels have been studied in 90Zr + 208Pb close to the Coulomb barrier energy in a fragment-γ coincident measurement employing the PRISMA magnetic spectrometer coupled to the CLARA γ-array. The selective properties of the reaction mechanism have been discussed in terms of states and their strength excited in the neutron transfer channels leading to 89–94Zr isotopes. A strong population of yrast states, with energies up to ∼7.5 MeV has been observed

  6. Reaction 48Ca+208Pb: the capture-fission cross-sections and the mass-energy distributions of fragments above and deep below the Coulomb barrier


    Prokhorova, E. V.; Cherepanov, E. A.; Itkis, M.G.; Kondratiev, N. A.; Kozulin, E. M.; Krupa, L.; Oganessian, Yu.Ts.; Pashkevich, V. V.; Pokrovsky, I. V.; Rusanov, A. Ya.


    The capture-fission cross-sections in an energy range of 206-242 MeV of 48Ca-projectiles and mass-energy distributions (MEDs) of reaction products in an energy range of 211-242 MeV have been measured in the 48Ca+208Pb reaction using the double-arm time-of-flight spectrometer CORSET. The MEDs of fragments for heated fission were shown to consist of two components. One component, which is due to classical fusion-fission, is associated with the symmetric fission of the 256No compound nucleus. Th...

  7. Full scale relativistic ab initio time dependent caculations for the the L-K vacancy transfer in 208 MeV Ni23+ on Ge solid target

    International Nuclear Information System (INIS)

    We present full scale ab initio relativistic calculations for the L-K vacancy transfer in collisions of 208 MeV Ni23+ on Ge-solid target. Our time dependent Dirac-Fock-Slater method allows to achieve a very accurate quantitative explanation for the experimental impact parameter-dependent Ni-K and Ge-K vacancy probabilities recently measured at GSI. Darmstadt in terms of dynamic creation and annihilation of Ni n=2 shell vacancies in the collision. Our calculations reveal that both the radial and rotational coupling between the molecular levels contribute to the L-K vacancy transfer. (orig.)

  8. Spectroscopic study of 206,207,208Pb isotopes by high resolution analysis of 24.5 MeV proton scattering

    International Nuclear Information System (INIS)

    206,207,208pb have been studied by 24.5 MeV proton inelastic scattering with a resolution of 20 keV. The angular distributions of the differential cross-sections corresponding to the different excited levels have been measured in a large angular region and analysed with the DWBA.This work shows that it exists between 4 and 5 MeV of excitation energy some strongly excited levels corresponding to transfer momenta l = 2, 4, 6 and 8. The single particle-hole models do not explain these states; so it will probably be necessary to introduce some several particle - hole configurations. (author)

  9. Association between TSH-Receptor Autoimmunity, Hyperthyroidism, Goitre, and Orbitopathy in 208 Patients Included in the Remission Induction and Sustenance in Graves' Disease Study

    DEFF Research Database (Denmark)

    Laurberg, Peter; Nygaard, Birte; Andersen, Stig;


    , goiter, and presence of orbitopathy) at the time of diagnosis of hyperthyroidism. Methods. We describe a cohort of 208 patients with newly diagnosed Graves' hyperthyroidism. Patients were enrolled in a multiphase study of antithyroid drug therapy of Graves' hyperthyroidism, entitled "Remission Induction......, whereas 25-30% had orbitopathy. Conclusions. A positive but rather weak correlation was found between TSH-receptor antibodies in serum and the major clinical manifestation of Graves' disease. Only half of the patients had an enlarged thyroid gland at the time of diagnosis....

  10. Analysis of light particles correlation selected by neutron calorimetry in the reaction {sup 208} Pb+{sup 93} Nb at 29 MeV/u; Analyse de correlation de particules legeres selectionnees par calorimetrie neutronique dans la reaction {sup 208} Pb+{sup 93} Nb a 29 MeV/u

    Energy Technology Data Exchange (ETDEWEB)

    Ghisalberti, C.


    This work deals with the analysis of light particles correlation selected by neutrons calorimetry in the reaction : {sup 208} Pb+{sup 93} Nb at 29 MeV/u. In the first part are described the interest of correlation functions, the proton-proton correlation function study, the classical model developed for describing the correlations of two light particles emitted by a nucleus in thermal equilibrium, the quantum model and some notions about exclusive sources and measures. The second part is a description of the experience : {sup 208} Pb+{sup 93} Nb at 29 MeV/u. The analysis of experimental data and of experimental correlation functions are given respectively in the third and the fourth parts. (O.L.). 38 refs., 82 figs., 11 tabs.

  11. In vitro screening of reversible and time-dependent inhibition on CYP3A by TM208 and TM209 in rat liver microsomes

    Directory of Open Access Journals (Sweden)

    Miaoran Ning


    Full Text Available TM208 and TM209, dithiocarbamate derivatives with potential anti-cancer effects, were evaluated in reversible and time-dependent cytochrome P450 (CYP 3A inhibition assays in rat liver microsomes using testosterone as probe substrate. Both compounds were found to be weak reversible inhibitors and moderate mechanism-based inhibitors of rat CYP3A. For reversible inhibition on rat CYP3A, the Ki values of competitive inhibition model were 12.10±1.75 and 13.94±1.31 μM, respectively. For time-dependent inhibition, the inactivation constants (Kl were 31.93±12.64 and 32.91±15.58 μM, respectively, and the maximum inactivation rates (kinact were 0.03497±0.0069 and 0.07259±0.0172 min−1 respectively. These findings would provide useful in vitro information for future in vivo DDI studies on TM208 or TM209.

  12. 3CR 208.1 - A radio-loud quasar at z = 1.02 gravitationally amplified by a foreground Seyfert galaxy at z = 0.159

    International Nuclear Information System (INIS)

    Deep high spatial resolution imaging and spectroscopy of the high-redshift radio galaxy 3CR 208.1 are presented. The observations show that this galaxy is in fact made of two distinct components separated by 3.9 arcsec and that the two components are at different redshifts. One component is the optical counterpart of the radio source and seems to be a radio-loud QSO with a redshift z = 1.011, while the other is a foreground Seyfert II galaxy with z = 0.159. Gravitational amplification calculations show that the foreground Seyfert gravitationally magnifies the QSO in the optical wavelengths by more than 0.5 mag. Moreover, the radio lobe closest to the Seyfert is amplified by more than a factor of two, which after correction leads to a real radio flux well below the 3CR catalog flux limit. Therefore, 3CR 208.1 has been included in the 3R catalog only because its radio flux has been gravitationally amplified by the foreground Seyfert galaxy. It should be reclassified as a QSO. 24 refs

  13. Two-step processes in the 116Sn(p,p')116Sn and 208Pb(p,t)206Pb reactions

    International Nuclear Information System (INIS)

    In this thesis the role of two-step processes is investigated in (p,p') and (p,t) reactions. An analysis is presented of inelastic proton-scattering on 116Sn. In particular the transitions to the low lying 0+, 2+ and 4+ states have been studied. Next transitions to unnatural-parity states in the 208Pb(p,t)206Pb reaction, measured at Esub(p) = 20 and 50.5 MeV, are studied. It is demonstrated that the data of these transitions, which are strongly forbidden in direct transfer, could satisfactorily be described by sequential-transfer calculations only. These calculations have been performed in a zero-range approximation for the (p,d) and (d,t) projectile formfactors. It is investigated if the finite-range effects in (p,d) (d,t) processes can be approximated by a first order correction. A method is presented to calculate this correction with the zero-range Coupled-Reaction Channel code CHUCK and it is shown that, the finite-range effects, as calculated by Charlton and Hashimoto are nearly exactly reproduced. The natural-parity transitions in the 208Pb(p,t)206Pb reaction are studied at various bombarding energies with direct-transfer calculations alone as well as with combined direct- and sequential-transfer calculations. (Auth.)

  14. Pahute Mesa Well Development and Testing Analyses for Wells ER-20-8 and ER-20-4, Nevada National Security Site, Nye County, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Greg Ruskauff and Sam Marutzky


    Wells ER-20-4 and ER-20-8 were drilled during fiscal year (FY) 2009 and FY 2010 (NNSA/NSO, 2011a and b). The closest underground nuclear test detonations to the area of investigation are TYBO (U-20y), BELMONT (U-20as), MOLBO (U-20ag), BENHAM (U-20c), and HOYA (U-20 be) (Figure 1-1). The TYBO, MOLBO, and BENHAM detonations had working points located below the regional water table. The BELMONT and HOYA detonation working points were located just above the water table, and the cavity for these detonations are calculated to extend below the water table (Pawloski et al., 2002). The broad purpose of Wells ER-20-4 and ER-20-8 is to determine the extent of radionuclide-contaminated groundwater, the geologic formations, groundwater geochemistry as an indicator of age and origin, and the water-bearing properties and hydraulic conditions that influence radionuclide migration. Well development and testing is performed to determine the hydraulic properties at the well and between other wells, and to obtain groundwater samples at the well that are representative of the formation at the well. The area location, wells, underground nuclear detonations, and other features are shown in Figure 1-1. Hydrostratigraphic cross sections A-A’, B-B’, C-C’, and D-D’ are shown in Figures 1-2 through 1-5, respectively.

  15. Developments of 207Pb, 208Pb and 209Bi target wheels in the synthesis of 107Ns, 108Hs and 109Mt

    International Nuclear Information System (INIS)

    The developments of 207Pb, 208Pb and 209Bi target wheels and their applications in heavy-ion fusion reactions are reviewed. In both, fabrication and use, the centers of the evaporator or accelerator beams are focussed at wheel radii of 155 mm to specially shaped frames which generate very homogeneous target layers and very constant reaction and counting rates in the experiment. Target areas of up to ∼98% of a wheel's circumference of 974 mm can be provided. The preparation procedures for necessary C backings and protecting layers of C are described, and details are given for the developments of high-vacuum evaporations of 207Pb, 208Pb and 209Bi with deposition yields of 35-55% from tantalum crucibles. The applications of the target wheels in heavy-ion fusion reactions with beams of 54Cr and 58Fe at energies near the Coulomb barrier and intensities of ∼1012 particles/s are mentioned. The target parameters for the production runs of the new chemical elements 107Ns, 108Hs and 109Mt are included. (orig.)

  16. Verification Survey of Rooms 113, 114, and 208 of the Inhalation Toxicology Laboratory, Lovelace Respiratory Research Institute, Albuquerque, NM

    International Nuclear Information System (INIS)

    DOE-funded research with the DOE's authorized release limits. Contamination identified may be remediated or documented and left in place for incorporation into the NRC license. DOE is responsible for oversight of survey and/or remedial actions that are conducted as a result of DOE-funded missions. It is the policy of DOE to perform independent (third party) verification of the final radiological status of DOE-impacted facilities. The purpose of these independent verification activities is to confirm that remedial actions have been effective in eliminating residual contamination to levels less than the established guidelines or otherwise satisfy the intended property end use for those cases where the property will not be released for unrestricted use. Per the transition plan, the ITL is not intended to be released without radiological restriction. Instead the facility will continue research involving radioactive materials and as such will operate under an NRC license that is to include residual contamination remaining in inaccessible areas, ducts, and drains. The Independent Environmental Assessment and Verification Program (IEAV) of the Oak Ridge Institute for Science and Education (ORISE) was designated as the organization responsible for verifying the radiological status of three ITL laboratories. The laboratories are designated Rooms 113, 114, and 208. The ORISE project statement of work did not include a task for the evaluation of LRRI's survey procedures and plans (Type A verification review). Therefore, this report does not include an independent evaluation of the adequacy of the site's documentation as to the facility's radiological status. The objectives of the verification survey were to confirm that accessible surfaces of the three laboratories meet the DOE's established criteria for residual contamination. Drain pipes and ductwork were not included within the survey scope

  17. A simple and economic method for accurate determination of the energy peak efficiency of 208 keV γ-ray of 237U based on 241Pu/237U secular equilibrium

    International Nuclear Information System (INIS)

    A new method is developed for the determination of energy peak efficiency of 208 keV γ-ray of 237U based on 241Pu/237U secular equilibrium. Plutonium solution was purified to remove Am with Dowex 1 × 2 anion exchange chromatography and the concentration of 241Pu in the purified solution was determined using 242Pu isotope-dilution mass spectrometry on an inductively-coupled plasma mass spectrometry. The solution can be used as calibration source for the determination of energy peak efficiency of 208 keV γ-ray of 237U after 48 days. The method was validated for a planar HPGe detector at the 12 mm above the detector surface. The results showed that this is a simple and economic method for determining the energy peak efficiency of gamma detectors for 208 keV γ-ray of 237U. (author)

  18. Calculation of neutron cross sections for 90Zr, 208Pb and 209Bi in the energy range of 0.5-25 MeV by using the optical model potentials

    International Nuclear Information System (INIS)

    Neutron total cross sections and differential elastic scattering cross sections for the nuclides 90Zr, 208Pb and 209Bi were calculated using different global spherical optical potential (SOP) parameter sets at neutron energies from 0.5-25 MeV. Calculated cross sections for the corresponding nuclides were compared with their experimental data obtained by the EXFOR file to select the best fit parameter sets. It is found that the parameter sets of Ferer Rapaport for 90Zr and Bechetti and Greenless for 208Pb and 209Bi are the best fitted set to obtain the experimental data of total cross sections and angular distributions of these nuclides. (author)

  19. Proton and deuteron inelastic excitation of the 1+ state at E/sub x/ = 5.846 MeV in /sup 208/Pb: Isoscalar character and importance of tensor correlations

    International Nuclear Information System (INIS)

    Differential cross sections for /sup 208/Pb(p,p') and /sup 208/Pb(d,d') excitation of the 1+ state at E/sub x/ = 5.846 MeV were measured at E/sub inc/ = 45 MeV. The fact that the measured strengths of both reactions are very similar supports the isoscalar nature of the 1+ state. The comparison of the experimental proton angular distribution to microscopic distorted-wave calculations using random phase approximation wave functions with and without tensor correlations suggests that the isoscalar tensor part of the (π+rho)-exchange potential is too strong

  20. Neutral pion production in the reactions 16O+27Al, 58Ni, 208Pb at Elab=95 MeV/nucleon

    International Nuclear Information System (INIS)

    The production of neutral pions has been studied in the 16O+27Al, 58Ni, 208Pb reactions at 95 MeV/nucleon. Inclusive pion differential distributions dσ/dpt, dσ/dTπ, and dσ/dΩ have been measured by detecting the two-pion decay γ-rays in a setup of 8 lead glass Cherenkov detector telescopes. The data are discussed in the framework of a moving thermal source model. It is shown that the shape of the pion energy spectra is better described if mean field effects on the primary pion-production cross section and pion reabsorption are included in the calculation. (orig.)

  1. Vector and tensor analyzing powers in the 208Pb(vector d,t)207Pb reaction at 200 and 360 MeV

    International Nuclear Information System (INIS)

    Cross-sections, vector and tensor analyzing powers for the main levels in 207Pb have been measured via the 208Pb (d,t) 207Pb reaction at 200 and 360 MeV incident energies. Ay and Ayy spin observables allow a clear identification of the valence levels, especially at 200 MeV. The results are compared with finite range DWBA calculations using the Paris projectile-ejectile form factor including the S and D components. The analysis shows a large effect of the D component on the tensor analyzing powers at the most forward angles. At both energies, the spin part of the deuteron optical potential is very important to describe the analyzing powers and especially Ayy. The good description of all observables at 200 MeV allows this reaction to be used as a spectroscopic tool

  2. (d,p) reactions on 124Sn, 130Te, 138Ba, 140Ce, 142Nd, and 208Pb below and near the Coulomb barrier

    International Nuclear Information System (INIS)

    The reactions 124Sn(d,p)125Sn, 130Te(d,p)131Te, 138Ba(d,p)139Ba, 140Ce(d,p)141Ce, 142Nd(d,p)143Nd, and 208Pb(d,p)209Pb have been investigated by measuring the differential cross sections of the (d,p) reactions and of the elastic scattering of deuterons at various incident energies below and near the Coulomb barrier. Using scattering potentials which describe the elastic scattering of the particles in the entrance and exit channels, reduced normalizations of 40 final states have been determined which are nearly independent of the uncertainties due to the ambiguities of optical potentials. The experimental errors are 8% on the average. In the energy region studied the expected constancy of derived spectroscopic factors is demonstrated

  3. Neutron-Induced Fission Cross Sections of Nuclei in the Vicinity of 208Pb at Incident Energies below 60 MeV (United States)

    Ryzhov, Igor V.; Tutin, Gennady A.; Eismont, Vilen P.; Mitryukhin, Andrey G.; Oplavin, Valery S.; Soloviev, Sergey M.; Meulders, Jean-Pierre; El Masri, Youssef; Keutgen, Thomas; Prieels, René; Nolte, Ralf


    Neutron-induced fission cross sections of 205Tl, 204, 206, 207, 208Pb, and 209Bi have been measured at incident energies of 32.8, 45.3, and 59.9 MeV. The measurements were performed at the Louvain-la-Neuve neutron beam facility using the 7Li (p, n) reaction as neutron source. Fission fragments were detected with a multi-section Frisch-gridded ionization chamber (MFGIC). Neutron fluence measurements were based on the 238U(n, f) reaction. The neutron fluence monitoring procedure was asserted by crosscheck measurement, in which the 59.9-MeV neutron beam fluence was simultaneously determined with the MFGIC and with a fission chamber monitor calibrated relative to a proton-recoil telescope.

  4. Neutron-Induced Fission Cross Sections of Nuclei in the Vicinity of 208Pb at Incident Energies below 60 MeV

    International Nuclear Information System (INIS)

    Neutron-induced fission cross sections of 205Tl, 204, 206, 207, 208Pb, and 209Bi have been measured at incident energies of 32.8, 45.3, and 59.9 MeV. The measurements were performed at the Louvain-la-Neuve neutron beam facility using the 7Li (p, n) reaction as neutron source. Fission fragments were detected with a multi-section Frisch-gridded ionization chamber (MFGIC). Neutron fluence measurements were based on the 238U(n, f) reaction. The neutron fluence monitoring procedure was asserted by crosscheck measurement, in which the 59.9-MeV neutron beam fluence was simultaneously determined with the MFGIC and with a fission chamber monitor calibrated relative to a proton-recoil telescope

  5. Study of two- and multi-particle correlations in 12C+24Mg and 12C+208Pb reactions at E=35 AMeV

    Directory of Open Access Journals (Sweden)

    Quattrocchi L.


    Full Text Available Two and multi particle correlations from the decay of sources produced in 12C+24Mg and 12C+208Pb collisions at E=35 AMeV have been studied by using the forward part (1° < θlab < 30° of the CHIMERA multi-detector. Correlations and invariant mass spectroscopy are used to explore simultaneous and sequential decays of resonances in light isotopes with Z∼3-6, produced in peripheral collisions via the break-up of excited quasi-projectiles. Among them we mention 5Li, 6Li, 6Be, 8Be and the astrophysically important state in 12C decaying into three alpha particles. Results and future perspectives at the INFN-LNS will be presented.

  6. Mapping the boundaries of the seniority regime and collective motion: Coulomb excitation studies of N = 122 isotones $^{206}$Po and $^{208}$Rn

    CERN Multimedia

    Butler, P; Voulot, D; Rahkila, P J; Darby, I G; Grahn, T; Bree, N C F; Julin, R J; Diriken, J V J; Jenkins, D G; Kroell, T; Huyse, M L

    In regions near magic nuclei, seniority can be regarded as a good quantum number. In the N = 122 isotones above the Z = 82 shell closure relative high-$\\textit{j}\\,$ single-particle proton orbitals dominate the structure and thus levels up to $\\textit{I}$ = 2$\\textit{j}$ - 1 could, in principle, be understood within the seniority scheme. While B(E2) values usually increase within the band with increasing $\\textit{I}$, the seniority scheme can lead to a contrasting result. The present proposal addresses this phenomenon through the measurements of previously unknown B(E2; 0$^{+}\\rightarrow$ 2$^{+}$) values in $^{206}$Po and $^{208}$Rn. The proposed Coulomb excitation measurements of radioactive beams will be carried out at the REX-ISOLDE facility using the MINIBALL $\\gamma$-ray spectrometer.

  7. Etude de la reaction $^{208}$Pb + $^{197}$Au a 29 MeV/u a l'aide de la multiplicite de neutrons associee


    Bresson, S.


    La disponibilité de faisceaux d'ions très lourds au GANIL a rendu possible l'étude de la réaction 208Pb+197au à 29 MeV/u. L'analyse de ce système lourd et symétrique a été réalisée a l'aide de la multiplicité de neutrons associée. Dans la première partie de ce travail, qui en compte quatre, nous décrivons l'ensemble des techniques expérimentales et le traitement des informations, en particulier pour le détecteur de neutrons ORION et pour le détecteur de produits charges utilise ici, un hodosc...

  8. Comparison of reactions for the production of 258,257Db: 208Pb(51V,xn) and 209Bi(50Ti,xn)


    Gates, Jacklyn M.


    Excitation functions for the 1n and 2n exit channels of the 208Pb(51V,xn)259-xDb reaction were measured. A maximum cross section of the 1n exit channel of 2070+1100/-760 pb was measured at an excitation energy of 16.0 +- 1.8 MeV. For the 2n exit channel, a maximum cross section of 1660+450/-370 pb was measured at 22.0 +- 1.8 MeV excitation energy. The 1n excitation function for the 209Bi(50Ti,n)258Db reaction was remeasured, resulting in a cross section of 5480+1750/-1370 pb at an excitati...

  9. Measurement of hadron and lepton-pair production in $e^{+}e^{-}$ collisions at $\\sqrt{s} = 192 - 208 GeV$ at LEP

    CERN Document Server

    Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, S W; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, G J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, M; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, L; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; De Asmundis, R; Deglon, P; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, M; Doria, A; Dova, M T; Duchesneau, D; Duda, M; Echenard, B; Eline, A; El-Hage, A; El-Mamouni, H; Engler, A; Eppling, F J; Extermann, P; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, M; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, F; Fisher, P H; Fisher, W; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Jin, B N; Jindal, P; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V F; Kraber, M; Krämer, R W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levchenko, P M; Li, C; Likhoded, S; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Luci, C; Luminari, L; Lustermann, W; Ma, W G; Malgeri, L; Malinin, A; Maña, C; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nisati, A; Novák, T; Nowak, H; Ofierzynski, R A; Organtini, G; Pal, I; Palomares, C; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, F; Pedace, M; Pensotti, S; Perret-Gallix, D; Piccolo, D; Pierella, F; Pieri, M; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Razis, P; Rembeczki, S; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosemann, C; Rosenbleck, C; Rosier-Lees, S; Roth, S; Rubio, J A; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Schäfer, C; Shchegelskii, V; Schopper, Herwig Franz; Schotanus, D J; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, L; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Vásquez, R; Vesztergombi, G; Vetlitskii, I; Viertel, G; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wang, Q; Wang, X L; Wang, Z M; Weber, M; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zimmermann, B; Zöller, M


    Hadron production and lepton-pair production in e+e- collisions are studied with data collected with the L3 detector at LEP at centre-of-mass energies sqrt{s}=192-208GeV. Using a total integrated luminosity of 453/pb, 36057 hadronic events and 12863 lepton-pair events are selected. The cross sections for hadron production and lepton-pair production are measured for the full sample and for events where no high-energy initial-state-radiation photon is emitted prior to the collisions. Lepton-pair events are further investigated and forward-backward asymmetries are measured. Finally, the differential cross sections for electron-positron pair-production is determined as a function of the scattering angle. An overall good agreement is found with Standard Model predictions.

  10. 非霍奇金淋巴瘤骨髓侵犯208例的血液学分析

    Institute of Scientific and Technical Information of China (English)

    徐光明; 邹学森


    @@ 非霍奇金淋巴瘤(non-Hodgkin lymphoma,NHL)是一种常见的淋巴系统恶性增殖性疾病.当NHL发展至晚期时,除侵犯胃肠道、睾丸、腹腔内淋巴组织等部位外,也常侵犯骨髓,导致淋巴瘤骨髓浸润(bone narrow involvement,BMI)或淋巴瘤细胞白血病(lymphoma cell leukaemia,LMCL).我院自1998年1月~2008年6月共收治NHL患者1649例,其中发生BMI和LMCL共208例,现将其血像、骨髓像结果报告如下.

  11. Energy dependence of the optical potentials for the 9Be +208Pb and 9Be +209Bi systems at near-Coulomb-barrier energies (United States)

    Gómez Camacho, A.; Yu, N.; Zhang, H. Q.; Gomes, P. R. S.; Jia, H. M.; Lubian, J.; Lin, C. J.


    We analyze the energy dependence of the interacting optical potential, at near barrier energies, for two systems involving the weakly bound projectile 9Be and the heavy 208Pb and 209Bi targets, by the simultaneous fit of elastic scattering angular distributions and fusion excitation functions. The approach used consists of dividing the optical potential into two parts. A short-range potential VF+i WF that is responsible for fusion, and a superficial potential VDR+i WDR for direct reactions. It is found, for both systems studied, that the fusion imaginary potential WF presents the usual threshold anomaly (TA) observed in tightly bound systems, whereas the direct reaction imaginary potential WDR shows a breakup threshold anomaly (BTA) behavior. Both potentials satisfy the dispersion relation. The direct reaction polarization potential predominates over the fusion potential and so a net overall behavior is found to follow the BTA phenomenon.

  12. Extended optical model analyses of elastic scattering and fusion cross sections for the 6Li+208Pb system at near-Coulomb-barrier energies using a folding potential

    International Nuclear Information System (INIS)

    Based on the extended optical model approach in which the polarization potential is decomposed into direct reaction (DR) and fusion parts, simultaneous χ2 analyses are performed for elastic scattering and fusion cross section data for the 6Li+208Pb system at near-Coulomb-barrier energies. A folding potential is used as the bare potential. It is found that the real part of the resultant DR part of the polarization potential is repulsive, which is consistent with the results from the continuum discretized coupled channel (CDCC) calculations and the normalization factors needed for the folding potentials. Further, it is found that both DR and fusion parts of the polarization potential satisfy separately the dispersion relation

  13. Extended optical model analyses of elastic scattering, direct reaction, and fusion cross sections for the 9Be+208Pb system at near-Coulomb-barrier energies

    International Nuclear Information System (INIS)

    Based on the extended optical model approach in which the polarization potential is decomposed into direct reaction (DR) and fusion parts, simultaneous χ2 analyses are performed for elastic scattering, DR, and fusion cross section data for the 9Be+208Pb system at near-Coulomb-barrier energies. Similar χ2 analyses are also performed by taking into account only the elastic scattering and fusion data as was previously done by the present authors, and the results are compared with those of the full analysis including the DR cross section data as well. We find that the analyses using only elastic scattering and fusion data can produce very consistent and reliable predictions of cross sections, particularly when the DR cross section data are incomplete. Discussions are also given on the results obtained from similar analyses made earlier for the 9Be+209Bi system

  14. Source identification of Pb in aerosols at Jeju-do, Korea by using 207Pb/206Pb and 208Pb/206Pb

    International Nuclear Information System (INIS)

    Aerosols and source related materials (fly ash from refuse incinerators, vehicle exhaust and soil) were collected in April, 2002 in the northern areas of Jeju-do, Korea, and the Pb isotopic ratios (207Pb/206Pb and 208Pb/206Pb) of the samples were measured in order to estimate the Pb sources of the aerosols. The Pb isotopic ratios of the aerosols were classified into two groups, depending on the sampling date. One group showed similar Pb isotopic ratios with those of the source related materials, suggesting that the contribution of the regional sources to the aerosols was very large. The other showed different Pb isotopic ratios from those of the regional sources and relatively high Pb isotopic ratios compared to the ratios of the first group. The results suggest that in the continental Asia there seems to be a long range transport of Pb with high ratios in desert sands, which are carried by northwest seasonal winds.(author)

  15. Protein profile analysis by SDS-PAGE of Mycoplasma Gallisepticum strains S6(208) and F-K810 grown in Hayflick's and Frey's media Análise do perfil protéico das amostras Mycoplasma gallisepticum S6(208) e F-K810 cultivadas em meio de Hayflick e Frey, por SDS-PAGE


    Priscila N. Ferraz; Claudio C. P. Menezes; Maria das Graças M. Danelli; Jackeline de O. P. Lizeu; Elmiro R. do Nascimento; Daniela M. Lucchesi


    The Mycoplasma gallisepticum strains [wild-type S6 (208) and a vaccine-type F-K810] grown in Frey´s and Hayflick´s media were analyzed by SDS-PAGE. No visual changes in the protein profiles of these strains were observed regardless of the media composition used, although the polyacrylamide gel electrophoretograms showed minor differences do exist when densitometer traces of the gel are compared. Both strains were easily differentiated on SDS-PAGE analysis by a peptide band p75, that is specif...

  16. Transfection of hypertrophic cardiac myocytes in vitro with 99Tcm-labeled antisense miR208b oligonucleotide%99Tcm标记反义miR208b寡核苷酸及其转染离体肥大心肌细胞的实验研究

    Institute of Scientific and Technical Information of China (English)

    王静; 冯会娟; 欧阳伟; 孙云钢; 吴菊清; 陈盼


    Objective To test the efficiency of transfecting 9 Tcm-labeled anti-miR208b oligonucleotide into early hypertrophic cardiac myocytes in vitro. Methods The anti-oligonucleotide targeting miR208b (AMO) was synthesized and modified with LNA followed by conjugation with N-hydroxysuccinimidyl S-acetyl-meraptoacetyl triglycine (NHS-MAG3) and radiolabeling with 9 Tcm. NHS-MAG3-LNA-AMO and labeled AMO were purified with Sep-Pak C18 column chromatography, and the former was examined for UV absorption at the 260 nm using Gene Quant DNA/RNA calculator. The labeling efficiency, radiochemical purity, stability and molecular hybridization activity were analyzed. An angiotensin II-induced cell model of hypertrophic cardiac myocytes was transfected with 9 Tcm-NHS-MAG3-LNA-AMO via liposome, and the relative expression of miRNA208b and retention ratio of the labeled AMO in early hypertrophic cells were determined. Results The labeling efficiency and radiochemical purity of the labeled AMO after purification exceeded 84% and 86%, respectively. The radio-chemical purities of the labeled AMO incubated in serum and normal saline for 12 h were both higher than 80%, and the labeled AMO showed a capacity to hybridize with the target gene. In the hypertrophic model of cardiac myocytes, the retention ratio of labeled AMO at 6 h was higher than 20%. Conclusion The 9 Tcm-labeled antisense probe can be efficiently transfected into hypertrophic cardiac myocytes in vitro, which provides an experimental basis for subsequent radionuclide imaging studies.%目的:探索用放射性核素99Tcm标记反义miR208b寡核苷酸,并转染离体早期肥大心肌细胞的实验过程及方法。方法合成针对miR208b的反义miR寡核苷酸(AMO),LNA(带锁核酸)修饰AMO,将双功能螯合剂NHS-MAG3(N-羟基琥珀酰亚胺-巯基乙酰基三甘氨酸)与LNA-AMO偶联后,用99Tcm标记,然后用Sep-Pak C18反相层析法对NHS-MAG3-LNA-AMO及其标记物进行洗

  17. Excitation function for the production of 262Bh (Z = 107) in theodd-Z projectile reaction 208Pb(55Mn, n)

    Energy Technology Data Exchange (ETDEWEB)

    Folden III, C.M.; Nelson, S.L.; Dullmann, Ch.E.; Schwantes, J.M.; Sudowe, R.; Zielinski, P.M.; Gregorich, K.E.; Nitsche, H.; Hoffman, D.C.


    The excitation function for production of 262Bh in the odd-Z-projectile reaction 208Pb(55Mn,n) has been measured at three projectile energies using the Berkeley Gas-filled Separator at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. In total, 33 decay chains originating from 262Bh and 2 decay chains originating from 261Bh were observed. The measured decay properties are in good agreement with previous reports. The maximum cross section of 540 +180 - 150 pb is observed at a lab-frame center-of-target energy of 264.0 MeV and is more than fives times larger than that expected based on previously reported results for production of 262Bh in the analogous even-Z-projectile reaction 209Bi(54Cr,n). Our results indicate that the optimum beam energy in one-neutron-out heavy-ion fusion reactions can be estimated simply using the ''Optimum Energy Rule'' proposed by Swiatecki, Siwek-Wilczynska, and Wilczynski.

  18. CDCC calculations of elastic scattering for the systems 6Li+144Sm and 6Li+208Pb. Effect of resonances of 6Li on elastic scattering angular distributions

    International Nuclear Information System (INIS)

    Calculations of elastic scattering angular distributions for reactions of the weakly bound projectile 6Li with targets 144Sm and 208Pb at energies above the barrier, are performed with the Continuum Discretized Coupled-Channel method (CDCC). Ground, resonant and nonresonant continuum states of 6Li are included up to some maximum energy εmax for which convergence is achieved. In the three-body system, global interactions are used for the α-target and d - target sub-systems. The effect of continuum resonant states of 6Li, i.e., l = 2, jπ = 3+, 2+ and 1+ on elastic scattering angular distributions is investigated by extracting these states from the continuum space. It is found that the calculated elastic scattering angular distributions are in good agreement with the measurements for most of the cases studied where consideration of couplings to continuum states is essential. It is also found that the resonance character of the continuum states is in some cases important to obtain agreement with the data

  19. The study of neutron-rich nuclei production in the region of the closed shell N=126 in the multi-nucleon transfer reaction 136Xe+208Pb (United States)

    Novikov, K.; Harca, I. M.; Kozulin, E. M.; Dmitriev, S.; Itkis, J.; Knyazheva, G.; Loktev, T.; Corradi, L.; Valiente-Dobon, J.; Fioretto, E.; Montanari, D.; Stefanini, A. M.; Vardaci, E.; Quero, D.; Montagnoli, G.; Scarlassara, F.; Strano, E.; Pollarolo, G.; Piot, J.; Mijatović, T.; Szilner, S.; Ackermann, D.; Chubarian, G.; Trzaska, W. H.


    The unexplored area of heavy neutron rich nuclei is extremely important for nuclear astrophysics investigations and, in particular, for the understanding of the r-process of astrophysical nucleogenesis. For the production of heavy neutron rich nuclei located along the neutron closed shell N=126 (probably the last "waiting point" in the r-process of nucleosynthesis) the low-energy multi-nucleon transfer reaction 136Xe+208Pb at Elab=870MeV was explored. Due to the stabilizing effect of the closed neutron shells in both nuclei, N=82 and N=126, and the rather favorable proton transfer from lead to xenon, the light fragments formed in this process are well bound and the Q-value of the reaction is nearly zero. Measurements were performed with the PRISMA spectrometer in coincidence with an additional time-of-flight (ToF) arm on the +20 beam line of the PIAVE-ALPI accelerator in Legnaro, Italy. The PRISMA spectrometer allows identification of the A, Z and velocity of the projectile-like fragments (PLF), while the second arm gives access to the target-like fragments (TLF). Details on the experimental setup and preliminary results are reported.

  20. Leakage spot evolution in thin (ZrO2)0.8(Al2O3)0.2 -films observed by conductive atomic force microscopy (CAFM)

    International Nuclear Information System (INIS)

    A change from amorphous to nanocrystalline dielectric layers is necessary to achieve dielectric constants >30 as required for future technology nodes. This often leads to significantly higher leakage currents. These were measured in such inhomogeneous samples with a spatial resolution on the nanoscale. CAFM was used to characterize 20 nm-thin (ZrO2)0.8(Al2O3)0.2-films grown by molecular beam deposition. In nanocrystalline samples, there are hillocks at the surface with typical diameters and heights of 30 nm and 3 nm, respectively. An investigation by transmission electron microscopy implies that these hillocks are crystallites that protrude from the surface. CAFM current maps show leakage spots in which the current is significantly higher than in the surrounding matrix. These leakage spots are strongly correlated with the hillocks on the corresponding morphology images, indicating that the formation of crystallites really leads to leakage paths. To distinguish between different transport mechanisms, multiple images of the same area were taken, while the bias-voltage was changed consecutively. By using the entire set of images, IV-curves can be assigned to each location. These show a hysteretic behaviour for all leakage spots. Also, the voltage at which the strong increase in current occurs varies significantly for different leakage spots, i.e. between -1 V and -4 V

  1. Prioritization and burden analysis of rare variants in 208 candidate genes suggest they do not play a major role in CAKUT. (United States)

    Nicolaou, Nayia; Pulit, Sara L; Nijman, Isaac J; Monroe, Glen R; Feitz, Wout F J; Schreuder, Michiel F; van Eerde, Albertien M; de Jong, Tom P V M; Giltay, Jacques C; van der Zwaag, Bert; Havenith, Marlies R; Zwakenberg, Susan; van der Zanden, Loes F M; Poelmans, Geert; Cornelissen, Elisabeth A M; Lilien, Marc R; Franke, Barbara; Roeleveld, Nel; van Rooij, Iris A L M; Cuppen, Edwin; Bongers, Ernie M H F; Giles, Rachel H; Knoers, Nine V A M; Renkema, Kirsten Y


    The leading cause of end-stage renal disease in children is attributed to congenital anomalies of the kidney and urinary tract (CAKUT). Familial clustering and mouse models support the presence of monogenic causes. Genetic testing is insufficient as it mainly focuses on HNF1B and PAX2 mutations that are thought to explain CAKUT in 5–15% of patients. To identify novel, potentially pathogenic variants in additional genes, we designed a panel of genes identified from studies on familial forms of isolated or syndromic CAKUT and genes suggested by in vitro and in vivo CAKUT models. The coding exons of 208 genes were analyzed in 453 patients with CAKUT using next-generation sequencing. Rare truncating, splice-site variants, and non-synonymous variants, predicted to be deleterious and conserved, were prioritized as the most promising variants to have an effect on CAKUT. Previously reported disease-causing mutations were detected, but only five were fully penetrant causal mutations that improved diagnosis. We prioritized 148 candidate variants in 151 patients, found in 82 genes, for follow-up studies. Using a burden test, no significant excess of rare variants in any of the genes in our cohort compared with controls was found. Thus, in a study representing the largest set of genes analyzed in CAKUT patients to date, the contribution of previously implicated genes to CAKUT risk was significantly smaller than expected, and the disease may be more complex than previously assumed. PMID:26489027

  2. The fusion fission and quasi-fission processes in the reaction 48Ca + 208Pb at energies near the Coulomb barrier (United States)

    Prokhorova, E. V.; Bogachev, A. A.; Itkis, M. G.; Itkis, I. M.; Knyazheva, G. N.; Kondratiev, N. A.; Kozulin, E. M.; Krupa, L.; Oganessian, Yu. Ts.; Pokrovsky, I. V.; Pashkevich, V. V.; Rusanov, A. Ya.


    Mass-energy distributions (MEDs) and capture-fission cross sections have been measured in the reaction 48Ca + 208Pb → 256No at the energies E=206-242 MeV using a double-arm time-of-flight spectrometer CORSET. It has been observed that MED of the fragments consists of two parts, namely, the classical fusion-fission process corresponding to the symmetric fission of 256No and quasi-fission "shoulders" corresponding to the light fragment masses ˜60-90 u and complimentary heavy fragment masses. The quasi-fission "shoulders" have a higher total kinetic energy (TKE) as compared with that expected for the classical fission. A mathematical formalism was employed for the MEDs fragment decomposition into fusion-fission and quasi-fission components. In the fusion-fission process a high-energy Super-Short mode has been discovered for the masses M=130-135 u and the TKE of ≈233 MeV.

  3. The fusion-fission and quasi-fission processes in the reaction 48Ca + 208Pb at energies near the Coulomb barrier

    International Nuclear Information System (INIS)

    Mass-energy distributions (MEDs) and capture-fission cross sections have been measured in the reaction 48Ca + 208Pb →256No at the energies Elab=206-242 MeV using a double-arm time-of-flight spectrometer CORSET. It has been observed that MED of the fragments consists of two parts, namely, the classical fusion-fission process corresponding to the symmetric fission of 256No and quasi-fission 'shoulders' corresponding to the light fragment masses ∼60-90 u and complimentary heavy fragment masses. The quasi-fission 'shoulders' have a higher total kinetic energy (TKE) as compared with that expected for the classical fission. A mathematical formalism was employed for the MEDs fragment decomposition into fusion-fission and quasi-fission components. In the fusion-fission process a high-energy Super-Short mode has been discovered for the masses MH=130-135 u and the TKE of ∼233 MeV

  4. Recovery of radiogenic lead-208 from a residue of thorium and rare earths obtained during the operation of a thorium purification pilot plant

    International Nuclear Information System (INIS)

    Brazil has a long tradition in thorium technology, from mineral dressing (monazite) to the nuclear grade thorium compounds. The estimate reserves are 1200,000. ton of ThO2. As a consequence from the work of thorium purification pilot plant at Instituto de Pesquisas Energeticas e Nucleares-CNEN/IPEN-SP, about 25 ton of a sludge containing thorium and rare earths was accumulated. It comes as a raffinate and washing solutions from thorium solvent extraction. This sludge, a crude hydroxide named RETOTER contains thorium, rare earths and minor impurities including the radiogenic lead-208, with abundance 88.34 %. This work discusses the results of the studies and main parameters for its recovery by anionic ion exchange technique in the hydrochloric system. The isotope abundance of this lead was analyzed by high resolution mass spectrometer (ICPMS) and thermoionic mass spectrometer (TIMS) and the data was used to calculate the thermal neutron capture cross section. The value of σγ0 = 14.6±0.7 mb was found, quite different from the σγ0 = 174.2 ± 7.0 mb measure cross section for the natural lead. Preliminary study for the thorium and rare earths separation and recovery was discussed as well. (author)

  5. Recovery of radiogenic lead-208 from a residue of thorium and rare earths obtained during the operation of a thorium nitrate purification pilot plant

    International Nuclear Information System (INIS)

    Brazil has a long tradition in thorium technology, from mineral dressing (monazite) to the nuclear grade thorium compounds. The estimate reserves are 1200,000. ton of ThO2. As a consequence from the work of thorium purification pilot plant at Instituto de Pesquisas Energeticas e Nucleares-CNEN/SP, about 25 ton of a sludge containing thorium and rare earths was accumulated. It comes as a raffinate and washing solutions from thorium solvent extraction. This sludge, a crude hydroxide named RETOTER contains thorium, rare earths and minor impurities including the radiogenic lead-208, with abundance 88.34 %. This work discusses the results of the studies and main parameters for its recovery by anionic ion exchange technique in the hydrochloric system. The isotope abundance of this lead was analyzed by high resolution mass spectrometer (ICPMS) and thermoionic mass spectrometer (TIMS) and the data was used to calculate the thermal neutron capture cross section. The value of s?o = 14.6 +/- 0.7 mb was found, quite different from the s?o = 174.2 +/- 7.0 mb measure cross section for the natural lead. Preliminary study for the thorium and rare earths separation and recovery was discussed as well. (author)

  6. Excitation functions of residual nuclei production from 40–2600 MeV proton-irradiated 206,207,208,natPb and 209Bi

    Indian Academy of Sciences (India)

    Yu E Titarenko; V F Batyaev; V M Zhivun; V O Kudryashov; K A Lipatov; A V Ignatyuk; S G Mashnik


    The work is aimed at experimental determination of the independent and cumulative yields of radioactive residual nuclei produced in intermediate-energy proton-irradiated thin targets made of highly isotopic enriched and natural lead (206,207,208,natPb) and 209Bi. 5972 radioactive product nuclide yields have been measured in 55 thin targets induced by 0.04, 0.07, 0.10, 0.15, 0.25, 0.6, 0.8, 1.2, 1.4, 1.6 and 2.6 GeV protons extracted from the ITEP U-10 proton synchrotron. The measured data have been compared with data obtained at other laboratories as well as with theoretical simulations by seven codes. We found that the predictive power of the tested codes is different but is satisfactory for most of the nuclides in the spallation region, though none of the codes agree well with the data in the whole mass region of product nuclides and all should be improved further.

  7. Excitation function for the production of 262Bh (Z=107) in the odd-Z-projectile reaction 208Pb(55Mn, n)

    International Nuclear Information System (INIS)

    The excitation function for production of 262Bh in the odd-Z-projectile reaction 208Pb(55Mn, n) has been measured at three projectile energies using the Berkeley Gas-filled Separator at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. In total, 33 decay chains originating from 262Bh and 2 decay chains originating from 261Bh were observed. The measured decay properties are in good agreement with previous reports. The maximum cross section of 540-150+180 pb is observed at a lab-frame center-of-target energy of 264.0 MeV and is more than five times larger than that expected based on previously reported results for production of 262Bh in the analogous even-Z-projectile reaction 209Bi(54Cr, n). Our results indicate that the optimum beam energy in one-neutron-out heavy-ion fusion reactions can be estimated simply using the optimum energy rule proposed by SwiaPtecki, Siwek-Wilczynska, and Wilczynski

  8. Multi-step processes in the (d, t) and (d, 3He) reactions on 116Sn and 208Pb targets at Ed = 200 MeV

    International Nuclear Information System (INIS)

    The role of multi-step processes in the reactions 116Sn(d,t), 208Pb(d,t) and 116Sn(d,3He), previously studied at Ed = 200 MeV at forward angles and for relatively low energy transfers, has been investigated. We have performed for the first time multi-step calculations taking into account systematically collective excitations in the second and higher order step inelastic transitions. A calculation code based on the Feshbach, Kerman and Koonin model has been modified to handle explicitly these collective excitations, most important in the forward angle domain. One step double differential pick-up cross sections were built from finite range distorted wave results spread in energy using known or estimated hole state characteristics. It is shown that two-step cross sections calculated using the above method compare rather well with those deduced via coupled channel calculations for the same collective excitations. The multi-step calculations performed up to 6 steps reproduce reasonably well the 115Sn, 207Pb and 115In experimental spectra measured up to Ex∼- 40 MeV and 15 deg. The relative contributions of steps of increasing order to pick-up cross sections at Ed = 200 MeV and 150 MeV are discussed. (authors)

  9. Characterization of the ground X1 state of 204Pb19F, 206Pb19F, 207Pb19F, and 208Pb19F

    International Nuclear Information System (INIS)

    Pure rotational spectra of the ground electronic-vibrational X1 state of 204Pb19F, 206Pb19F, 207Pb19F, and 208Pb19F are measured with a resonator pulsed supersonic jet Fourier-transform microwave spectrometer. Also reported is a new measurement of the Stark effect on the optical spectra of A(leftarrow)X1 transitions. These spectra are combined with published high-resolution infrared spectra of X2↔X1 transitions in order to create a complete picture of the ground state of lead monofluoride. For the microwave data, molecules are prepared by laser ablation of lead target rods and stabilized in a supersonic jet of neon mixed with sulfur hexafluoride. For the optical Stark spectra, a continuous source of molecules is created in a nozzle heated to 1000 deg. C. The microwave spectra confirm, improve, and extend previously reported constants that describe the rotational, spin-orbit, and hyperfine interactions of the ground electronic state of the PbF molecule. A discrepancy concerning the sign of the hyperfine constant describing the 207Pb nucleus is discussed. Magnetic-field-dependent microwave spectra are used to characterize the Zeeman interaction in terms of two g factors of the body-fixed electronic wave function. The optical Stark spectra are used to characterize the electric dipole moment of the X1 and A states.

  10. Pahute Mesa Well Development and Testing Analyses for Wells ER-20-7, ER-20-8 #2, and ER-EC-11, Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Greg Ruskauff


    This report analyzes the following data collected from ER-20-7, ER-20-8 No.2, and ER-EC-11 during WDT operations: (1) Chemical indicators of well development (Section 2.0); (2) Static hydraulic head (Section 3.0); (3) Radiochemistry and geochemistry (Section 4.0); (4) Drawdown observed at locations distal to the pumping well (Section 5.0); and (5) Drilling water production, flow logs, and temperature logs (Section 6.0). The new data are further considered with respect to existing data as to how they enhance or change interpretations of groundwater flow and transport, and an interim small-scale conceptual model is also developed and compared to Phase I concepts. The purpose of well development is to remove drilling fluids and drilling-associated fines from the formation adjacent to a well so samples reflecting ambient groundwater water quality can be collected, and to restore hydraulic properties near the well bore. Drilling fluids can contaminate environmental samples from the well, resulting in nonrepresentative measurements. Both drilling fluids and preexisting fines in the formation adjacent to the well can impede the flow of water from the formation to the well, creating artifacts in hydraulic response data measured in the well.

  11. Allanite from the El Muerto Pegmatite, Oaxaca, Mexico: A Potential New Standard for 232Th-208Pb Dating by LA-ICP-MS (United States)

    Price, J.; Crowley, J. L.; Solari, L.; Prol-Ledesma, R.


    Allanite dating may be important to studies addressing tectonomagmatic evolution, provenance of monocyclic sediment, and mineral weathering. Obtaining accurate allanite ages by SIMS has been challenging and time-consuming due to the mineral's extreme chemical variability which often prevents finding adequately matrix-matched standards. Isotopic measurements by LA-ICP-MS minimize the need for standards of nearly identical composition to the unknown allanite being analyzed, and it is done relatively rapidly. Dating by LA-ICP-MS requires high quality standards for isotopic fractionation corrections. However, readily accessible and well characterized allanite standards are scarce. We investigated gemstone allanite from the El Muerto pegmatite, Oaxaca, Mexico, as a potential new geochronology standard for 232Th-208Pb allanite dating by LA-ICP-MS. Compositional homogeneity was thoroughly investigated by scanning and backscatter electron microscopy, cathodoluminescence, quantitative and qualitative energy dispersive x-ray spectroscopy, electron microprobe, and LA-ICP-MS. The possibility of metamictization was investigated by extensive X-ray diffraction analyses. The El Muerto allanite was U-Pb dated by ID-TIMS, with common Pb ratios determined from cogenetic K-feldspar by ID-TIMS and LA-MC-ICP-MS. Future work includes Th-Pb dating by ID-TIMS. The samples investigated are homogeneous with respect to major and trace elements. Major element compositional results are generally in agreement with published values, and no metamictization was identified despite the allanite being nearly 1 Ga. The only limitation of the El Muerto allanite is that it contains small, generally <100 μm, scarce inclusions of quartz, calciothorite, albite, calcite, and biotite. However, these grains are easily recognized and avoided during LA-ICP-MS analyses. Based on these results, the El Muerto allanite has the potential to serve as a standard for LA-ICP-MS dating.

  12. Study of the giant multipole resonances especially of the isoscalar giant E2 resonance in 208Pb by medium and high energy resolution inelastic electron scattering

    International Nuclear Information System (INIS)

    In the nucleus 208Pb giant multipole resonances up to excitation energies of Esub(x) = 35 MeV were looked for by medium resolution inelastic electron scattering. Twelve spectra were taken up at incident energies of E0 = 45-65 MeV under scattering angles from upsilon = 930 to 1650. The cross sections extracted from this were analyzed by means of DWBA calculations using RPA amplitudes from a model with separable residual interaction. On the base of this analysis for the first time it could be shown that the maximum in the electron scattering cross section at Esub(x) approx.= 14 MeV can be consistently described as superposition of the Jsup(π) = 1-, ΔT = 1 with a Jsup(π) = 0+, ΔT = 0 giant resonance. Furthermore the spectra under backward scattering angles indicate the existence of a magnetic excitation at Esub(x) approx.= 15 MeV which is interpreted as Jsup(π) = 3+ giant resonance. Besides under forward angles a further weak excitation at Esub(x) approx.= 14.6 MeV appears which is very well compatible with Jsup(π) = 2+. At Esub(x) = 17.5 MeV a Jsup(π) = 3- resonance was found which recently is observed also in (α, α') experiments and therefore gets a ΔT = 0 assignment. A further resonance at Esub(x) approx.= 21 MeV has also a Jsup(π) = 3- character but has to be partly assigned to a Jsup(π) = 1-, ΔT = 0 excitation. At Esub(x) = 23.8 MeV a Jsup(π) = 2+ excitation was found which gets because of model predictions a ΔT = 1 assignment. (orig./HSI)

  13. What characterises women who eat potatoes? A cross-sectional study among 74,208 women in the Norwegian Women and Cancer cohort

    Directory of Open Access Journals (Sweden)

    Lene A. Åsli


    Full Text Available Background: Studies of potato consumption have shown that age, region, socioeconomic status, and household structure are important determinants. Objective: This study aims to map which factors influence potato consumption among women in the Norwegian Women and Cancer (NOWAC study. Design: A cross-sectional study using a postal questionnaire among 74,208 NOWAC participants aged 41–70. Results: Results showed that 56% of the women ate at least two potatoes a day. A north–south gradient in potato consumption was observed in logistic regression models (OR: 3.41, 95% CI: 3.19–3.64 for the north compared to the capital. Women in households with children had lower odds of high potato consumption than women living only with a partner, and women who lived alone had the lowest odds of all (OR: 0.39, 95% CI: 0.37–0.41. Smokers had higher odds of high potato consumption, while diabetics had lower odds. The odds of high potato consumption were greater among older women, and among those with lower income and education. In a sub-cohort, women who were dieting had lower odds of high potato consumption. Consumption of different foods varied in the low versus the high potato consumption group, with largest effect for fish and pasta/rice. The groups had similar nutrient densities. Conclusions: In addition to lifestyle and socioeconomic factors, health-related factors like smoking and diabetes were found to influence potato consumption. The high potato consumption group had an especially high consumption of fish and a low consumption of pasta/rice, though the nutrient density in the groups was similar.

  14. 间接数字化成像技术分析208颗山东地区汉族人恒前牙根管的弯曲情况%Root canal curvature of 208 anterior teeth from Han Chinese people in Shandong Province An indirect digital X-ray radiography analysis

    Institute of Scientific and Technical Information of China (English)

    王玲香; 邓婧; 王大山


    BACKGROUND: It can to a certain extent prevent complications during root canal preparation and improve the success rate of root canal therapy by understanding root canal anatomical configuration and bending degree.OBJECTIVE: To investigate the root canal curvature of permanent anterior teeth from Han Chinese people in Shandong province.METHODS: A total of 208 anterior teeth were collected and examined by indirect digital X-ray radiography both from labiolingual and mesiodistal directions,according to Schneider method,the data obtained were analyzed.RESULTS AND CONCLUSION: Most root canals of anterior teeth from Shandong province were typeⅠ,and more than half were curved. The most curvature happened in the apical third. The highest rate of canal curvature occurred in maxillary canines. Except the central incisors,the S-shaped canal was observed on the rest teeth. The radius of mandibular anteriors was obvious longer in labiolingual directions than that in mesiodistal directions. Root canal curvatures of anterior teeth from Shandong province are complex and have a higher bending rate.%背景:熟悉根管解剖形态,了解其弯曲程度,可以在一定程度上预防根管预备时的并发症,提高根管治疗的成功率.目的:了解山东地区汉族人恒前牙根管弯曲的情况.方法:采用间接数字化X射线成像技术,对收集的离体208颗前牙进行颊舌向和近远中向拍摄,采用改良的Schneider测量方法,分析根管弯曲情况.结果与结论:山东地区汉族人前牙根管多为Ⅰ型根管,且半数以上存在弯曲,弯曲部位多集中在根尖1/3,尤以上颌尖牙根管弯曲发生率最高,除上颌中切牙外,其余牙位均有S形弯曲根管,下颌前牙在唇舌方向上弯曲半径明显高于近远中方向.提示山东地区汉族人恒前牙根管形态复杂,弯曲率较高.

  15. Effect of small body habitus on peri-operative outcomes after robotic-assisted pulmonary lobectomy: retrospective analysis of 208 consecutive cases (United States)

    Velez-Cubian, Frank O.; Zhang, Wei-Wei; Rodriguez, Kathryn L.; Thau, Matthew R.; Ng, Emily P.; Moodie, Carla C.; Garrett, Joseph R.; Fontaine, Jacques-Pierre


    Background Patients with smaller body surface area (BSA) have smaller pleural cavities, which limit visualization and instrument mobility during video-assisted thoracoscopic surgery (VATS). We investigated the effects of BSA on outcomes with robotic-assisted VATS lobectomy. Methods We analyzed 208 consecutive patients who underwent robotic-assisted lobectomy over 34 months. Patients were separated into group A (BSA ≤1.65 m2) and group B (BSA >1.65 m2). Operative times, estimated blood loss (EBL), conversions to thoracotomy, complications, hospital length of stay (LOS), and in-hospital mortality were compared. Results Group A had 40 patients (BSA 1.25–1.65 m2), and group B had 168 patients (BSA 1.66–2.86 m2). Median skin-to-skin operative times [± standard error of the mean (SEM)] were 169±16 min for group A and 176±6 min for group B (P=0.34). Group A had median EBL of 150±96 mL compared to 200±24 mL for group B (P=0.37). Overall conversion rate to thoracotomy was 8/40 (20.0%) in group A versus 12/168 (7.1%) in group B (P=0.03); while emergent conversion for bleeding was 2/40 (5.0%) in group A versus 5/168 (3.0%) in group B (P=0.62). Postoperative complications occurred in 12/40 (30.0%) in group A, compared to 66/168 (39.3%) in group B (P=0.28). Patients from both groups had median hospital LOS of 5 days (P=0.68) and had similar in-hospital mortality. Conclusions Patients with BSA ≤1.65 m2 have similar perioperative outcomes and complication risks as patients with larger BSA. Patients with BSA ≤1.65 m2 have a higher overall conversion rate to thoracotomy, but similar conversion rate for bleeding as patients with larger BSA. Robotic-assisted pulmonary lobectomy is feasible and safe in patients with small body habitus.

  16. Study of tracking detector of NEMO experiment - Simulation of the measurement of the ultra low 208Tl radioactivity in the source foils used as neutrinoless double beta decay emitters in NEMO experiment

    International Nuclear Information System (INIS)

    The purpose of NEMO3 experiment is the research of the neutrinoless double beta decay. This low energy process can sign the massive and Majorana nature of neutrino. This experiment with a very low radioactive background and containing 10 kg of enriched isotopes, studies mainly 100Mo. Installed at the Frejus underground laboratory, NEMO3 is a cylindrical detector which consists in very thin central source foils in a tracking detector made up of vertical drift cells operating in Geiger mode in a calorimeter and in a suitable shielding. This thesis is divided in two different parts. The first part is a full study of the features of the tracking detector. With a prototype composed of 9 drift cells we characterised the longitudinal and transverse reconstruction of position of the ionisation created by a LASER. With the first 3 modules under operation we used radioactive external neutron sources to measure the transverse resolution of ionisation position in a drift cell for high energy electrons. To study the vertex reconstruction on the source foil, sources of 207Bi which produced conversion electrons, were used inside the 3 modules. The second part of this thesis we show with simulations that we can measure with NEMO3 detector itself, the ultra low level of contamination in 208Tl of the source foil which comes from the natural radioactive chain of thorium. Using electron-photons channels we can obtain the 208Tl activity in the sources. With an analysis on the energy and on the time of flight of particles, NEMO3 is able to reach a sensitivity of 20μBq/kg after only 2 months of measurement. This sensitivity is the maximum 208Tl activity which we accepted for the sources in the NEMO3 proposal. (author)

  17. Measurement of isotopic cross sections of the fission fragments produced in 500 AMeV {sup 208}Pb + p reaction; Etude de la production des fragments de fission issus de la reaction {sup 208}Pb + p a 500 AMeV

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez-Dominguez, B


    The aim of this work is the study of the fission fragments produced in the spallation reaction {sup 208}Pb + p at 500 AMeV. The fission fragments from Z=23 up to Z=59 have been detected and identified by using the inverse kinematics technique with the high-resolution spectrometer FRS. The production cross sections and the recoil velocities of 430 nuclei have been measured. The measured data have been compared with previous data. The isotopic distributions show a high precision. However, the absolute value of the fission cross section is higher than expected. From the experimental data the characteristics of the average fissioning system have been reconstructed (Z{sub fis}, A{sub fis}, E*{sub fis}). In addition, the number of post-fission neutrons emitted from the fission fragments, v{sub post}, has been determined by using a new method. The experimental data have been compared to the two-steps models describing the spallation reaction. The impact of the model parameters on the observables has been analysed and the reasons Leading to the observed differences between the codes are also presented. This analyse shows a good agreement with the INCL4+ABLA code. (author)

  18. Recovery of radiogenic lead-208 from a residue of thorium and rare earths obtained during the operation of a thorium purification pilot plant; Separacao e recuperacao de chumbo-208 dos residuos de torio terras raras gerados na unidade piloto de purificacao de nitrato de torio

    Energy Technology Data Exchange (ETDEWEB)

    Seneda, Jose Antonio


    Brazil has a long tradition in thorium technology, from mineral dressing (monazite) to the nuclear grade thorium compounds. The estimate reserves are 1200,000. ton of ThO{sub 2}. As a consequence from the work of thorium purification pilot plant at Instituto de Pesquisas Energeticas e Nucleares-CNEN/IPEN-SP, about 25 ton of a sludge containing thorium and rare earths was accumulated. It comes as a raffinate and washing solutions from thorium solvent extraction. This sludge, a crude hydroxide named RETOTER contains thorium, rare earths and minor impurities including the radiogenic lead-208, with abundance 88.34 %. This work discusses the results of the studies and main parameters for its recovery by anionic ion exchange technique in the hydrochloric system. The isotope abundance of this lead was analyzed by high resolution mass spectrometer (ICPMS) and thermoionic mass spectrometer (TIMS) and the data was used to calculate the thermal neutron capture cross section. The value of {sigma}{gamma}{sup 0} = 14.6{+-}0.7 mb was found, quite different from the {sigma}{gamma}{sup 0} = 174.2 {+-} 7.0 mb measure cross section for the natural lead. Preliminary study for the thorium and rare earths separation and recovery was discussed as well. (author)

  19. Measurements of Neutron-Induced Fission Cross Sections of 205Tl, 204, 206, 207, 208Pb, and 209Bi using Quasi-Monoenergetic Neutrons in the Energy Range 35 - 174 MeV (United States)

    Tutin, Gennady A.; Ryzhov, Igor V.; Eismont, Vilen P.; Mitryukhin, Andrey G.; Oplavin, Valery S.; Soloviev, Sergey M.; Blomgren, Jan; Condè, Henri; Olsson, Nils; Renberg, Per-Ulf


    Cross sections for neutron-induced fission of 205Tl, 204, 206, 207, 208Pb, and 209Bi were measured in the energy range from 35 MeV to 174 MeV. The experiments were done at the neutron beam facility of The Svedberg Laboratory, using a multi-section Frisch-gridded ionization chamber for detection of the fission fragments. The neutron-induced fission cross section of 238U was employed as a reference. The results of the measurements are compared with existing experimental data.

  20. Measurements of neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi with a multi-section Frisch-gridded ionization chamber (United States)

    Ryzhov, I. V.; Tutin, G. A.; Mitryukhin, A. G.; Oplavin, V. S.; Soloviev, S. M.; Blomgren, J.; Renberg, P.-U.; Meulders, J. P.; El Masri, Y.; Keutgen, Th.; Prieels, R.; Nolte, R.


    Neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi have been measured in the energy range from 30 to 180 MeV. The measurements were performed with quasi-monoenergetic neutron beams using a multi-section Frisch-gridded ionization chamber. The neutron-induced fission cross-sections of 238U were used as reference data. The experimental techniques are described in detail as well as the data processing. The results are compared with existing experimental data.

  1. Measurements of neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi with a multi-section Frisch-gridded ionization chamber

    International Nuclear Information System (INIS)

    Neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi have been measured in the energy range from 30 to 180 MeV. The measurements were performed with quasi-monoenergetic neutron beams using a multi-section Frisch-gridded ionization chamber. The neutron-induced fission cross-sections of 238U were used as reference data. The experimental techniques are described in detail as well as the data processing. The results are compared with existing experimental data

  2. Method for determination of the average parameters of the dispersion optical potential for p+A in the range of 40 ≤ A ≤ 208 and -60 ≤ E ≤ 65 MeV

    International Nuclear Information System (INIS)

    The method for determination of the average parameters of the proton dispersion optical potential, applicable in the area of the nuclei mass numbers 40 ≤ A ≤ 208 and within the energy range of -60 ≤ E ≤+65 MeV is proposed. Application of the average parameters makes it possible to reliable forecast the differential cross sections of elastic scattering and polarization, complete cross sections of reactions, characteristics of the single-particle proton stets in the A-1 and A+1 nuclei

  3. Reflection asymmetry in odd-A and odd-odd actinium nuclei

    International Nuclear Information System (INIS)

    Theoretical calculations and measurements indicate that octupole correlations are at a maximum in the ground states of the odd-proton nuclei Ac and Pa. It has been expected that odd-odd nuclei should have even larger amount of octupole-octupole correlations. We have recently made measurements on the structure of 224Ac. Although spin and parity assignments could not be made, two bands starting at 354.1 and 360.0 keV have properties characteristic of reflection asymmetric shape. These two bands have very similar rotational constants and also similar alpha decay rates, which suggest similarity between the wavefunctions of these bands. These signatures provide evidence for octupole correlations in these nuclides

  4. Bestimmung der Ionisationsenergie von Actinium und Ultraspurenanalyse von Plutonium mit resonanter Ionisationsmassenspektrometrie (RIMS)


    Waldek, Achim Marcus


    ZusammenfassungDie Resonanzionisationsmassenspektrometrie (RIMS) verbindet hohe Elementselektivität mit guter Nachweiseffizienz. Aufgrund dieser Eigenschaften ist die Methode für Ultraspurenanalyse und Untersuchungen an seltenen oder schwer handhabbaren Elementen gut geeignet. Für RIMS werden neutrale Atome mit monochromatischem Laserlicht ein- oder mehrfach resonant auf energetisch hoch liegende Niveaus angeregt und anschließend durch einen weiteren Laserstrahl oder durch ein elektrisches Fe...

  5. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    International Nuclear Information System (INIS)

    The activities of 228Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide 228Ac. The radium was pre-concentrated on MnO2 and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter 228Ra(228Ac), the daughter nuclide 228Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by 228Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9±0.1% was measured for 228Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317±0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of 228Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for 228Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure 228Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used

  6. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    International Nuclear Information System (INIS)

    Linear free energy relationships for trivalent cations with crystalline M2O3 and, M(OH)3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔGf,MvX0=aMvXΔGn,M3+0+bMvX+βMvXrM3+, where the coefficients aMvX, bMvX, and βMvX characterize a particular structural family of MvX, rM3+ is the ionic radius of M3+ cation, ΔGf,MvX0 is the standard Gibbs free energy of formation of MvX and ΔGn,M3+0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: aMvX=0.2705, bMvX=-1984.75 (kJ/mol), and βMvX=197.24 (kJ/molnm). The coefficients for the hydroxide family are: aMvX=0.1587, bMvX=-1474.09 (kJ/mol), and βMvX=791.70 (kJ/molnm).

  7. Actinium: A RESTful Runtime Container for Scriptable Internet of Things Applications


    Kovatsch, Matthias; Lanter, Martin; Duquennoy, Simon


    Programming Internet of Things (IoT) applications is challenging because developers have to be knowledgeable in various technical domains, from low-power networking, over embedded operating systems, to distributed algorithms. Hence, it will be challenging to find enough experts to provide software for the vast number of expected devices, which must also be scalable and particularly safe due to the connection to the physical world. To remedy this situation, we propose an architecture that pr...

  8. New method for large scale production of medically applicable Actinium-225 and Radium-223

    International Nuclear Information System (INIS)

    Alpha-emitters (211At, 212Bi, 213Bi, 223Ra, 225Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225Ac may be used either directly or as a mother radionuclide in 213Bi isotope generator. Production of 225Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225Ac production is separation from mother 229Th or irradiation of 226Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225Ac, 227Ac, 227Th, 228Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO3 media. About 6 mCi 225Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227Ac (0.1% at the EOB) but it does not hinder 225Ac from being used for medical 225Ac/213Bi generators. (author)

  9. Synthesis of chelating agents for actinium 225 complexation and its application in radioimmunotherapy

    International Nuclear Information System (INIS)

    Immunotherapy with radiolabeled antibodies should allow fairly specific targeting of certain cancers. However, iodine 131 may not be the best isotope for tumor therapy because of its limited specific activity, low beta-energy, relatively long half life and strong gamma emission. Another approach to improve therapeutic efficacy is the use of replacement isotopes with better physical properties. Chelator that can hold radio-metals with high stability under physiological conditions are essential to avoid excessive damage to non-target cells; Moreover, the development of new bifunctional chelating agents is essential for this purpose. Accordingly, our efforts have been directed, for several years, to the synthesis of original chelating agents likely to form stable complexes in vivo with the numerous potential candidates for such applications. Therefore, we have developed a new simple and efficient synthesis pathway of 2-(4-iso-thio-cyanate-benzyl)-1,4,7,10,13,16- hexa-aza-cyclo-hexadecane- 1,4,7,10,13,16-hexa-acetic acid, though functionalized on the cycle by a termination allowed coupling to an antibody or any other biological substance such as a hapten. (author)

  10. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    International Nuclear Information System (INIS)

    A technique of selenium purification from 232Th, 238U, 226,228Ra, 227Ac and 40K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  11. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Energy Technology Data Exchange (ETDEWEB)

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)


    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  12. Solidification structure of C2.08Cr25.43Si1.19Mn0.43Fe70.87 powders fabricated by high pressure gas atomization

    International Nuclear Information System (INIS)

    Powders of hypoeutectic high chromium white cast iron (C2.08Cr25.43Si1.19Mn0.43Fe70.87) were produced by high pressure gas atomization. The microstructure of the powders was characterized using light microscopy, scanning electron microscopy and X-ray diffraction. The results showed that the as-atomized powders were mainly composed of austenite and M7C3 (M = Fe, Cr) type carbide, and became ferrite and carbide after annealing. With the decrease of the powder diameter, the number of austenite grains, primary dendrite length and second dendrite arm spacing were decreased. The relationship between cooling rate and microstructure was also determined.

  13. Solidification structure of C{sub 2.08}Cr{sub 25.43}Si{sub 1.19}Mn{sub 0.43}Fe{sub 70.87} powders fabricated by high pressure gas atomization

    Energy Technology Data Exchange (ETDEWEB)

    Dai Yongxiang; Yang Min; Song Changjiang [Shanghai Key Laboratory of Modern Metallurgy and Materials Processing, Shanghai University, Shanghai (China); Han, Qingyou [Mechanical Engineering Technology Department, Purdue University (United States); Zhai Qijie, E-mail: [Shanghai Key Laboratory of Modern Metallurgy and Materials Processing, Shanghai University, Shanghai (China)


    Powders of hypoeutectic high chromium white cast iron (C{sub 2.08}Cr{sub 25.43}Si{sub 1.19}Mn{sub 0.43}Fe{sub 70.87}) were produced by high pressure gas atomization. The microstructure of the powders was characterized using light microscopy, scanning electron microscopy and X-ray diffraction. The results showed that the as-atomized powders were mainly composed of austenite and M{sub 7}C{sub 3} (M = Fe, Cr) type carbide, and became ferrite and carbide after annealing. With the decrease of the powder diameter, the number of austenite grains, primary dendrite length and second dendrite arm spacing were decreased. The relationship between cooling rate and microstructure was also determined.

  14. Extended optical model analyses of elastic scattering and fusion cross section data for the 12C+208Pb system at near-Coulomb-barrier energies by using a folding potential

    International Nuclear Information System (INIS)

    Simultaneous χ2 analyses are performed for elastic scattering and fusion cross section data for the 12C+208Pb system at near-Coulomb-barrier energies by using the extended optical model approach in which the polarization potential is decomposed into direct reaction (DR) and fusion parts. Use is made of the double folding potential as a bare potential. It is found that the experimental elastic scattering and fusion data are well reproduced without introducing any normalization factor for the double folding potential and also that both DR and fusion parts of the polarization potential determined from the χ2 analyses satisfy separately the dispersion relation. Furthermore, it is shown that the imaginary parts of both DR and fusion potentials at the strong absorption radius change very rapidly, which results in a typical threshold anomaly in the total imaginary potential as observed with tightly bound projectiles such as α-particle and 16O

  15. Herramientas de Análisis Estadístico y Espacial aplicadas en la separación Línea Base – Anomalía Geoquímica. Implicaciones en Exploración de Recursos Naturales. Parte 2: Zinc en Sedimentos Activos Plancha 5-09 y 208 – Villeta, Colombia

    Directory of Open Access Journals (Sweden)

    García Cabrejo Oscar Javier


    Full Text Available Se emplea la concentración de Zn en sedimentos activos en las planchas 5-09, (escala 1:500000y 208 (escala 1:100000 como caso de estudio, con el fin de comparar los valores de línea base– anomalía para dos escalas de muestreo y por unidad geológica en el sector central de la plancha208 – Villeta. Dichos valores de línea base – anomalía se reportan para cada uno de los métodos.El muestreo de baja densidad (Plancha 5-09 delimita sectores con las concentraciones mayores deZn (zona anómala, en el flanco W de Cordillera Oriental al W de Bogotá y específicamente el sectorcentral de la Plancha 208 – Villeta. Esto implica que a nivel regional el muestreo de baja densidadpermite delimitar de forma efectiva anomalías regionales o blancos de exploración potenciales. Anivel particular en el sector central de la Plancha 208 – Villeta, la Formación El Peñón presenta losvalores más altos de Zn, en donde se delimitan las zonas anómalas de interés, mientras que lasunidades del Cretácico inferior y superior representan zonas de empobrecimiento en Zn respecto detoda la región.

  16. Rayleigh LIDAR and satellite (HALOE, SABER, CHAMP and COSMIC) measurements of stratosphere-mesosphere temperature over a southern sub-tropical site, Reunion (20.8 S; 55.5 E). Climatology and comparison study

    Energy Technology Data Exchange (ETDEWEB)

    Sivakumar, V. [Univ. de La Reunion, Reunion Island (FR). Lab. de l' Atmosphere et des Cyclones (LACy); Council for Scientific and Industrial Research (CSIR), Pretoria (ZA). National Laser Centre (NLC); Pretoria Univ. (South Africa). Dept. of Geography, Geoinformatics and Meteorology; KwaZulu Natal Univ., Durban (South Africa). School of Physics; Vishnu Prasanth, P. [Univ. de La Reunion, Reunion Island (FR). Lab. de l' Atmosphere et des Cyclones (LACy); Sree Vidyanikethan Engineering College, Tirupathi, Andhra Pradesh (India); Kishore, P. [California Univ., Irvine, CA (United States). Dept. of Earth System Science; Bencherif, H. [Univ. de La Reunion, Reunion Island (FR). Lab. de l' Atmosphere et des Cyclones (LACy); Keckhut, P. [IPSL (UMR 8190), Guyancourt (FR). Lab. Atmospheres Milieux Observations Spatiales (LATMOS)


    For the first time, climatology of the middle atmosphere thermal structure is presented, based on 14 years of LIDAR and satellite (HALOE, SABER, CHAMP and COSMIC) temperature measurements. The data is collected over a southern sub-tropical site, Reunion Island (20.8 S; 55.5 E), for the height range between 30 and 60 km. The overall monthly mean temperature shows a maximum of 265-270K at the stratopause height region from {proportional_to}44-52 km and peaks during the months of March and November. Furthermore, the temperature profiles are compared with different satellite datasets (HALOE, CHAMP, COSMIC and SABER) and the results are found to be in reasonable agreement with each other, although a relative difference in temperature of {+-}5 to 6K is noticed. In comparison, LIDAR shows higher/lower temperatures for the lower mesosphere/upper stratosphere height region. The differences in temperature measured by the LIDAR and satellite measurements are analogous with previous results available elsewhere. Long-term temperature measurements are used to further study seasonal oscillations, especially annual, semi-annual and quasi-biennial oscillations. In comparison with SAO, the measured spectral amplitudes of AO shows dominant amplitudes in both the upper stratosphere and lower mesosphere height regions. Using LIDAR and the other satellite measurements, the quasi-biennial oscillation was found to be approximately 26 months. The spectral amplitudes are comparable to the results reported earlier by other researchers. (orig.)

  17. Study of central collisions of relativistic 12C and 40Ar on 208Pb, using neutral and charged pi-meson production, and charged particle multiplicity as probes. Volumes 1 and II

    International Nuclear Information System (INIS)

    Recent advances in accelerator technology have made it possible to accelerate nuclei much heavier than the proton to relativistic energies, opening the study of nuclear matter to a new and exciting avenue of scientific inquiry - the study of relativistic heavy ion collisions. To help expand the boundaries of current knowlege in this field, and to understand the detailed nature of the collision process more fully, the rate of charged and neutral pion production, the total charged particle multiplicity, and the production of low energy γ rays have been measured for central collisions relativistic 12C and 40Ar on 208Pb. Using the results of these measurements, an effort has been made to determine what phenomena may exist which are uniquely characteristic of central collisions of relativistic heavy ions, how central collisions of relativistic heavy ions may be parameterized, e.g., by charged particle multiplicity, so that future studies may be done more systematically, and how thoroughly the incident energy and momentum delivered by the projectile are distributed among the nucleons which participate in the reaction. Toward that end, the observations of the current study are compared with existing heavy ion collision theories whenever possible. The neutral pion production measurments presented in this work represent the first reported data of their kind, and consequently are of particular interest. Overall, the rate of both charged and neutral pion production is found to be a smoothly increasing function of beam energy

  18. Remarkable charge-trapping efficiency of the memory device with (TiO2)0.8(Al2O3)0.1 composite charge-storage dielectric (United States)

    Jiang, K.; Ou, X.; Lan, X. X.; Cao, Z. Y.; Liu, X. J.; Lu, W.; Gong, C. J.; Xu, B.; Li, A. D.; Xia, Y. D.; Yin, J.; Liu, Z. G.


    A memory device p-Si/SiO2/(TiO2)0.8(Al2O3)0.1(TAO-81)/Al2O3/Pt was fabricated, in which a composite of two high-k dielectrics with a thickness of 1 nm was employed as the charge-trapping layer to enhance the charge-trapping efficiency of the memory device. At an applied gate voltage of ±9 V, TAO-81 memory device shows a memory window of 8.83 V in its C-V curve. It also shows a fast response to a short voltage pulse of 10-5 s. The charge-trapping capability, the endurance, and retention characteristics of TAO-81 memory device can be improved by introducing double TAO-81 charge-trapping layers intercalated by an Al2O3 layer. The charge-trapping mechanism in the memory device is mainly ascribed to the generation of the electron-occupied defect level in the band gap of Al2O3 induced by the inter-diffusion between TiO2 and Al2O3.

  19. Observations of protons with energies Esub(p) >=100 MeV and electrons with energies Esub(e) >=20 MeV by means of the oriented Kosmos-208 and Kosmos-228 satellites

    International Nuclear Information System (INIS)

    Measurement results of cosmic radiation have been analyzed using scintillation-Cherenkov spectrometer SEhZ-1 in oriented ''Kosmos-208'' and ''Kosmos-228'' satellites. Applicability of the Mc Ilwain's parameter L for the description of planetary distribution of detected radiation is shawn. The effect of equatorial plato and reverse latitude pitch ip the equatorial area is discussed. An essential difference in the instrument readings during its axis orientation relative to nadir or zenith is domonstrated. When orienting the instrument axis relative to zenith the data on latitude pitch of radiatione detected by means of a channel with the 500 MeV threshold (protons), in the range of medium and high latitudes coincide with the results of battoo; experiments on xntensity and sctrum measurement of primary cosmic rays to the accuracy of 35%. A possibility of observation with the SEhZ-1 spectrometer of the dynamics of high-energy protons (and electrons) of the internal radiation belt of the Earth in the region of Brasil magnetic anomaly is shown

  20. The identification of soil radionuclides in the area of Puspiptek and surrounding

    International Nuclear Information System (INIS)

    The area of PUSPIPTEK and the surrounding are potentially exposed by radionuclides, because the operation of the nuclear research plant. The PPTN Serpong was operated long than 10 years, therefore soil radioactivity need to evaluate. The determination of radioactivity in the soil samples which be taken from research location using gamma spectrometry on June-August. The result of the research identified natural radionuclides K-40; Thorium decay series Ac-228, Bi-212, Pb-212, Tl-208, Ra-224 and Rn-220; Uranium decay series Bi-214, Pa-234, Pb-214 and Actinium decay series Bi-211, Po-211. There are no identification radionuclides produce from the activation of PPTN Serpong

  1. Stable (206Pb, 207Pb, 208Pb) and radioactive (210Pb) lead isotopes in 1 year of growth of Sphagnum moss from four ombrotrophic bogs in southern Germany: Geochemical significance and environmental implications (United States)

    Shotyk, William; Kempter, Heike; Krachler, Michael; Zaccone, Claudio


    The surfaces of Sphagnum carpets were marked with plastic mesh and 1 year later the production of plant matter was harvested in four ombrotrophic bogs from two regions of southern Germany: Upper Bavaria (Oberbayern, OB) and the Northern Black Forest (Nordschwarzwald, NBF). Radioactive, 210Pb was determined in solid samples using ultralow background gamma spectrometry while total Pb concentrations and stable isotopes (206Pb, 207Pb, 208Pb) were determined in acid digests using ICP-SMS. Up to 12 samples (40 × 40 cm) were collected per site, and 6-10 sites investigated per bog. The greatest variations within a given sampling site were in the range 212-532 Bq kg-1 for 210Pb activity, whereas 206Pb/207Pb and 208Pb/206Pb varied less than 1%. The median values of all parameters for the sites (6-10 per bog) were not significantly different. The median activities of 210Pb (Bq kg-1) in the mosses collected from the bogs in NBF (HO = 372 ± 56, n = 55; WI = 342 ± 58, n = 93) were slightly less from those in OB (GS = 394 ± 50, n = 55; KL = 425 ± 58, n = 24). However, the mosses in the NBF bogs exhibited much greater productivity (187-202 g m-2 a-1) compared to those of OB (71-91 g m-2 a-1), and this has a profound impact on the accumulation rates of 210Pb (Bq m-2 a-1), with the bogs in the NBF yielding fluxes (HO = 73 ± 30; WI = 65 ± 20) which are twice those of OB (GS = 29 ± 11; KL = 40 ± 13). Using the air concentrations of 210Pb measured at Schauinsland (SIL) in the southern Black Forest and average annual precipitation, the atmospheric fluxes of 210Pb at SIL (340 Bq m-2 a-1) exceeds the corresponding values obtained from the mosses by a factor of five, providing the first quantitative estimate of the net retention efficiency of 210Pb by Sphagnum. When the 210Pb activities of all moss samples are combined (n = 227), a significant decrease with increasing plant production rate is observed; in contrast, total Pb concentrations show the opposite trend. The contrasting

  2. [Comparison of the performances of gas chromatography-quadrupole time of flight mass spectrometry and gas chromatography-tandem mass spectrometry in rapid screening and confirmation of 208 pesticide residues in fruits and vegetables]. (United States)

    Cao, Xinyue; Pang, Guofang; Jin, Linghe; Kang, Jian; Hu, Xueyan; Chang, Qiaoying; Wang, Minglin; Fan, Chunlin


    The performances of gas chromatography-tandem mass spectrometry (GC-MS/MS) and gas chromatography quadrupole time of flight mass spectrometry (GC-QTOF/MS) for the determination of 208 pesticide residues in fruit and vegetable samples, including apple, orange, tomato and cucumber, were compared comprehensively. Based on the differences of the two instruments, their respective characteristics and scopes of application in the detection of the pesticide residues were presented, which provided the reference for the analysis of pesticide residues. The performance parameters of the two instruments, such as overall recoveries, precisions, limits of detection, linear ranges, identification points and matrix effects, were evaluated according to a designed experiment. At three spiked levels (5.0, 10.0 and 20.0 µg/kg), the average recoveries for the majority of pesticides (93.0%) ranged from 70% to 120% in the four matrices with relative standard deviations below 20%. The limits of detection for most of the pesticides by GC-MS/MS and GC-Q-TOF/MS were less than 5.0 µg/kg. Compared with GC-QTOF/MS, GC-MS/MS showed relatively lower limits of detection and wider linear ranges, and its performance was more satisfactory in accurate quantitative analysis due to its superior sensitivity. On the other hand, GC-QTOF/MS provided accurate mass measurement, which was proved to be an efficient analytical tool on the rapid screening and confirmation of a large number of pesticides and non-target compounds. PMID:26292409

  3. Characterization of the ground X{sub 1} state of {sup 204}Pb{sup 19}F, {sup 206}Pb{sup 19}F, {sup 207}Pb{sup 19}F, and {sup 208}Pb{sup 19}F

    Energy Technology Data Exchange (ETDEWEB)

    Mawhorter, Richard J.; Murphy, Benjamin S.; Baum, Alexander L.; Sears, Trevor J.; Yang, T.; Rupasinghe, P. M; McRaven, C. P.; Shafer-Ray, N. E.; Alphei, Lukas D.; Grabow, Jens-Uwe [Department of Physics and Astronomy, Pomona College, Claremont, California 91711-6327 (United States); Chemistry Department, Brookhaven National Laboratory, Upton, New York 11973-5000 (United States); Homer L. Dodge Department of Physics and Astronomy, University of Oklahoma, Norman, Oklahoma (United States); Gottfried-Wilhelm-Leibniz-Universitaet, Institut fuer Physikalische Chemie and Elektrochemie, Lehrgebiet A, D-30167 Hannover (Germany)


    Pure rotational spectra of the ground electronic-vibrational X{sub 1} state of {sup 204}Pb{sup 19}F, {sup 206}Pb{sup 19}F, {sup 207}Pb{sup 19}F, and {sup 208}Pb{sup 19}F are measured with a resonator pulsed supersonic jet Fourier-transform microwave spectrometer. Also reported is a new measurement of the Stark effect on the optical spectra of A(leftarrow)X{sub 1} transitions. These spectra are combined with published high-resolution infrared spectra of X{sub 2}{r_reversible}X{sub 1} transitions in order to create a complete picture of the ground state of lead monofluoride. For the microwave data, molecules are prepared by laser ablation of lead target rods and stabilized in a supersonic jet of neon mixed with sulfur hexafluoride. For the optical Stark spectra, a continuous source of molecules is created in a nozzle heated to 1000 deg. C. The microwave spectra confirm, improve, and extend previously reported constants that describe the rotational, spin-orbit, and hyperfine interactions of the ground electronic state of the PbF molecule. A discrepancy concerning the sign of the hyperfine constant describing the {sup 207}Pb nucleus is discussed. Magnetic-field-dependent microwave spectra are used to characterize the Zeeman interaction in terms of two g factors of the body-fixed electronic wave function. The optical Stark spectra are used to characterize the electric dipole moment of the X{sub 1} and A states.

  4. 48 CFR 1552.208-70 - Printing. (United States)


    ... casting, photo typesetting, or electronic character generating devices for the purpose of producing camera copy, negatives, a plate or image to be used in the production of printing or microform. “Camera copy” (or “camera-ready copy”) is a final document suitable for printing/duplication. “Desktop...

  5. 30 CFR 208.2 - Definitions. (United States)


    ... or Region means the geographic territory having Federal oil and gas leases over which MMS has... other oil on a volume or equivalent value basis. Fair market value means the value of oil—(1) Computed... authorizes the exploration, development, and production of oil and gas on Federal lands onshore or on the...

  6. QTL Information Table: 208 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available Morphological trait Panicle/flower total number of spikelets per panicle RFLP C)Interval RIL Zhe ... .L. (2001). Comparison of the detection of QTL for yi eld traits in different generations of a rice cross ... using two mapping approaches. Yi ... Chuan Xue Bao 28, 458-464. ...

  7. 5 CFR 551.208 - Learned professionals. (United States)


    ... predominantly intellectual in character and includes work requiring the consistent exercise of discretion and judgment, as distinguished from performance of routine mental, manual, mechanical or physical work. An... application of a knowledge of such engineering fundamentals as the strength and strain analysis of...

  8. 24 CFR 881.208 - Financing. (United States)


    ... the mortgagee of the Section 8 project, will be subject to 24 CFR part 811, subpart B. (2) Issuers of obligations that are tax-exempt under Section 11(b) of the U.S. Housing Act of 1937 will be subject to 24 CFR....S. Housing Act of 1937 will be subject to 24 CFR 811, subpart A if paragraph (b)(1) of this...

  9. 24 CFR 880.208 - Financing. (United States)


    ... solely to the requirements of 24 CFR part 883 with regard to the approval of tax-exempt financing. (c...-backed securities issued by the mortgagee of the Section 8 project, will be subject to 24 CFR part 811... 1937 will be subject to 24 CFR part 811, subpart A if paragraph (b)(1) of this section is...

  10. Shell model states around $^{208}Pb$

    CERN Document Server

    Liendo, J A; Gómez, R; Caussyn, D D


    The experimental binding energies of single-particle and single-hole neutron states belonging to neutron shells that extend from N = 126 to 184 and 82 to 126 respectively, have been reproduced by solving Schr\\"{o}edinger's equation with a potential containing the traditional Woods-Saxon (WS) plus spin-orbit (SO) potential [1-6], and a superficial term proportional to the derivative of a Woods-Saxon like potential. The agreement between theory and experiment has been achieved by varying the strength of the superficial potential for each state studied, until the theoretical binding energy matches the corresponding measured value. Our results indicate the existence of a explicit relationship between the strength of the superficial potential and the orbital angular momentum quantum number $\\ell$ of the state. This dependence has been used to make reasonable predictions for the excitation energy centroids of states located inside and outside the neutron shells investigated. Comparisons are made with results report...

  11. 12 CFR 208.77 - Definitions. (United States)


    ...) Affiliate, Company, Control, and Subsidiary. The terms “affiliate”, “company”, “control”, and “subsidiary” have the meanings given those terms in section 2 of the Bank Holding Company Act of 1956 (12 U.S.C... company that is controlled by one or more insured depository institutions other than: (i) A...

  12. Contribution to construction and setup of a detection system for the focal plan of the BBS spectrometer. Application to study of the neutron emission decay of the resonant states populated by the reaction (4He,3He) at 42 MeV/u in nuclei 208Pb and 209Pb

    International Nuclear Information System (INIS)

    In order to realize an experimental program dedicated to nuclear structure studies we have conceived and constructed at IPN Orsay a detection system for the focal plane of the magnetic spectrometer BBS, installed at the cryogenic cyclotron AGOR of the laboratory KVI (The Netherlands). Two detection units, consisting each of two localization plans of the Cathode Strip Chamber (CSC) type, measure the position and angle of particle trajectory. This information is used for the determination of the reaction parameters at the target by a backtracking procedure. The identification of the reaction products is done by the measurement of their time-of-flight and energy loss. For light ions this task is assumed by plastic scintillators, and for heavy ions by a parallel plan detector (PPAC) and an ionization chamber. This detection system is well adapted to the requirements given by the detection of a large range of ions (protons to 36Ar at energies of several tenths of MeV/nucleon) as well as the big acceptance, the small dispersion and the aberration of the BBS. The results of the test show the good performances of the detection system. In a first experiment the focal plane detection system was coupled to the neutron multidetector EVEN in order to study the decay of resonant high spin states at high excitation energies by the (4He, 3He) reaction on 207Pb and 208Pb targets. The transfer spectra, inclusive and in coincidence, of the nuclei 208Pb and 209Pb show a striking resemblance except for an excitation energy shift which is due to the hole in the last neutron shell of 207Pb. The resonances at l 8 and l = 9 are clearly populated, in agreement with the predictions of the Bonaccorso-Brink model. A sizeable fraction of the decay of the l = 8 resonance is direct, but at excitation energies higher than 15 MeV (in 208Pb) the decay is mostly statistical. (author)

  13. An aerial radiological survey of the Sandia National Laboratories and surrounding area

    International Nuclear Information System (INIS)

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

  14. The Technological Enhancement of Normally Occurring Radioactive Materials in Red Mud due to the Production of Alumina

    Directory of Open Access Journals (Sweden)

    Maurice O. Miller


    Full Text Available This study investigates the level of technological enhancement of normally occurring radioactive materials (TENORM in the red mud waste due to the production of alumina in Jamaica. Technological enhancements factors (TEF were determined for the uranium, thorium, actinium series, their progenies, and the nonseries potassium-40 using gamma spectrometry. The study concluded that bauxite production technologically enhances the uranium progenies Th-234, Pb-214, Bi-214, and Pa-234 and the thorium-232 progenies Ac-228, Pb-212, and Bi-212 in red mud. The actinium series was technologically enhanced, but K-40 and the thorium daughter, Tl-208, were reduced. The spectrometric comparison of Tl-208 (at 510 keV was unexpected since its other photopeaks at 583 keV, 934 keV, and 968 keV were markedly different. An explanation for this anomaly is discussed. An explanation regarding the process of accumulation and fractionation of organically derived phosphate deposits and potassium-feldspar is offered to explain the spectrometric differences between the alumina product and its waste material, red mud.

  15. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus


    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  16. 宁夏208例胃癌危险因素的病例对照研究%A Case - Control Study on Risk Factors of Gastric Carcinoma in Ningxia

    Institute of Scientific and Technical Information of China (English)

    高瑞萍; 杨力


    目的 探讨宁夏地区胃癌高发的相关危险因素,找出可以干预的一些相关因素.方法 以2008年5月至2008年10月经胃镜检出并经病理确诊的胃癌208例作为研究对象,按1∶2频数匹配原则选取同性别、年龄(相差±5岁)、同一民族、同一居住地的慢性浅表性胃炎416例,进行问卷调查,进行条件Logistic回归分析.结果 多因素条件Logistic回归分析结果显示宁夏地区胃癌发病与幽门螺杆菌感染(OR=4.454,95% CI=2.763 ~7.180)、胃癌家族史(OR=3.574,95% CI=1.909~6.689)、食用腌渍食品(OR=2.485,95% CI=1.574~3.922)和饮井水或窖水(OR=1.914,95% CI=1.216 ~3.014)密切相关.结论 宁夏地区胃癌高发危险因素包括幽门螺杆菌感染、胃癌家族史、经常食用腌渍食品、饮井水或窖水,因此改善饮水条件、防治幽门螺杆菌感染、改变当地居民的生活方式及进行健康宣教对降低胃癌的发生至关重要.%Objective To explore the relationship between personality characteristics and their parental stress in parents of children with autism so as toprovide a theoretical basis for carrying out psychological intervention and support. Methods 34 parents of children with autism and 68 parents of normal children were investigated with Parenting Stress Index Short Form (PSI /SF) and Eysenck Personality Questionnaire (EPQ). Results Parents of children with autism experienced a significantly higher level in the total score of parenting stress and three subscale score (P <0. 001) than their normal counterparts did. In terms of personality, parental distress was significantly negatively correlated with extraversion ( r = -0.500,P=0.003 ) and was significantly positively correlated with neuroticism ( r =0.423 ,P =0.013 ) ; total parenting stress was significantly negatively correlated with extraversion ( r = -0.421,P=0.013) and significantly positively correlated with neuroticism (r =0.434,P =0.010) in parents of children

  17. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)


    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  18. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    International Nuclear Information System (INIS)

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  19. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    International Nuclear Information System (INIS)

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  20. 49 CFR 571.208 - Standard No. 208; Occupant crash protection. (United States)


    ... by the vehicle occupant. S4.1.2.2Second option—head-on automatic protection system. The vehicle shall... severity of injuries, by specifying vehicle crashworthiness requirements in terms of forces and... under 49 CFR part 585, between the manufacturer so specified and the manufacturer to which the...


    Directory of Open Access Journals (Sweden)

    Stanislav COPEŢCHI


    Full Text Available În cadrul studiului întreprins este supusă investigaţiei problema privind stabilirea coraportului între principiul nead­mi­terii tragerii la răspundere penală de două sau mai multe ori pentru una şi aceeaşi faptă şi infracţiunea de atragere a minorilor la activitate criminală sau de determinare a lor la săvârşirea unor fapte imorale. Se ajunge la concluzia că nu se încalcă principiul dreptului penal stipulat la alin.(2 art.7 CP RM atunci când făptuitorul este tras la răspundere penală pentru fapta prevăzută la art.208 CP RM, precum şi pentru instigare la infracţiunea concretă comisă de minor, în ipoteza în care persoana adultă instigă la săvârşirea infracţiunii un minor care este pasibil de a fi supus răspunderii penale şi care de sine stătător comite infracţiunea. ATTRACT MINORS IN CRIMINAL ACTIVITY OR THEIR DETERMINATION TO COMMIT IMMORAL ACTS (art.208 PC RM vs. PRINCIPLE OF AVOINDING CRIMINAL RESPONSABILITY TWICE FOR THE SAME FACTWithin the undertaken study it is being investigated the problem on establishing the correlation between the principle of avoiding criminal responsibility for two or more times for the same act and offence of attract minors in criminal activity or their determination to commit immoral acts. It is concluded that is not violated principle of criminal law stipulated in par.(2 Article 7 PC RM when the offender is held to criminal responsibility for the act stipulated in Article 208 PC RM and for instigation to the concrete offense, committed by minor, in the event that adult person instigate to commit an offence a minor, who is liable to be subjected to criminal liability and that alone commit the offence. 

  2. Residual nuclide formation in 206,207,208,natPb and 209Bi induced by 0.04 - 2.6 GeV protons as well as in 56Fe induced by 0.3 - 2.6 GeV protons

    International Nuclear Information System (INIS)

    This work is aimed at experimental determination of independent and cumulative yields of radioactive residual product nuclei in the intermediate energy proton-irradiated thin targets made of highly isotopic enriched and natural lead (206,207,208,natPb), bismuth (209Bi), and highly isotopic enriched iron (56Fe). 5972 independent and cumulative yields of radioactive residuals nuclei have been measured in 55 thin Pb and Bi targets irradiated by 0.04, 0.07, 0.10, 0.15, 0.25, 0.6, 0.8, 1.2, 1.4, 1.6, and 2.6 GeV protons. Besides, 219 yields have been measured in 0.3, 0.5, 0.75, 1.0, 1.5, and 2.6 GeV proton-irradiated Fe target. In both cases, the protons were extracted from the ITEP U-10 synchrotron. The measured data are compared with experimental results obtained elsewhere and with theoretical calculations by seven codes. The predictive power was found to be different for each of the codes tested, but was satisfactory on the whole in the case of spallation products. At the same time, none of the codes can describe well the product yields throughout the whole product mass range, and all codes must be further improved. (authors)

  3. Microstructures and Microwave Dielectric Properties of (1-x(Sr0.2Nd0.208Ca0.488TiO3- xNd(Ti0.5Mg0.5O3 Ceramics with High Quality Factor

    Directory of Open Access Journals (Sweden)

    QU Jing-Jing, WEI Xing, JING Ben-Qin, LIU Fei, YUAN Chang-Lai


    Full Text Available (1-x(Sr0.2Nd0.208Ca0.488TiO3-xNd(Ti0.5Mg0.5O3 (0.3≤x≤0.4, SNCT-NTMx ceramics were prepared by solid sate reaction technique. In addition, the crystal structure, microstructures, sintering properties, and microwave dielectric properties of the SNCT-NTMx ceramics were investigated. These results showed that an orthorhombic perovskite structure with a minor amount of unknown secondary phase was formed in the ceramics with the compositions of 0.3≤x≤0.35. Additionally, the content of the second phase gradually increased with increasing x valueup to 0.4. For the SNCT-NTMx ceramics with an increase in NTM content, the dielectric constant (εr decreased, while the quality factor (Q×f effectively improved, and the temperature coefficient of resonant frequencies (τf gradually shifted to negative direction. An optimized microwave dielectric properties with εr ~ 50.1, Q×f ~ 44, 910 GHz and τf ~–1.7×10-6/℃ could be obtained for the ceramics with x = 0.35 after being sintered at 1520℃ for 4 h.

  4. Discovery of difference in the diffuse scattering from nonstoichiometric Ca0.87La0.13F2.13 and Ca0.92Er0.08F2.08 crystals with different types of clusters of structural defects

    International Nuclear Information System (INIS)

    A new approach to application of diffuse scattering (DS) for studying the defect structure of crystals on laboratory radiation sources is implemented. The basic principles of this approach are as follows: (i) choice of crystals with a high concentration of structural defects (highly nonstoichiometric Ca1−xRxF2+x phases), (ii) application of intermeasurement minimization method (experimental comparison) to select a weak desired DS signal from a superposition of signals of different nature, and (iii) choice of the basic model proceeding from the reliable information provided by accurate analysis of the contribution of structural defects to Bragg reflections. Significantly different DS diffraction patterns have been recorded for Ca0.87La0.13F2.13 and Ca0.92Er0.08F2.08 crystals, characterized by different types of structural-defect clusters, determined from the Bragg diffraction data. Experiments performed at 90–100 K proved that DS is caused by clusters with stable atomic configurations rather than cooperative thermal atomic vibrations. A set of methods is proposed which can efficiently be used in diagnostics of nanomaterials

  5. Contribution to construction and setup of a detection system for the focal plan of the BBS spectrometer. Application to study of the neutron emission decay of the resonant states populated by the reaction ({sup 4}He,{sup 3}He) at 42 MeV/u in nuclei {sup 208}Pb and {sup 209}Pb; Contribution a la construction et a la mise au point d'un systeme de detection pour le plan focal du spectrometre BBS. Application a l'etude de la decroissance par emission de neutrons d'etats resonants peuples par la reaction ({sup 4}He,{sup 3}He) a 42 MeV/u dans les noyaux {sup 208}Pb et {sup 209}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Plankl-Chabib, Elke [Inst. de Physique Nucleaire, Paris-11 Univ., 91 - Orsay (France)


    In order to realizean experimental program dedicated to nuclear structure studies we have conceived and constructed at IPN Orsay a detection system for the focal plane of the magnetic spectrometer BBS, installed at the cryogenic cyclotron AGOR of the laboratory KVI (The Netherlands). Two detection units, consisting each of two localization plans of the Cathode Strip Chamber (CSC) type, measure the position and angle of particle trajectory. This information is used for the determination of the reaction parameters at the target by a backtracking procedure. The identification of the reaction products is done by the measurement of their time-of-flight and energy loss. For light ions this task is assumed by plastic scintillators, and for heavy ions by a parallel plan detector (PPAC) and an ionization chamber. This detection system is well adapted to the requirements given by the detection of a large range of ions (protons to {sup 36}Ar at energies of several tenths of MeV/nucleon) as well as the big acceptance, the small dispersion and the aberration of the BBS. The results of the test show the good performances of the detection system. In a first experiment the focal plane detection system was coupled to the neutron multidetector EVEN in order to study the decay of resonant high spin states at high excitation energies by the ({sup 4}He, {sup 3}He) reaction on {sup 207}Pb and {sup 208}Pb targets. The transfer spectra, inclusive and in coincidence, of the nuclei {sup 208}Pb and {sup 209}Pb show a striking resemblance except for an excitation energy shift which is due to the hole in the last neutron shell of {sup 207}Pb. The resonances at l 8 and l = 9 are clearly populated, in agreement with the predictions of the Bonaccorso-Brink model. A sizeable fraction of the decay of the l = 8 resonance is direct, but at excitation energies higher than 15 MeV (in {sup 208}Pb) the decay is mostly statistical.

  6. 48 CFR 2452.208-71 - Reproduction of reports. (United States)


    ... preparation to produce camera ready copy for reproduction must be set by methods other than hot metal... and/or positives prepared with a camera requiring a darkroom. All reproducibles (camera ready copies for reproduction by photo offset methods) shall become the property of the Government and shall...

  7. 44 CFR 208.12 - Maximum Pay Rate Table. (United States)


    ...) Worldwide for physicians. The rates used in the initial Table can be found at rates used in the initial Table can be found at (iii...:// (3) Review and update. DHS will review and update the...

  8. 19 CFR 351.208 - Suspension of investigation. (United States)


    ...) Introduction. In addition to the imposition of duties, the Act also permits the Secretary to suspend an... investigation involving a nonmarket economy country or a countervailing duty investigation, the government, must... or producer or, in an investigation involving a nonmarket economy country, the government,...

  9. 28 CFR 42.208 - Notice of noncompliance. (United States)


    ... Act (APA) if: (1) The agency gives all interested parties opportunity for— (i) The submission and... consistent with the APA, it shall presume the APA procedures were applied, and send notification under §...

  10. 44 CFR 206.208 - Direct Federal assistance. (United States)


    ... agency in all support and local jurisdictional matters. (2) A statement as to the reasons the State and... Federal agency in all State and local jurisdictional matters. These matters include securing local building permits and rights of entry, control of traffic and pedestrians, and compliance with...

  11. Surface Diffuseness Parameter From 16O+208Pb System

    Institute of Scientific and Technical Information of China (English)


    <正>The nucleus-nucleus potential is the primary ingredient in nuclear reaction calculations. Its nuclear part has often been parametrized as a Wood-Saxon (WS) form. In general, a diffuseness parameter of

  12. Widths of the isobaric analog state of 208Pb

    International Nuclear Information System (INIS)

    Both escape and spreading widths are evaluated microscopically in a consistent framework for the isobaric analog of the 206Pb ground state. A TDA Green function is obtained within the space of discretized J=0+ proton-particle neutron-hole configurations using the Skyrme interaction. Couplings of these configurations with continuum and more complicated configurations are included into TDA matrix elements with a form of energy dependent terms. The energy and the widths of the isobaric analog resonance are obtained as a result of the matrix diagonalization. Comparison is made of the results with the former theoretical calculations as well as experimental data. (orig.)

  13. 12 CFR 208.62 - Suspicious activity reports. (United States)


    ... transaction related to a money laundering activity or a violation of the Bank Secrecy Act. This section... or more that involve potential money laundering or violations of the Bank Secrecy Act. Any... 17 CFR 240.17f-1. (g) Retention of records. A member bank shall maintain a copy of any SAR filed...

  14. 24 CFR 3280.208 - Smoke alarm requirements. (United States)


    ... locations: (i) To protect both the living area and kitchen space. Manufacturers are encouraged to locate the alarm in the living area remote from the kitchen and cooking appliances. A smoke alarm located within 20... other equipment discharging conditioned air through a ceiling grille into the living space; and (ii)...

  15. 40 CFR 59.208 - Charcoal lighter material testing protocol. (United States)


    ... each test run (grams VOC/start ) A=Hydrocarbon molecular weight =14.0268 grams per gram-mole (14.0268 pounds per pound-mole) B=Carbon number =1 C=Average concentration for each duplicate run of total gaseous... emissions resulting from the ignition of the barbecue charcoal are, on average, less than or equal to...

  16. Dicty_cDB: SSJ208 [Dicty_cDB

    Lifescience Database Archive (English)


  17. 10 CFR 1015.208 - Administrative wage garnishment. (United States)


    ... delinquent debt in accordance with section 31001(o) of the DCIA, codified at 31 U.S.C. 3720D. Treasury has issued regulations implementing the administrative wage garnishment provisions contained in the DCIA, at 31 CFR 285.11. DOE has adopted these regulations in their entirety. (b) As described in §...

  18. 13 CFR 134.208 - Representation in cases before OHA. (United States)


    ... attorney. A partner may represent a partnership; a member may represent a limited liability company; and an officer may represent a corporation, trust, association, or other entity. (b) An attorney for a party...

  19. 5 CFR 734.208 - Participation in fundraising. (United States)


    ... political contributions in a partisan election described in 5 CFR part 733; (3) Solicit, accept, or receive... apply, e.g., the Federal Property Management Regulations in 41 CFR chapter 101. Further, Federal... employee of the National Park Service may give a speech or keynote address at a political fundraiser...

  20. Dicty_cDB: SSA208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lphphqqytnstptvhqq*hqhqqihqiqphp khqqqlvllqlllqvyhslfsq*ffpfvnfknxkxxklfgifkynfkffkxk*n*inn*i n*likkiklklf*fknk Frame B: ---iisqhianq...A14, DNA sequence. 44 1.9 1 AL355529 |AL355529.21 Human DNA sequence from clone RP11-85C15 on chromosome 10....e. 38 7.1 2 AL732445 |AL732445.3 Human DNA sequence *** SEQUENCING IN PROGRESS **... 42 7.5 1 AL031684 |AL031684.14 Human DNA sequence from clone RP5-917N8 on chromosome 20p11.22-12.1 Contains STSs an... |pid:none) Mus musculus TFII-I repeat domain-... 33 7.5 (Q8R4X7) RecName: Full=General transcription factor

  1. 42 CFR 495.208 - Avoiding duplicate payment. (United States)


    ... EHR incentive program, payment for such an individual is only made under the MA EHR incentive program...-affiliated eligible hospital under common governance only occurs under the MA EHR incentive program to the... program under § 495.104 of this part. In no event are EHR incentive payments made for a hospital for...

  2. 12 CFR 208.37 - Government securities sales practices. (United States)


    ... Department of the Treasury rules under section 15C (17 CFR 400.1(d) and part 401). (b) Definitions. For... rules under section 15C (17 CFR 400.1(d) and Part 401). (2) Customer does not include a broker or dealer... dealer. (d) Recommendations to customers. In recommending to a customer the purchase, sale or exchange...

  3. 12 CFR 208.101 - Obligations concerning institutional customers. (United States)


    ... believing the recommendation is suitable for the customer to whom it is made. Banks are expected to meet the... circumstances of the customer. (c) In recommending to a customer the purchase, sale, or exchange of any... for the customer upon the basis of the facts, if any, disclosed by the customer as to the...

  4. 7 CFR 62.208 - Publication of QSVP assessment status. (United States)


    ... (CONTINUED) LIVESTOCK, MEAT, AND OTHER AGRICULTURAL COMMODITIES (QUALITY SYSTEMS VERIFICATION PROGRAMS.../lsg/arc/audit.htm. Such postings shall include: (a) Program name and contact information, (b)...

  5. Van sloop naar behoud: Renovatie Complex 208 te Rotterdam


    Dubbeling, D.J.


    Flats uit de eerste naoorlogse decennia liebben na een of twee eerdere renovatierondes het einde van hun levensduur wel bereilct. Of toch niet? De balans tussen slopen en renoveren slaat door naar renoveren. Dat is mooi te illustreren aan de hand van flats in Lombardijen die behouden zijn voor de doelgroep.

  6. Dicty_cDB: VHM208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lrrrclrtnrncitssrr*tyqtslirqqsrsflirtpikh* rslslfp*sy*irqchcw*h*r*gir*chcip--- ---rtsyrfpiilcqssftsirixrfhr*... 268 3e-70 (Q6FYA7) RecName: Full=Elongation factor 2; Short=EF-2;... 267 5e-70 DQ357217_1( DQ357217 |pid:none) Leishmania brazili...ensis elongation... 266 1e-69 AM494972_26( AM494972 |pid:none) Leishmania braziliensis...vvlmnksvvsplnlhlyhftskcqrktnyqlvvlhtnf*silsipqvtlis vqk*llpsvllmvl*slsiaskvfaykpklyyvkpslnvsnqsysstksivsy*nsn*tl kkli...s fw*yeiyvmsc**trawyhh*ificitslrnakgrqitswlyftrifnqsyrfprsr*fq frsnccppcy*wcfsryr

  7. Dicty_cDB: AHB208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 312837 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX14G21 5...i aconitase mRNA, partial cds. 58 6e-11 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell...1 EST311828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10

  8. Dicty_cDB: VSC208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence update 2000. 9.22 Translated Amino Acid sequence VGRTMVVHADQDDLGKGGKPDSLTTGAAGARLGCGVIGVSQ*isn*nktllnike...fklk*npvkykrstpfl ll Frame B: VGRTMVVHADQDDLGKGGKPDSLTTGAAGARLGCGVIGVSQ*isn*nktllnike

  9. Electromagnetic Dissociation of Target Nuclei by $^{208}$Pb Projectiles

    CERN Multimedia

    Petridis, A; Wohn, F K


    % NA53 \\\\ \\\\ The purpose of this experiment is to study the process of electromagnetic dissociation (ED) that occurs at impact parameters large enough so that there is no nuclear interaction. In these cases strong electromagnetic fields are produced for a short time at the nucleus. For large charges and ultrarelativistic energies, the intense electromagnetic pulse produces cross-sections much larger than the total hadronic cross-section. These effects place significant constraints on the storage times of the heavy ion beams planned for RHIC and LHC.\\\\ \\\\In this experiment we measure the cross-sections for the one- and two-neutron removal processes resulting from the interaction of 160 and 40~GeV/nucleon Pb beams on Au and Co targets. Thin Au targets were bombarded in the beam line of the NA50 experiment. Gamma rays from the residual nuclides produced in the bombardment were measured to determine the saturation activities of $^{196}$Au and $^{195}$Au resulting from ED of the Au target. This along with cross-se...

  10. Decay of hot nuclei formed with energetic antiprotons (PS208)

    CERN Document Server

    Pienkowski, L; Eades, John; Egidy, T V; Figuera, P; Fuchs, H; Galin, J; Goldenbaum, F; Golubeva, Y S; Gulda, K; Hilscher, D; Iljinov, A S; Jahnke, U; Jastrzebski, J J; Kurcewicz, W; Lott, B; Morjean, M; Pausch, G; Peghaire, A; Polster, D; Proschitzki, S; Quednau, B; Rossner, H; Schmid, S; Schmid, W; Ziem, P


    Energetic antiproton-nucleus interactions allow to build up thermal excitation energies exceeding 800 MeV in nuclei of masses close to 200. We found that for these high excitation energies the fission process still remains a very significant exit channel. At excitation energies close to 800 MeV the fission process approaches 20-50% of the cross section for Ho, Au and U-like nuclei depending on the fission events selection criteria. The average intermediate mass fragment multiplicity at such high excitation energies is equal to about 1 and alpha particle multiplicity is equal to about 5 for all three reactions independently of the exit channel, including fission. A transition towards the multifragmentation is not observed.

  11. 12 CFR 208.61 - Bank security procedures. (United States)


    ... other liquid assets, such as a vault, safe, or other secure space; (ii) A lighting system for illuminating, during the hours of darkness, the area around the vault, if the vault is visible from outside the... physical characteristics of the structure of the banking office and its surroundings. (d) Annual...

  12. A search for dynamical fluctuations in 208Pb - 208Pb collisions at 158 A GeV/c

    International Nuclear Information System (INIS)

    The study of fluctuations and correlations in heavy-ion collision experiments at relativistic high energies provide us an opportunity to study exotic phenomenon such as possibility of formation of Quark-gluon plasma (QGP). A key problem in this search is the identification of signatures of QGP formation via the study of experimental observable. Any physical quantity measured in collision experiments is subject to fluctuations. These fluctuations are believed to depend on the property of the system under study and are expected to provide some useful information about the system formed during the collision. In the context of heavy-ion collisions, a considerable advancement has been made in recent years on the event-by-event study of the fluctuation due to the availability of heavy-ion beams for wide range of energies (such as SPS, RHIC and now available LHC energies). Analysis of single events with large statistics can reveal different physics than studying averages over a large statistical sample of collision events. In order to extract new physics associated with the fluctuations, it becomes customary to understand the role of statistical fluctuations. In this search, investigation of experimental observables, like, transverse energy (Et), transverse momentum (pt), k/π ratio, electric charge, etc.

  13. May-July Temperature Variability Since 1801 Inferred from Tree Rings of Pinus tabulaeformis of Helan Mountains in China%树轮记录的贺兰山北部近208年5-7月温度变化

    Institute of Scientific and Technical Information of China (English)

    陈峰; 袁玉江; 魏文寿; 张同文; 张瑞波; 喻树龙; 范子昂; 李杨; 尚华明


    reconstructed temperature has 3 warm periods, including 1801-1812, 1940-1953, and 1994-2008. The rising of temperature series in the 2000s is the fastest and indicates that temperature in the 2000s has been warmer than any other period since 1801. The reconstructed temperature during the last 208a has significant period cycles of 120 years (95%), 8. 1 years (95%), 6.5 years (90%), 3.2 years (95%), 2.9 years (95%), and 2. 1 years (99%). Many low density values are forced by volcanic eruptions. Comparison shows volcanic eruptions have no systematic relationship with this reconstruction data, but they are correlated with the regional characteristics of the temperature and forcing data. Detailed analysis, however, suggests a cooling of several years following primarily tropical events with a volcanic eruption index (VEI). Examples include Tambora in Indonesia (1815) , Co-siguina in Nicaragua(1935), Chikurachki in Kurilels(1853), Sheveluch in Kamchatka(1854), Krakatu in Java(1883), Okataina in New Zealand(1886), Santa Maria in Guatemala(1902), Ksudach in Kamchatka (1907), Katmai in Alaska(1912), Bezymianny in Kamchatka (1956), Agung in Indonesia (1963), St Helens in US(1980), El Chichon in Mexico(1982), and Pinatubo in Philippines(199l). The mean of 28 low values after volcanic eruption in reconstructed temperature series is 26. 9℃, which is 0. 5℃ lower than the average over the 1801-2008. The earlywood density of Helan Mountains has good relations with the earlywood densities of Shimen Mountains and Changling Mountains in Gansu.

  14. Study on laser atomic spectroscopy

    International Nuclear Information System (INIS)

    Laser atomic spectroscopic study on actinium element has been performed in many areas of spectroscopy. The study on characteristic of atomic vapor has been proceeded for copper atom and the spatial density distribution of copper vapor is measured. This experimental data has been compared with the theoretically calculated data. In spectroscopic experiment, the first and second excited states for actinium element are identified and the most efficient ionization scheme for actinium element is identified. In addition, the corrosion problem for filament material due to the heating of the actinium element has been studied. (Author)

  15. Removal of actinium from europium for the determination of specific radioactivity of ultra low-level Eu-152 in a sample exposed to atomic-bomb neutrons in Nagasaki

    International Nuclear Information System (INIS)

    Measurements of specific radioactivities of residual neutron-induced radionuclides such as 152Eu and 60Co have been carried out to check the validity of a series of computer calculations employed for the atomic-bomb neutron dosimetry in Hiroshima (exposed to uranium bomb) and Nagasaki (exposed to plutonium bomb). The use of these nuclides for atomic-bomb neutron dosimetry, however, has been limited by the following difficulties: (1) today, these radionuclides are found only at extremely low concentrations in materials exposed to the atomic-bomb and (2) the neutrons that induced these radionuclides were thermal and epithermal, while the neutron dose received in Hiroshima and Nagasaki is attributable to fast neutrons. In order to overcome the first difficulty, we established a chemical procedure to extract Eu and Co from materials exposed to the atomic-bomb, and the chemical procedure has been successful for the materials exposed to atomic-bomb within 1400 m in slant distance from the explosion point. As for Nagasaki, materials exposed in the distances farther than 1200 m have never been subjected to the measurement of residual neutron-induced radionuclides. In this work, determination of specific radioactivity of 152Eu (half-life: 13.542 y) in a sample exposed to Nagasaki atomic-bomb at a distant place from the explosion point was undertaken. But, because of radioactive decay during this ∝60 years since 1945 and long distance from the explosion point, the present specific radioactivity of 152Eu in the sample is extremely low (estimated to be ∝3 x 10-4 Bq-152Eu/mg-Eu), and a serious problem is interferences from daughters of 227Ac (half-life: 21.8 y) in the measurement of ultra low-level radioactivity of 152Eu. Hence, our chemical procedure to obtain Eu-enriched counting source should be improved, and much attention is being denoted to removal of Ac from Eu. (orig.)

  16. 12 CFR 208.22 - Community development and public welfare investments. (United States)


    ... or class of entities is a public welfare investment under paragraph 23 of section 9 of the Federal Reserve Act (12 U.S.C. 338a), or a community development investment under Regulation Y (12 CFR 225.25(b)(6... standards of 13 CFR 121.802(a)(2). (b) Investments not requiring prior Board approval. Notwithstanding...

  17. Yeast Interacting Proteins Database: YLR208W, YDL195W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available complex (Sar1p, Sec13p, Sec16p, Sec23p, Sec24p, Sec31p, Sfb2p, and Sfb3p) which is important for the format...clear pore sub-complex and of the COPII complex (Sar1p, Sec13p, Sec16p, Sec23p, Sec24p, Sec31p, Sfb2p, and Sfb3p) which is important

  18. Dipole response in Pb-208 within a self-consistent multiphonon approach

    Czech Academy of Sciences Publication Activity Database

    Knapp, F.; Lo Iudice, N.; Veselý, Petr; Andreozzi, F.; De Gregorio, G.; Porrino, A.


    Roč. 92, č. 5 (2015), s. 054315. ISSN 0556-2813 R&D Projects: GA ČR GA13-07117S Grant ostatní: GA MŠk(CZ) LM2010005 Institutional support: RVO:61389005 Keywords : photoneutron * cross-section * neutron scattering Subject RIV: BE - Theoretical Physics Impact factor: 3.733, year: 2014

  19. 12 CFR Appendix D-1 to Part 208 - Interagency Guidelines Establishing Standards for Safety and Soundness (United States)


    ... agencies to establish standards relating to asset quality, earnings, and stock valuation that the agencies... capital and reserves. The institution should: 1. Compare recent earnings trends relative to equity, assets... exposure. F. Asset growth. G. Asset quality. H. Earnings. I. Compensation, fees and benefits....

  20. 8 CFR 208.12 - Reliance on information compiled by other sources. (United States)


    ... Information Act (FOIA) request pursuant to 8 CFR part 103. ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Reliance on information compiled by other... Reliance on information compiled by other sources. (a) In deciding an asylum application, or in...

  1. 44 CFR 208.40 - Reimbursement of fringe benefit costs during Activation. (United States)


    ... System Member, Bill DHS for a pro-rata share of the premium based on the number of base hours worked...-rata share of the premium based on the number of hours each System Member worked during Activation The City Fire Department pays a premium of 12 percent for retirement based on the number of hours worked...

  2. Bis(trimethylphenylammonium hexa[bromido/chlorido(0.792/0.208]stannate(IV

    Directory of Open Access Journals (Sweden)

    Kong Mun Lo


    Full Text Available In the title molecular salt, [C6H5(CH33N]2[SnBr4.75Cl1.25], the SnIV atom (site symmetry overline{1} adopts an octahedral coordination geometry. The Br and Cl atoms are disordered over three sites in 0.7415 (13:0.2585 (14, 0.8514 (14:0.1486 (14 and 0.7821 (14:0.2179 (14 ratios.

  3. 12 CFR 208.43 - Capital measures and capital category definitions. (United States)


    ... has determined, after notice and opportunity for hearing pursuant to 12 CFR 263.203, that the bank is... notice and opportunity for hearing pursuant to 12 CFR 263.203, that, in the most recent examination of... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Capital measures and capital...

  4. Isotopic Trends of Fusion Probability in Reactions with Zn Isotopes Bombarding 208Pb

    Institute of Scientific and Technical Information of China (English)

    LiWenfei; XuHushan; ZuoWei; JiaFei; LiJunqing


    where σc is the effective capture cross section for the transition of the colliding nuclei over the entrance Coulomob arrier, Wsur is the survival probability of the compound nucleus. In the DNS model, the compound nucleus is reached by a series of transfers of nuclcons from the light nucleus to the heavy one. Thc dynamics of the DNS is considered as a diffusion process in the mass asymmetry degree of freedom η=(A1 - A2)/(A1 + A2) (A1 and A2 are the mass numbers of the DNS nuclei), PCN is the complete fusion probability, here it is calculated by solving the Master equation numcrically[2]. The fusion barrier Bfus in η supplies a hindrance for fusion.

  5. 48 CFR 15.208 - Submission, modification, revision, and withdrawal of proposals. (United States)


    ..., electronic commerce, or facsimile). If no time is specified in the solicitation, the time for receipt is 4:30... not unduly delay the acquisition; and— (i) If it was transmitted through an electronic commerce...

  6. 37 CFR 41.208 - Content of substantive and responsive motions. (United States)


    ... Fees: Division of 10.37 Failure to pay 10.40 Sharing of 10.48 Legal system, assistance in improving the....36 Excluded practitioner 10.1 Giving information 10.1 Invention development services 10.23 Law firm... information 10.22, 10.23 Witnesses 10.63, 10.92 Z Zealously representing the client 10.83, 10.84 37 CFR Ch....

  7. 8 CFR 208.9 - Procedure for interview before an asylum officer. (United States)


    ... interview in English must provide, at no expense to the Service, a competent interpreter fluent in both English and the applicant's native language or any other language in which the applicant is fluent....

  8. 28 CFR 2.208 - Termination of a term of supervised release. (United States)


    ... AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS District of Columbia... is indicated if the releasee: (i) Has a salient factor score in the very good risk category and has... release violation; or (ii) Has a salient factor score in a risk category other than very good and...

  9. 11. 208 82Pb, 232 90 Th, 256 100 Fm nucleus internal structure and Parameter calculation

    Directory of Open Access Journals (Sweden)

    Huang Zhenqiang and Huang Yuxiang


    Full Text Available Pass in front of the internal structure of the nucleus, chapter 7 ~ 10 nuclear force, magnetic forming principle and parameters of calculation, we not only have "assembly" the basis of atomic nuclei, and predictable "assembly" nucleus must abide by the principle of a couple of items. At the same time also will to book model, theory of thorough and the strict proof of simulatio

  10. 7 CFR 1430.208 - Payment rate and dairy operation payment. (United States)


    ... of the USDA monthly Agricultural Prices publication (including the data and factors noted in footnote... paragraphs (b) and (c) of this section by the quantity of eligible production marketed by the operation... the maximum production limitations set in § 1430.207(b) of eligible production per applicable...

  11. 42 CFR 412.208 - Puerto Rico rates for Federal fiscal year 1988. (United States)


    ... rates for Federal fiscal year 1988. (a) General rule. CMS determines the Puerto Rico adjusted DRG... of payments based on DRG prospective payment rates that are additional payments to hospitals located.... For each discharge classified within a DRG, CMS establishes a Puerto Rico prospective payment rate,...

  12. 22 CFR 208.215 - Which nonprocurement transactions are not covered transactions? (United States)


    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not...

  13. Evaporation residues produced in spallation of 208Pb by protons at 500A MeV

    CERN Document Server

    Audouin, L; Armbruster, P; Benlliure, J; Bernas, M; Boudard, A; Casarejos, E; Czajkowski, S; Enqvist, T; Fernandez-Dominguez, B; Jurado, B; Legrain, R; Leray, S; Mustapha, B; Pereira, J; Pravikoff, M; Rejmund, F; Ricciardi, M V; Schmidt, K H; Stéphan, C; Taieb, J; Volant, C; Wlazlo, W


    The production cross sections of fragmentation-evaporation residues in the reaction Pb+p at 500A MeV have been measured using the inverse-kinematics method and the FRS spectrometer (GSI). Fragments were identified in nuclear charge using ionisation chambers. The mass identification was performed event-by-event using the B-rho - TOF - Delta-E technique. Although partially-unresolved ionic charge states induced an ambiguity on the mass of some heavy fragments, production rates could be obtained with a high accuracy by systematically accounting for the polluting ionic charge states. The contribution of multiple reactions in the target was subtracted using a new, partly self-consistent code. The isobaric distributions are found to have a shape very close to the one observed in experiments at higher energy. Kinematic properties of the fragments were also measured. The total and the isotopic cross sections, including charge-pickup cross sections, are in good agreement with previous measurements. The data are discus...

  14. Tank 241-AP-105, cores 208, 209 and 210, analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the final laboratory report for Tank 241-AP-105. Push mode core segments were removed from Risers 24 and 28 between July 2, 1997, and July 14, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-AP-105 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997) and Tank Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT), differential scanning calorimetry (DSC) analysis, or total organic carbon (TOC) analysis exceeded the notification limits as stated in TSAP and DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report. Appearance and Sample Handling Two cores, each consisting of four segments, were expected from Tank 241-AP-105. Three cores were sampled, and complete cores were not obtained. TSAP states core samples should be transported to the laboratory within three calendar days from the time each segment is removed from the tank. This requirement was not met for all cores. Attachment 1 illustrates subsamples generated in the laboratory for analysis and identifies their sources. This reference also relates tank farm identification numbers to their corresponding 222-S Laboratory sample numbers

  15. 12 CFR 208.82 - Definitions for purposes of this subpart. (United States)


    ... individuals living on the effective date of the trust). It does not include any corporation the majority of..., solicitation, advertisement, or offer of any insurance product or annuity is by or on behalf of the bank;...

  16. 33 CFR 208.27 - Fort Cobb Dam and Reservoir, Pond (Cobb) Creek, Oklahoma. (United States)


    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Fort Cobb Dam and Reservoir, Pond..., Pond (Cobb) Creek, Oklahoma. The Bureau of Reclamation shall operate the Fort Cobb Dam and Reservoir in... inflow below the dam, will not produce flows in excess of bankfull on Pond (Cobb) Creek downstream of...

  17. Yeast Interacting Proteins Database: YGL115W, YGL208W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available rature on bait (YPD) 55 Literature on prey (YPD) 20 Literature shared by bait and prey 10 Literature...membrane Rows with this prey as prey Rows with this prey as prey (1) Rows with this prey as bait Rows with this prey as bait (0) Lite

  18. 45 CFR 680.20 - Exemptions under 18 U.S.C. 208(b). (United States)


    ... Government: (1) Noncorporate bonds; (2) Shares in a well-diversified money market or mutual fund; (3) Stocks... aggregate market value of all the securities you hold in that corporation does not exceed $1,000; (4)...

  19. 5 CFR 2417.208 - Restrictions that apply to released records. (United States)


    ... COUNSEL OF THE FEDERAL LABOR RELATIONS AUTHORITY AND FEDERAL SERVICE IMPASSES PANEL GENERAL PROVISIONS... proceeding obtain a protective order or execute a confidentiality agreement to limit access and any further disclosure. The terms of the protective order or of a confidentiality agreement must be acceptable to...

  20. Shelf Edge Exchange Processes, II: SEEP2-08, R/V ENDEAVOR cruise 188

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, C.; Behrens, W.J.; Flagg, C.N.; Wallace, D.W.R.; Wilke, R.J.; Wyman, K.D.


    The Shelf Edge Exchange Processes (SEEP) program sponsored by the United States Department of Energy is a multi-institutional effort designed to investigate the flux of suspended material from the continental shelf to the waters of the upper slope, and then possibly into the slope sediments. Phase I of SEEP consisted of a series of nine cruises and a mooring array across the outer continental shelf of New England during 1983--1984 (Behrens and Flagg, 1986). Phase II focused specifically on the shelf/slope frontal region of the mid-Atlantic bight off the Delmarva Peninsula. This project consisted of a series of ten cruises, a mooring array, and a series of over-flights by NASA aircraft. Hydrographic data were collected on eight of the cruises, six of which were primarily mooring deployment or recovery cruises. The cruises were consecutively designated SEEP2-01 to SEEP2-10. Two cruises (SEEP2-04 and SEEP2-07) were dedicated to investigating benthic processes and hydrographic data were not collected.