WorldWideScience

Sample records for actinium 208

  1. Actinium

    International Nuclear Information System (INIS)

    Keller, C.

    1977-01-01

    There are only very few investigations dealing with the chemical and physical properties of actinium, the lanthanum homologue in the actinide series, 227 Ac, the only long-lived isotope can be produced in gram amounts only by neutron irradiation of 226 Ra, the amounts occurring in nature are too low for isolation (about 1 μg 227 Ac/1 uranium ore). Experimental work with 227 Ac gives rise to a lot of problems due to the radiation characteristics of the 227 Ac daughter nuclides. Therefore, the metal and the only ten solid compounds, prepared up to now, have been isolated in the microgram scale. Due to the high specific activity of 227 Ac, the preparation of a lot of compounds, e.g. metal-organic compounds seems to be very difficult, if not impossible. The properties of actinium in aqueous solutions have been deduced from experiments in the tracer scale only. The present investigations on actinium show that only the oxidation state + 3 exists - only radiopolarographic studies indicate the possibility of a lower valancy state (Ac 2+ ). - This review will give a critical and comprehensive description on the present knowledge about this element. The presently decreasing interest in the development of thermionic batteries using 227 Ac 2 O 3 radionuclide also implies that there will be only small progress in the chemistry of this radio-element in the near future. (orig.) [de

  2. The sorption of polonium, actinium and protactinium onto geological materials

    International Nuclear Information System (INIS)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.

    1999-01-01

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  3. The sorption of polonium, actinium and protactinium onto geological materials

    Energy Technology Data Exchange (ETDEWEB)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.

    1999-07-01

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.

  4. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    Martinez-Tarango, S.

    1991-01-01

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  5. Application of partition chromatography method for separation and analysis of actinium radionuclides

    International Nuclear Information System (INIS)

    Sinitsina, G.S.; Shestakova, I.A.; Shestakov, B.I.; Plyushcheva, N.A.; Malyshev, N.A.; Belyatskij, A.F.; Tsirlin, V.A.

    1979-01-01

    The method of partition chromatography is considered with the use of different extractants for the extraction of actinium-227, actinium-225 and actinium-228. It is advisable to extract actinium-227 from the irradiated radium with the help of D2FGFK. The use of 2DEGFK allows us to separate actinium-227 from alkaline and alkaline-earth elements. Amines have a higher radiative stability. An express-method has been developed for the identification of actinium-227 with TOA by its intrinsic α-emission in nonequilibrium preparations of irradiated radium-226 of small activity. Actinium-225 is extracted from uranium-233 with due regard for the fact that U, Th, and Ac are extracted differently by TBP from HNO 3 solutions. With the help of the given procedure one can reach the purifying coefficient of 10 4 . Actinium-228 is extracted from the radiummesothorium preparations by a deposition of decay products, including polonium-210 on the iron hydroxyde. Actinium-228 extraction from the mixture of radium radionuclides is performed by the partition chromatography method on D2EGFK. All the procedures for separation of actinium isotopes by the above methods are described

  6. Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target

    Science.gov (United States)

    Fassbender, Michael E.; Radchenko, Valery

    2018-04-24

    Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.

  7. Separation of actinium-227 from its daughter products by cationic resins technique

    International Nuclear Information System (INIS)

    Nastasi, M.J.C.

    1976-01-01

    A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt

  8. Short history of radioactivity. No. XIII. The actinium and thorium series

    Energy Technology Data Exchange (ETDEWEB)

    Chalmers, T W

    1950-06-16

    Discussions of the actinium disintegration series (about 1905), the /sup 235/U or actinium series (as it is accepted today), the disintegration of thorium (about 1905), the thorium series in the modern form, and the 4n, 4n + 1, 4n + 2, and 4n + 3 series are presented.

  9. Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer

    International Nuclear Information System (INIS)

    Scheinberg, D.

    2013-01-01

    Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection

  10. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  11. Amides with nitrogenous heterocyclic substituent, their manufacturing process and their use to draw out selectively Actinium series (III) and to separate them in particular from Lanthanides (III)

    International Nuclear Information System (INIS)

    Cuillerdier, C.; Musikas, C.

    1993-01-01

    Present invention is concerned with new amides with nitrogenous heterocyclic substituent utilizable to separate trivalent actinium series from trivalent lanthanides. In these molecules, it is possible to obtain particularly covalent liaison which has more affinity with 5f series, that is to say actinium series; included a manufacturing process for these amides with nitrogenous heterocyclic substituent

  12. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    International Nuclear Information System (INIS)

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  13. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    International Nuclear Information System (INIS)

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.

    2016-01-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  15. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  16. 7 CFR 330.208 - Courtesy permits.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Courtesy permits. 330.208 Section 330.208 Agriculture... PRODUCTS; GARBAGE Movement of Plant Pests § 330.208 Courtesy permits. The Deputy Administrator may issue... subject to regulation under the Plant Protection Actor any other act, as a courtesy to facilitate movement...

  17. 15 CFR 280.208 - Default.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Default. 280.208 Section 280.208... Enforcement § 280.208 Default. (a) General. Failure of the respondent to file an answer within the time...) Petition to set aside default—(1) Procedure. Upon petition filed by a respondent against whom a default...

  18. 42 CFR 460.208 - Financial statements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Financial statements. 460.208 Section 460.208... ELDERLY (PACE) Data Collection, Record Maintenance, and Reporting § 460.208 Financial statements. (a... must submit a certified financial statement that includes appropriate footnotes. (2) The financial...

  19. 23 CFR 633.208 - Maintenance.

    Science.gov (United States)

    2010-04-01

    ... responsibility of the State. The State may arrange for maintenance of such roads or portions thereof, by... 23 Highways 1 2010-04-01 2010-04-01 false Maintenance. 633.208 Section 633.208 Highways FEDERAL... PROVISIONS Federal-Aid Contracts (Appalachian Contracts) § 633.208 Maintenance. Maintenance of all highway...

  20. 22 CFR 208.920 - Civil judgment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Civil judgment. 208.920 Section 208.920 Foreign...) Definitions § 208.920 Civil judgment. Civil judgment means the disposition of a civil action by any court of... creates a civil liability for the complained of wrongful acts, or a final determination of liability under...

  1. 24 CFR 208.112 - Cost.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cost. 208.112 Section 208.112... MULTIFAMILY SUBSIDIZED PROJECTS § 208.112 Cost. (a) The costs of the electronic transmission of the correctly... cost of contracting for those services, or the cost of centralizing the electronic transmission...

  2. 30 CFR 90.208 - Bimonthly sampling.

    Science.gov (United States)

    2010-07-01

    ... MANDATORY HEALTH STANDARDS-COAL MINERS WHO HAVE EVIDENCE OF THE DEVELOPMENT OF PNEUMOCONIOSIS Sampling Procedures § 90.208 Bimonthly sampling. (a) Each operator shall take one valid respirable dust sample for... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Bimonthly sampling. 90.208 Section 90.208...

  3. 22 CFR 208.1005 - State.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false State. 208.1005 Section 208.1005 Foreign...) Definitions § 208.1005 State. (a) State means— (1) Any of the states of the United States; (2) The District of Columbia; (3) The Commonwealth of Puerto Rico; (4) Any territory or possession of the United States; or (5...

  4. 28 CFR 16.208 - Annual report.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Annual report. 16.208 Section 16.208 Judicial Administration DEPARTMENT OF JUSTICE PRODUCTION OR DISCLOSURE OF MATERIAL OR INFORMATION Public Observation of Parole Commission Meetings § 16.208 Annual report. The Commission shall report annually to...

  5. 29 CFR 2200.208 - Discovery.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Discovery. 2200.208 Section 2200.208 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH REVIEW COMMISSION RULES OF PROCEDURE Simplified Proceedings § 2200.208 Discovery. Discovery, including requests for admissions, will only be...

  6. 31 CFR 208.9 - Compliance.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Compliance. 208.9 Section 208.9 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY DISBURSEMENTS § 208.9...

  7. 31 CFR 208.4 - Waivers.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Waivers. 208.4 Section 208.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY DISBURSEMENTS § 208.4...

  8. 31 CFR 208.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Definitions. 208.2 Section 208.2 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY DISBURSEMENTS § 208.2...

  9. 22 CFR 208.995 - Principal.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Principal. 208.995 Section 208.995 Foreign...) Definitions § 208.995 Principal. Principal means— (a) An officer, director, owner, partner, principal investigator, or other person within a participant with management or supervisory responsibilities related to a...

  10. Compton scattering on 208Pb

    International Nuclear Information System (INIS)

    Alberico, W.M.; Molinari, A.

    1982-01-01

    In this paper we briefly review the formalism of the nuclear Compton scattering in the frame of the low-energy theorems (LET). We treat the resonant terms of the amplitude, having collective intermediate nuclear states, as a superposition of Lorentz lines with energy, width and strength fixed by the photo-absorption experiments. The gauge terms are evaluated starting from a simple, but realistic, nuclear Hamiltonian. Dynamical nucleon-nucleon correlations are consistently taken into account, beyond those imposed by the Pauli principle. The comparison of the theoretical predictions with the data of elastic diffusion of photons from 208 Pb shows that LET are insufficient to account for the experiment. (orig.)

  11. 7 CFR 1280.208 - Compensation.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Compensation. 1280.208 Section 1280.208 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... INFORMATION ORDER Lamb Promotion, Research, and Information Order Lamb Promotion, Research, and Information...

  12. 31 CFR 800.208 - Critical infrastructure.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Critical infrastructure. 800.208 Section 800.208 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE... infrastructure means, in the context of a particular covered transaction, a system or asset, whether physical or...

  13. 48 CFR 208.7401 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE ACQUISITION PLANNING REQUIRED SOURCES OF SUPPLIES AND SERVICES Enterprise Software Agreements 208.7401 Definitions. As used in this subpart— Enterprise software agreement means an agreement or... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Definitions. 208.7401...

  14. 31 CFR 545.208 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Exempt transactions. 545.208 Section 545.208 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... assist in the creation of information or informational materials; and, with respect to information or...

  15. 44 CFR 208.52 - Reimbursement procedures.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Reimbursement procedures. 208... Reimbursement Claims and Appeals § 208.52 Reimbursement procedures. (a) General. A Sponsoring Agency must present a claim for reimbursement to DHS in such manner as the Assistant Administrator specifies . (b...

  16. 40 CFR 86.208-94 - Dynamometer.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Dynamometer. 86.208-94 Section 86.208-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

  17. 31 CFR 208.8 - Recipient responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Recipient responsibilities. 208.8 Section 208.8 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  18. 31 CFR 208.7 - Agency responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Agency responsibilities. 208.7 Section 208.7 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  19. 42 CFR 93.208 - Evidence.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Evidence. 93.208 Section 93.208 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

  20. 48 CFR 952.208-70 - Printing.

    Science.gov (United States)

    2010-10-01

    ... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.208-70 Printing. As prescribed... reproduction in excess of the limits set forth above, the Contractor shall notify the Contracting Officer in...

  1. Dicty_cDB: SLH208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH208 (Link to dictyBase) - - - Contig-U10711-1 SLH208P (Link to Original site) SLH2...08F 517 SLH208Z 692 SLH208P 1209 - - Show SLH208 Library SL (Link to library) Clone ID SLH2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH208Q.Seq.d/ Representative seq. ID SLH2...08P (Link to Original site) Representative DNA sequence >SLH208 (SLH208Q) /CSM/SL/SLH2-A/SLH2...wfr*fpfkimei*llnnstsltlpppplsiihil*lql*ye Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH2

  2. 40 CFR 92.208 - Certification.

    Science.gov (United States)

    2010-07-01

    ... the construction of a locomotive or locomotive engine, where such step may reasonably be expected to... POLLUTION FROM LOCOMOTIVES AND LOCOMOTIVE ENGINES Certification Provisions § 92.208 Certification. (a) This paragraph (a) applies to manufacturers of new locomotives and new locomotive engines. If, after a review of...

  3. 48 CFR 871.208 - Rehabilitation facilities.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Rehabilitation facilities... Vocational Rehabilitation and Employment Service 871.208 Rehabilitation facilities. Charges by rehabilitation facilities for the rehabilitation services provided under 38 U.S.C. Chapter 31 are paid in the same manner as...

  4. 27 CFR 46.208 - Unmerchantable articles.

    Science.gov (United States)

    2010-04-01

    ... Tubes Held for Sale on April 1, 2009 Inventories § 46.208 Unmerchantable articles. Articles that the... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Unmerchantable articles.... However, the dealer must segregate any such unmerchantable articles and include them in a separate section...

  5. The analog resonance of 208Pb

    International Nuclear Information System (INIS)

    Brinati, J.R.; Bund, G.W.

    1973-01-01

    Elastic and inelastic partial proton widths and Coulomb displacement energies for the IAR of the Ground State of 208 Pb are calculated in the Blair-Bund model. Exchange terms are included and different optical potentials are considered. Comparison with the experimental widths is made taking into account the off-resonance cross sections predicted by the optical potentials [pt

  6. 12 CFR 208.4 - Capital adequacy.

    Science.gov (United States)

    2010-01-01

    ... Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM MEMBERSHIP OF STATE BANKING INSTITUTIONS IN THE FEDERAL RESERVE SYSTEM (REGULATION H) General Membership and Branching Requirements § 208.4 Capital adequacy. (a) Adequacy. A member bank's capital, as defined in appendix A to this...

  7. 12 CFR 208.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM MEMBERSHIP OF STATE BANKING INSTITUTIONS IN THE FEDERAL RESERVE SYSTEM (REGULATION H) General Membership and Branching Requirements § 208.2 Definitions. For the purposes of this part: (a) Board of Directors means the governing...

  8. 30 CFR 75.208 - Warning devices.

    Science.gov (United States)

    2010-07-01

    ... Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE SAFETY AND HEALTH MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Roof Support § 75.208 Warning devices. Except during the..., or a physical barrier shall be installed to impede travel beyond permanent support. ...

  9. 22 CFR 208.505 - Who uses the EPLS?

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Who uses the EPLS? 208.505 Section 208.505 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND SUSPENSION... available to the general public. ...

  10. Nuclear polarization in muonic 208Pb

    International Nuclear Information System (INIS)

    Haga, Akihiro; Tanaka, Yasutoshi; Horikawa, Yataro

    2002-01-01

    We calculate nuclear-polarization energy shifts in muonic 208 Pb. We employ a relativistic field-theoretical calculation and evaluate the ladder, cross, and seagull terms of the two-photon exchange diagrams in both the Feynman and Coulomb gauges. Gauge independence is very well satisfied with the calculated nuclear-polarization energies. Using these results, we analyze fine-structure splitting energies of muonic 208 Pb because of the presence of the persisting discrepancies between experiment and calculation. The present nuclear-polarization energies explain about half of the anomaly in the Δ2p fine-structure splitting energy, and only one-fourth of the anomaly in the Δ3p fine-structure splitting energy

  11. 49 CFR 195.208 - Welding of supports and braces.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding of supports and braces. 195.208 Section 195.208 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS... HAZARDOUS LIQUIDS BY PIPELINE Construction § 195.208 Welding of supports and braces. Supports or braces may...

  12. 9 CFR 113.208 - Avian Encephalomyelitis Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ..., Killed Virus. 113.208 Section 113.208 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.208 Avian Encephalomyelitis Vaccine, Killed Virus. Avian...

  13. 44 CFR 208.26 - Accountability for use of funds.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Accountability for use of funds. 208.26 Section 208.26 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY... Preparedness Cooperative Agreements § 208.26 Accountability for use of funds. The Sponsoring Agency is...

  14. 46 CFR 185.208 - Accidents to machinery.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Accidents to machinery. 185.208 Section 185.208 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) OPERATIONS Marine Casualties and Voyage Records § 185.208 Accidents to machinery. The owner, managing...

  15. 46 CFR 122.208 - Accidents to machinery.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Accidents to machinery. 122.208 Section 122.208 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS CARRYING MORE THAN 150... Voyage Records § 122.208 Accidents to machinery. The owner, managing operator, or master shall report...

  16. 33 CFR 110.208 - Buffalo Harbor, N.Y.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo Harbor, N.Y. 110.208 Section 110.208 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.208 Buffalo Harbor, N.Y. (a) The anchorage grounds—(1...

  17. 44 CFR 208.42 - Reimbursement for other administrative costs.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Reimbursement for other administrative costs. 208.42 Section 208.42 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT... SYSTEM Response Cooperative Agreements § 208.42 Reimbursement for other administrative costs. Costs...

  18. 44 CFR 208.35 - Reimbursement for Advisory.

    Science.gov (United States)

    2010-10-01

    ... Cooperative Agreements § 208.35 Reimbursement for Advisory. DHS will not reimburse costs incurred during an... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Reimbursement for Advisory. 208.35 Section 208.35 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY...

  19. 42 CFR 50.208 - Program or project requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Program or project requirements. 50.208 Section 50.208 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS POLICIES OF GENERAL APPLICABILITY Sterilization of Persons in Federally Assisted Family Planning Projects § 50.208...

  20. 12 CFR 208.60 - Authority, purpose, and scope.

    Science.gov (United States)

    2010-01-01

    ... 208.60 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM MEMBERSHIP OF STATE BANKING INSTITUTIONS IN THE FEDERAL RESERVE SYSTEM (REGULATION H) Miscellaneous Requirements § 208.60 Authority, purpose, and scope. (a) Authority. Subpart F of Regulation H (12 CFR part 208...

  1. 31 CFR 208.1 - Scope and application.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Scope and application. 208.1 Section 208.1 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY DISBURSEMENTS § 208.1...

  2. 30 CFR 208.8 - Transportation and delivery.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Transportation and delivery. 208.8 Section 208... MANAGEMENT SALE OF FEDERAL ROYALTY OIL General Provisions § 208.8 Transportation and delivery. (a) The lessee... delivery point at no additional cost to the purchaser or the Government. The purchaser must have physical...

  3. Measurement of conversion coefficients in 208Tl

    International Nuclear Information System (INIS)

    Wendling, F.

    1976-06-01

    A electron spectrometer composed by a Li drifted Si detector and a uniform magnetic field was constructed. The magnetic field is used to focus the electrons on the detector and to filter the other radiations. After the construction the instrument was calibrated in absolute eficience and was used together with a Ge(Li) spectrometer also calibrated, in the measurement of internal conversion coeficients of the 433 and 453 keV transitions in 208 Tl [pt

  4. Radiogenic lead-208 abundance 88.34 %

    International Nuclear Information System (INIS)

    Seneda, Jose A.; Abrao, Alcidio; Dias, Mauro S.; Kakazu, Mauricio H.; Salvador, Vera L.R.; Queiroz, Carlos A.S.; Rocha, Soraya M.R. da; Sato, Key

    2009-01-01

    Brazil has a long tradition in thorium technology, from the monazite ores mining until the production of the nuclear grade thorium compounds. Early in 1969 the Institute of Energy and Nuclear Research (IPEN) designed a project for a pilot plant installation to purify the thorium compounds, based on the solvent extraction technique. Thorium compounds used came from monazite's industrialization. During the course of the operation of this plant, a crude sludge were formed containing thorium not extracted and the whole rare earths, plus minor impurities like sodium, titanium, zirconium, hafnium, iron, silicon, phosphate and the thorium daughters were accumulated. Included is the radiogenic lead-208. This sludge, hereafter named 'RETOTER', was treated with hydrochloric acid and the lead was separated and recovered by anion exchange technology. The lead-208 was analyzed by mass spectrometry (HR-ICPMS) technique. The lead-208 abundance measure was 88.34%, this allowed the calculation of the thermal neutron capture cross section of σ 0 γ = 14,6 +/- 0.7 mb, considerably lower than the σ 0 γ = 174.2 +/- 0.7 mb value of the natural lead. (author)

  5. Leucine 208 in human histamine N-methyltransferase emerges as a hotspot for protein stability rationalizing the role of the L208P variant in intellectual disability.

    Science.gov (United States)

    Tongsook, Chanakan; Niederhauser, Johannes; Kronegger, Elena; Straganz, Grit; Macheroux, Peter

    2017-01-01

    The degradation of histamine catalyzed by the SAM-dependent histamine N-methyltransferase (HNMT) is critically important for the maintenance of neurological processes. Recently, two mutations in the encoding human gene were reported to give rise to dysfunctional protein variants (G60D and L208P) leading to intellectual disability. In the present study, we have expressed eight L208 variants with either apolar (L208F and L208V), polar (L208N and L208T) or charged (L208D, L208H, L208K and L208R) amino acids to define the impact of side chain variations on protein structure and function. We found that the variants L208N, L208T, L208D and L208H were severely compromised in their stability. The other four variants were obtained in lower amounts in the order wild-type HNMT>L208F=L208V>L208K=L208R. Biochemical characterization of the two variants L208F and L208V exhibited similar Michaelis-Menten parameters for SAM and histamine while the enzymatic activity was reduced to 21% and 48%, respectively. A substantial loss of enzymatic activity and binding affinity for histamine was seen for the L208K and L208R variants. Similarly the thermal stability for the latter variants was reduced by 8 and 13°C, respectively. These findings demonstrate that position 208 is extremely sensitive to side chain variations and even conservative replacements affect enzymatic function. Molecular dynamics simulations showed that amino acid replacements in position 208 perturb the helical character and disrupt interactions with the adjacent β-strand, which is involved in the binding and correct positioning of histamine. This finding rationalizes the gradual loss of enzymatic activity observed in the L208 variants. Copyright © 2016 The Author(s). Published by Elsevier B.V. All rights reserved.

  6. Dicty_cDB: CHN208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHN208 (Link to dictyBase) - - - Contig-U11696-1 - (Link to Or...iginal site) CHN208F 157 - - - - - - Show CHN208 Library CH (Link to library) Clone ID CHN208 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11696-1 Original site URL http://dictycdb.b...ces producing significant alignments: (bits) Value N AC149612 |AC149612.1 Ictalurus punctatus clone CH212-98...nuclear 20.0 %: mitochondrial 8.0 %: vacuolar 4.0 %: peroxisomal >> prediction fo

  7. 30 CFR 208.14 - Civil and criminal penalties.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Civil and criminal penalties. 208.14 Section... MANAGEMENT SALE OF FEDERAL ROYALTY OIL General Provisions § 208.14 Civil and criminal penalties. Failure to abide by the regulations in this part may result in civil and criminal penalties being levied on that...

  8. 12 CFR 208.51 - Real estate lending standards.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Real estate lending standards. 208.51 Section... MEMBERSHIP OF STATE BANKING INSTITUTIONS IN THE FEDERAL RESERVE SYSTEM (REGULATION H) Real Estate Lending and Appraisal Standards § 208.51 Real estate lending standards. (a) Adoption of written policies. Each state...

  9. 7 CFR 400.208 - Term of the contract.

    Science.gov (United States)

    2010-01-01

    ... writing to the other party that the contract is not to be renewed. Any breach of the contract, or failure... 7 Agriculture 6 2010-01-01 2010-01-01 false Term of the contract. 400.208 Section 400.208..., DEPARTMENT OF AGRICULTURE GENERAL ADMINISTRATIVE REGULATIONS Agency Sales and Service Contract-Standards for...

  10. 22 CFR 208.100 - What does this part do?

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false What does this part do? 208.100 Section 208.100 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND SUSPENSION...., p. 235) and 31 U.S.C. 6101 note (Section 2455, Public Law 103-355, 108 Stat. 3327). ...

  11. 22 CFR 1203.735-208 - Misuse of information.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Misuse of information. 1203.735-208 Section 1203.735-208 Foreign Relations UNITED STATES INTERNATIONAL DEVELOPMENT COOPERATION AGENCY EMPLOYEE... or in connection with Government employment which has not been made available to the general public. ...

  12. 22 CFR 208.50 - How is this part written?

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false How is this part written? 208.50 Section 208.50 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND SUSPENSION... for the general public and business community to use. The section headings and text, often in the form...

  13. 48 CFR 33.208 - Interest on claims.

    Science.gov (United States)

    2010-10-01

    ... otherwise would be due, if that date is later, until the date of payment. (b) Simple interest on claims... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Interest on claims. 33.208... REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 33.208 Interest on claims. (a) The Government...

  14. 48 CFR 5152.208-9001 - Industrial preparedness planning.

    Science.gov (United States)

    2010-10-01

    ... planning. 5152.208-9001 Section 5152.208-9001 Federal Acquisition Regulations System DEPARTMENT OF THE ARMY... planning. As prescribed at 5108-070(g)(4) insert the following clause in full text in contracts where the contractor is designated a Limited Fee Planned Producer. Industrial Preparedness Planning (XXX 1989) (DEV) (a...

  15. 47 CFR 25.208 - Power flux density limits.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Power flux density limits. 25.208 Section 25.208 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE... emissions from all co-frequency space stations of a single non-geostationary-satellite orbit (NGSO) system...

  16. Polarization of photoneutrons from the threshold region of 208Pb

    International Nuclear Information System (INIS)

    Holt, R.J.; Jackson, H.E.

    1975-01-01

    In order to determine the parities of several resonances in 208 Pb, the polarization of photoneutrons from the 208 Pb(γ,n(pol)) 207 Pb reaction was measured. This represents the first measurement of the polarization of photoneutrons from resonances near threshold. The observations are tabulated. (SDF)

  17. 7 CFR 1160.208 - Powers of the Board.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Powers of the Board. 1160.208 Section 1160.208 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing... of deposit of a bank that is a member of the Federal Reserve System, or in obligations fully...

  18. 12 CFR 208.30 - Authority, purpose, and scope.

    Science.gov (United States)

    2010-01-01

    ...). (b) Purpose and scope. This subpart C describes the requirements imposed upon member banks acting as... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Authority, purpose, and scope. 208.30 Section 208.30 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM...

  19. 27 CFR 555.208 - Construction of type 2 magazines.

    Science.gov (United States)

    2010-04-01

    ... magazines. 555.208 Section 555.208 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO... Construction of type 2 magazines. A type 2 magazine is a box, trailer, semitrailer, or other mobile facility. (a) Outdoor magazines—(1) General. Outdoor magazines are to be bullet-resistant, fire-resistant...

  20. 44 CFR 208.45 - Advance of funds.

    Science.gov (United States)

    2010-10-01

    ... Agreements § 208.45 Advance of funds. At the time of Activation of a Task Force, the Task Force will develop... advance of funds will not include any costs for equipment purchase. ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Advance of funds. 208.45...

  1. 31 CFR 208.5 - Availability of the ETA SM.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Availability of the ETA SM. 208.5 Section 208.5 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  2. 31 CFR 208.10 - Reservation of rights.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Reservation of rights. 208.10 Section 208.10 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  3. 31 CFR 208.3 - Payment by electronic funds transfer.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Payment by electronic funds transfer. 208.3 Section 208.3 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  4. 31 CFR 208.6 - General account requirements.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false General account requirements. 208.6 Section 208.6 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  5. 31 CFR 208.11 - Accounts for disaster victims.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Accounts for disaster victims. 208.11 Section 208.11 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  6. 12 CFR 208.37 - Government securities sales practices.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Government securities sales practices. 208.37... Securities-Related Activities § 208.37 Government securities sales practices. (a) Scope. This subpart is... dealer. (d) Recommendations to customers. In recommending to a customer the purchase, sale or exchange of...

  7. Thermal modified Thomas-Fermi approximation with the Skyrme interaction for the 208Pb + 208Pb system

    International Nuclear Information System (INIS)

    Mansour, H.M.M.; Ismail, M.; Osman, M.; Ramadan, Kh.A.

    1988-01-01

    A generalization of the modified Thomas-Fermi (MTF) approximation to finite temperatures is used to calculate the optical potential for the 208 Pb + 208 Pb system using the energy density formalism derived from different effective forces of Skyrme type. The nuclear optical potential becomes more attractive when the temperature is increased. Pockets are also predicted in the total potential (Nuclear + Coulomb) wich depths are dependent on both the type of effective force and the temperature. 23 refs., 7 figs. (author)

  8. 25 CFR 39.208 - How are ISEP funds distributed?

    Science.gov (United States)

    2010-04-01

    ... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR EDUCATION THE INDIAN SCHOOL EQUALIZATION PROGRAM Administrative Procedures, Student Counts, and Verifications § 39.208 How are ISEP funds distributed? (a) On July 1, schools will receive 80 percent of their funds as determined in § 39.207. (b) On...

  9. 5 CFR 734.208 - Participation in fundraising.

    Science.gov (United States)

    2010-01-01

    ... Section 734.208 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE... allotments to political action committees. (d) An employee who is covered under this subpart and is a payroll... apply, e.g., the Federal Property Management Regulations in 41 CFR chapter 101. Further, Federal...

  10. Structure of the giant dipole resonance in 208Pb

    International Nuclear Information System (INIS)

    El Naggar, N.M.

    1977-01-01

    A new scheme is devised to study the giant resonance in the heavy magic nucleus 208 Pb. The effect of the 4 + and 5 - collective excitations of the nucleus core is demonstrated. The calculated cross section is compared with the experimental data. (author)

  11. 12 CFR 208.6 - Establishment and maintenance of branches.

    Science.gov (United States)

    2010-01-01

    ... management; (2) Capital. The adequacy of the bank's capital in accordance with § 208.4, and its future... (iii) The application or the notice required under paragraph (a)(3) of this section, raises significant... involves individual complaints, or raises frivolous, previously considered, or wholly unsubstantiated...

  12. 9 CFR 93.208 - Articles accompanying poultry.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Articles accompanying poultry. 93.208... AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS; REQUIREMENTS...

  13. 27 CFR 9.208 - Snake River Valley.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Snake River Valley. 9.208... Snake River Valley. (a) Name. The name of the viticultural area described in this section is “Snake River Valley”. For purposes of part 4 of this chapter, “Snake River Valley” is a term of viticultural...

  14. 12 CFR 208.101 - Obligations concerning institutional customers.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Obligations concerning institutional customers...) Interpretations § 208.101 Obligations concerning institutional customers. (a) As a result of broadened authority... on their suitability obligations when making recommendations to institutional customers. (b) The...

  15. 44 CFR 208.36 - Reimbursement for Alert.

    Science.gov (United States)

    2010-10-01

    ... § 208.41 of this part. (4) Food and beverages for Task Force Members and Support Specialists when DHS does not provide meals during the Alert. DHS will limit food and beverage reimbursement to the amount... where such food and beverages were provided, multiplied by the number of personnel who received them. (b...

  16. 48 CFR 12.208 - Contract quality assurance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contract quality assurance... Items 12.208 Contract quality assurance. Contracts for commercial items shall rely on contractors' existing quality assurance systems as a substitute for Government inspection and testing before tender for...

  17. 23 CFR 450.208 - Coordination of planning process activities.

    Science.gov (United States)

    2010-04-01

    ... process. (h) The statewide transportation planning process should be consistent with the Strategic Highway... 23 Highways 1 2010-04-01 2010-04-01 false Coordination of planning process activities. 450.208... Coordination of planning process activities. (a) In carrying out the statewide transportation planning process...

  18. 48 CFR 2452.208-71 - Reproduction of reports.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Reproduction of reports... 2452.208-71 Reproduction of reports. As prescribed in 2437.110(b), insert the following clause in... other written materials. Reproduction of Reports (APR 1984) In accordance with Title I of the Government...

  19. 30 CFR 71.208 - Bimonthly sampling; designated work positions.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Bimonthly sampling; designated work positions... UNDERGROUND COAL MINES Sampling Procedures § 71.208 Bimonthly sampling; designated work positions. (a) Each... standard when quartz is present), respirable dust sampling of designated work positions shall begin on the...

  20. 44 CFR 208.44 - Reimbursement for other costs.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Reimbursement for other costs... Cooperative Agreements § 208.44 Reimbursement for other costs. (a) Except as allowed under paragraph (b) of this section, DHS will not reimburse other costs incurred preceding, during or upon the conclusion of...

  1. 42 CFR 438.208 - Coordination and continuity of care.

    Science.gov (United States)

    2010-10-01

    ... Improvement Access Standards § 438.208 Coordination and continuity of care. (a) Basic requirement—(1) General... MCO must meet the primary care coordination, identification, assessment, and treatment planning... those activities. (4) Ensure that in the process of coordinating care, each enrollee's privacy is...

  2. 12 CFR 208.64 - Frequency of examination.

    Science.gov (United States)

    2010-01-01

    ... Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM MEMBERSHIP OF STATE BANKING INSTITUTIONS IN THE FEDERAL RESERVE SYSTEM (REGULATION H) Miscellaneous Requirements § 208.64 Frequency of examination. (a) General. The Federal Reserve examines insured member banks pursuant...

  3. 20 CFR 725.208 - Determination of relationship; child.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of relationship; child. 725.208... Determination of relationship; child. As used in this section, the term “beneficiary” means only a surviving... considered to be the child of a beneficiary if: (a) The courts of the State in which the beneficiary is...

  4. The direct neutron decay of giant resonances in 208Pb

    International Nuclear Information System (INIS)

    Bracco, A.

    1988-01-01

    The neutron decay of the giant multipole resonance region from 9 to 15 MeV of excitation energy in 208 Pb has been studied. Neutron branching ratios for the decay to the ground state and to the low-lying excited states of 207 Pb were measured as a function of the excitation energy of 208 Pb and compared to Hauser-Feshbach calculations. While the neutron branching ratios from the energy region of the isoscalar giant quadrupole resonance are reproduced by the calculations, the ratios from the energy region of the isoscalar giant monopole resonance show a conspicuous excess with respect to the statistical model predictions. The neutron yield from this energy region was analysed in terms of a multistep model of the compound nucleus which includes collective doorway channels. The total direct escape width as well as the associated direct partial escape widths to the lowest five valence hole states of 207 Pb were determined. (orig.)

  5. 34 CFR 682.208 - Due diligence in servicing a loan.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Due diligence in servicing a loan. 682.208 Section 682.208 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF... § 682.208 Due diligence in servicing a loan. (a) The loan servicing process includes reporting to...

  6. 22 CFR 208.600 - How do suspension and debarment actions start?

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false How do suspension and debarment actions start? 208.600 Section 208.600 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE... § 208.600 How do suspension and debarment actions start? When we receive information from any source...

  7. 31 CFR 515.208 - Restrictions on loans, credits and other financing.

    Science.gov (United States)

    2010-07-01

    ... other financing. 515.208 Section 515.208 Money and Finance: Treasury Regulations Relating to Money and... REGULATIONS Prohibitions § 515.208 Restrictions on loans, credits and other financing. No United States... provide other financing for the purpose of financing transactions involving confiscated property the claim...

  8. Statistical decay of giant monopole resonance in 208Pb

    International Nuclear Information System (INIS)

    Dias, H.; Wolynec, E.

    1984-01-01

    The neutron spectrum from the decay of the monopole giant resonance in 208 Pb is calculated using the known energy levels of 207 Pb. The particle vibrator model is used to assign spins parities to the measured 207 Pb levels, where these were not avaliable from experiments. The results of the Hauser-Feshbach calculation is in excellent agreement with the experimental spectrum, showing that the observed fast neutrons can be completely explained assuming a statistical decay. (Author) [pt

  9. Relativistic corrections to the elastic electron scattering from 208Pb

    International Nuclear Information System (INIS)

    Chandra, H.; Sauer, G.

    1976-01-01

    In the present work we have calculated the differential cross sections for the elastic electron scattering from 208 Pb using the charge distributions resulting from various corrections. The point proton and neutron mass distributions have been calculated from the spherical wave functions for 208 Pb obtained by Kolb et al. The relativistic correction to the nuclear charge distribution coming from the electromagnetic structure of the nucleon has been accomplished by assuming a linear superposition of Gaussian shapes for the proton and the neutron charge form factor. Results of this calculation are quite similar to an earlier calculation by Bertozzi et al., who have used a different wave function for 208 Pb and have assumed exponential smearing for the proton corresponding to the dipole fit for the form factor. Also in the present work, reason for the small spin orbit contribution to the effective charge distribution is discussed in some detail. It is also shown that the use of a single Gaussian shape for the proton smearing usually underestimates the actual theoretical cross section

  10. Compton scattering by mesons in nuclei: Experiment on 208Pb

    International Nuclear Information System (INIS)

    Fuhrberg, K.; Martin, G.; Haeger, D.; Ludwig, M.; Schumacher, M.; Andersson, B.E.; Blomqvist, K.I.; Ruijter, H.; Sandell, A.; Schroeder, B.; Hayward, E.; Nilsson, L.; Zorro, R.

    1992-01-01

    Using 58 and 73 MeV tagged photons and scattering angles from 60deg to 150deg, it is shown that is possible to observe Compton scattering by 'mesons in nuclei ' through an incomplete cancellation of the mesonic (exchange- current) seagull amplitude by parts of the nuclear resonance amplitude related to the giant-dipole resonance of 208 Pb. This phenomenon is a property of an extended nucleus and , therefore, cannot be dtudied on the deuteron. Predictions of the exchange form factor which determines the angular distribution of the exchange seagull amplitude are compared with experimental data. (orig.)

  11. Angular distributions of threshold photoneutrons from 208Pb

    International Nuclear Information System (INIS)

    Haacke, L.C.

    1973-01-01

    The shape of the 41 keV resonance in the 208 Pb(γ,n) 207 Pb reaction has been considered in some detail in view of recent reports of asymmetry interpreted in terms of interference between resonant and nonresonant neutron capture amplitudes. Additional threshold measurements were made using bremsstrahlung with an endpoint energy of 8.0 MeV. It has been concluded that asymmetry in the present data appears to be induced by the presence of an unresolved resonance, and that this interpretation of the resonance shape cannot be confuted on the basis of (n,γ) or total neutron cross section measurements made elsewhere. (author)

  12. Self-consistent calculation of 208Pb spectrum

    International Nuclear Information System (INIS)

    Pal'chik, V.V.; Pyatov, N.I.; Fayans, S.A.

    1981-01-01

    The self-consistent model with exact accounting for one-particle continuum is applied to calculate all discrete particle-hole natural parity states with 2 208 Pb nucleus (up to the neutron emission threshold, 7.4 MeV). Contributions to the energy-weighted sum rules S(EL) of the first collective levels and total contributions of all discrete levels are evaluated. Most strongly the collectivization is manifested for octupole states. With multipolarity growth L contributions of discrete levels are sharply reduced. The results are compared with other models and the experimental data obtained in (e, e'), (p, p') reactions and other data [ru

  13. 8B + 208Pb Elastic Scattering at Coulomb Barrier Energies

    Science.gov (United States)

    La Commara, M.; Mazzocco, M.; Boiano, A.; Boiano, C.; Manea, C.; Parascandolo, C.; Pierroutsakou, D.; Signorini, C.; Strano, E.; Torresi, D.; Yamaguchi, H.; Kahl, D.; Di Meo, P.; Grebosz, J.; Imai, N.; Hirayama, Y.; Ishiyama, H.; Iwasa, N.; Jeong, S. C.; Jia, H. M.; Kim, Y. H.; Kimura, S.; Kubono, S.; Lin, C. J.; Miyatake, H.; Mukai, M.; Nakao, T.; Nicoletto, M.; Sakaguchi, Y.; Sánchez-Benítez, A. M.; Soramel, F.; Teranishi, T.; Wakabayashi, Y.; Watanabe, Y. X.; Yang, L.; Yang, Y. Y.

    2018-02-01

    The scattering process of weakly-bound nuclei at Coulomb barrier energies provides deep insights on the reaction dynamics induced by exotic nuclei. Within this framework, we measured for the first time the scattering process of the short-lived Radioactive Ion Beam (RIB) 8B (Sp = 0.1375 MeV) from a 208Pb target at 50 MeV beam energy. The 8B RIB was produced by means of the in-flight facility CRIB (RIKEN, Japan) with an average intensity on target of 10 kHz and a purity about 25%. Elastically scattering ions were detected in the angular range θc.m. = 10°-160° by means of the detector array EXPADES. A preliminary optical model analysis indicates a total reaction cross section of about 1 b, a value, once reduced, 2-3 times larger than those obtained for the reactions induced by the stable weakly-bound projectiles 6,7Li on a 208Pb target in the energy range around the Coulomb barrier.

  14. Electroexcitation of giant multipole resonances in 208Pb

    International Nuclear Information System (INIS)

    Sasao, M.; Torizuka, Y.

    1977-01-01

    Electroexcitation of the nuclear continuum for 208 Pb at excitation energies up to 100 MeV has been measured at momentum transfers in the range from 0.45 to 1.2 fm -1 . Unfolding of the radiation tail was performed using a tail function which takes into account the multiple-photon emission effect. The spectra at these momentum transfers deviate significantly from the prediction of the Fermi-gas model but are consistent with the sum of the multipole strengths of the random-phase approximation; the excess cross section on the low excitation energy side indicates the excitation of multipole resonances. A series of 208 Pb spectra at low momentum transfers was expanded into E1, E2 (E0), E3, and higher multipole components using the q dependence of the Tassie model for isoscalar modes and the Goldhaber-Teller or Steinwedel-Jensen model for isovector modes. The giant dipole resonance thus obtained is consistent with that from photoreactions. Isoscalar and isovector giant quadrupole resonances are seen, respectively, at 11 and 22.5 MeV and an octupole resonance at 16 MeV. A monopole resonance is suggested at 13.5 MeV. The reduced 2 > 2 , B (E1), B (E2), and B (E3) consume most of the corresponding energy weighted sum rule if the q dependences of the Tassie and Goldhaber-Teller models are assumed. The results with these models are consistent with the random-phase approximation

  15. 208Pb(16O,15O)209Pb reaction

    International Nuclear Information System (INIS)

    Becchetti, F.D.; Harvey, B.G.; Kovar, D.; Mahoney, J.; Maguire, C.; Scott, D.K.

    1975-01-01

    The neutron levels in 209 Pb have been studied with the 208 Pb( 16 O, 15 O) reaction at a bomdarding energy of 139 MeV. Spectroscopic factors (S) have been deduced using a finite-range distorted-wave Born approximation (DWBA) with recoil. The 2g 9 / 2 , 1i 11 / 2 , 2g 7 / 2 , and 3d 3 / 2 levels are found to have S approximately-greater-than 0.9 while S approx. = 0.7 for the 1j 15 / 2 level at 1.4 MeV excitation. Evidence is found for other 1j 15 / 2 fragments being at 3.05 MeV and approx. 3.8 MeV with S approx. = 0.08 and 0.26, respectively, which would place the centroid of the 1j 15 / 2 level at E/subx/ approx. = 2.2 MeV. DWBA predicts a shift in the maxima of the angular distributions as a function of Q value which is not observed experimentally. A comparison with the proton transfer reaction 208 Pb( 16 O, 15 N) 209 Bi has been used to deduce the geometrical parameters of a neutron shell model potential appropriate for nuclei with A approximately-greater-than 200. The parameters of this Wood-Saxon potential are: V/subR/=-50.5 MeV,r/subR/=1.19 fm, a/subR/=0.75 fm, V)=-5.5 MeV, r)=1.01 fm, and a)=0.75 fm

  16. 8 CFR 208.18 - Implementation of the Convention Against Torture.

    Science.gov (United States)

    2010-01-01

    ... motion is filed within June 21, 1999; and (ii) The evidence sought to be offered establishes a prima facie case that the applicant's removal must be withheld or deferred under §§ 208.16(c) or 208.17(a). (3... a removal order will not be executed under circumstances that would violate the obligations of the...

  17. 45 CFR 400.208 - Claims involving family units which include both refugees and nonrefugees.

    Science.gov (United States)

    2010-10-01

    ... refugees and nonrefugees. 400.208 Section 400.208 Public Welfare Regulations Relating to Public Welfare OFFICE OF REFUGEE RESETTLEMENT, ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES REFUGEE RESETTLEMENT PROGRAM Federal Funding Federal Funding for Expenditures for Determining...

  18. Direct neutron decay from the giant monopole resonance in 208Pb

    International Nuclear Information System (INIS)

    Bracco, A.; Beene, J.R.; Van Giai, N.; Bortignon, P.F.; Zardi, F.; Broglia, R.A.

    1988-01-01

    Experimental values of partial direct escape widths for the giant monopole resonance (GMR) in 208 Pb are presented and compared with predictions from various RPA models. It is found that different model Hamiltonians that reproduce equally well the energy and strength of the GMR in 208 Pb lead to direct escape width which may differ by a large factor. 1 tab

  19. 44 CFR 208.38 - Reimbursement for re-supply and logistics costs incurred during Activation.

    Science.gov (United States)

    2010-10-01

    ... this subpart, DHS will not reimburse costs incurred for re-supply and logistical support during... and logistics costs incurred during Activation. 208.38 Section 208.38 Emergency Management and...-supply and logistics costs incurred during Activation. With the exception of emergency procurement...

  20. 22 CFR 208.885 - May the debarring official extend a debarment?

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false May the debarring official extend a debarment? 208.885 Section 208.885 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE... determines that an extension is necessary to protect the public interest. (b) However, the debarring official...

  1. 22 CFR 208.700 - When may the suspending official issue a suspension?

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false When may the suspending official issue a suspension? 208.700 Section 208.700 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE...) through (d); and (c) Immediate action is necessary to protect the public interest. ...

  2. 22 CFR 208.110 - What is the purpose of the nonprocurement debarment and suspension system?

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false What is the purpose of the nonprocurement debarment and suspension system? 208.110 Section 208.110 Foreign Relations AGENCY FOR INTERNATIONAL... the nonprocurement debarment and suspension system? (a) To protect the public interest, the Federal...

  3. 30 CFR 208.4 - Royalty oil sales to eligible refiners.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Royalty oil sales to eligible refiners. 208.4... MANAGEMENT SALE OF FEDERAL ROYALTY OIL General Provisions § 208.4 Royalty oil sales to eligible refiners. (a... and defense. The Secretary will review these items and will determine whether eligible refiners have...

  4. 8 CFR 208.5 - Special duties toward aliens in custody of DHS.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Special duties toward aliens in custody of DHS. 208.5 Section 208.5 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... duties toward aliens in custody of DHS. (a) General. When an alien in the custody of DHS requests asylum...

  5. 23 CFR 973.208 - Indian lands pavement management system (PMS).

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Indian lands pavement management system (PMS). 973.208... PROGRAM Bureau of Indian Affairs Management Systems § 973.208 Indian lands pavement management system (PMS... concepts described in the AASHTO's “Pavement Management Guide.” 1 1 “Pavement Management Guide,” AASHTO...

  6. 22 CFR 208.800 - What are the causes for debarment?

    Science.gov (United States)

    2010-04-01

    ... accordance with the terms of one or more public agreements or transactions; (2) A history of failure to... 22 Foreign Relations 1 2010-04-01 2010-04-01 false What are the causes for debarment? 208.800 Section 208.800 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND...

  7. 5 CFR 591.208 - How does OPM establish COLA rates?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false How does OPM establish COLA rates? 591.208 Section 591.208 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living...

  8. Search for the two-phonon octupole vibrational state in {sup 208}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Blumenthal, D.J.; Henning, W.; Janssens, R.V.F. [and others

    1995-08-01

    We performed an experiment to search for the two-phonon octupole vibrational state in {sup 208}Pb. Thick targets of {sup 208}Pb, {sup 209}Bi, {sup 58,64}Ni, and {sup 160}Gd were bombarded with 1305 MeV beams of were bombard {sup 208}Pb supplied by ATLAS. Gamma rays were detected using the Argonne-Notre Dame BGO gamma-ray facility, consisting of 12 Compton-suppressed germanium detectors surrounding an array of 50 BGO scintillators. We identified some 30 known gamma rays from {sup 208}Pb in the spectra gated by the 5{sup -} {yields} 3{sup -} and 3{sup -} {yields} 0{sup +} transitions in {sup 208}Pb. In addition, after unfolding these spectra for Compton response, we observed broad coincident structures in the energy region expected for the 2-phonon states. Furthermore, we confirmed the placement of a 2485 keV line observed previously in {sup 207}Pb and find no evidence consistent with the placement of this line in {sup 208}Pb. We are currently in the process of investigating the origin of the broadened lines observed in the spectra, extracting the excitation probability of states in {sup 208}Pb, and determining the relative probability of mutual excitation and neutron transfer in this reaction. An additional experiment is also being performed to collect much higher statistics germanium-germanium coincidence data for the thick {sup 208}Pb target.

  9. 48 CFR 3027.208 - Use of patented technology under the North American Free Trade Agreements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Use of patented technology under the North American Free Trade Agreements. 3027.208 Section 3027.208 Federal Acquisition... American Free Trade Agreements. (f) Contracting officers shall ensure compliance. ...

  10. 8 CFR 208.30 - Credible fear determinations involving stowaways and applicants for admission found inadmissible...

    Science.gov (United States)

    2010-01-01

    ... the Act. 208.30 Section 208.30 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... Immigration Review has exclusive jurisdiction to review such determinations. Except as otherwise provided in... summary with the alien and provide the alien with an opportunity to correct any errors therein. (e...

  11. 12 CFR 208.35 - Qualification requirements for transactions in certain securities. [Reserved

    Science.gov (United States)

    2010-01-01

    ... requirements for transactions in certain securities. [Reserved] ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Qualification requirements for transactions in certain securities. [Reserved] 208.35 Section 208.35 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF...

  12. Therapeutic Inhibition of miR-208a Improves Cardiac Function and Survival During Heart Failure

    Science.gov (United States)

    Montgomery, Rusty L.; Hullinger, Thomas G.; Semus, Hillary M.; Dickinson, Brent A.; Seto, Anita G.; Lynch, Joshua M.; Stack, Christianna; Latimer, Paul A.; Olson, Eric N.; van Rooij, Eva

    2012-01-01

    Background Diastolic dysfunction in response to hypertrophy is a major clinical syndrome with few therapeutic options. MicroRNAs act as negative regulators of gene expression by inhibiting translation or promoting degradation of target mRNAs. Previously, we reported that genetic deletion of the cardiac-specific miR-208a prevents pathological cardiac remodeling and upregulation of Myh7 in response to pressure overload. Whether this miRNA might contribute to diastolic dysfunction or other forms of heart disease is currently unknown. Methods and Results Here, we show that systemic delivery of an antisense oligonucleotide induces potent and sustained silencing of miR-208a in the heart. Therapeutic inhibition of miR-208a by subcutaneous delivery of antimiR-208a during hypertension-induced heart failure in Dahl hypertensive rats dose-dependently prevents pathological myosin switching and cardiac remodeling while improving cardiac function, overall health, and survival. Transcriptional profiling indicates that antimiR-208a evokes prominent effects on cardiac gene expression; plasma analysis indicates significant changes in circulating levels of miRNAs on antimiR-208a treatment. Conclusions These studies indicate the potential of oligonucleotide-based therapies for modulating cardiac miRNAs and validate miR-208 as a potent therapeutic target for the modulation of cardiac function and remodeling during heart disease progression. PMID:21900086

  13. 9 CFR 381.208 - Poultry products offered for entry and entered to be handled and transported as domestic; entry...

    Science.gov (United States)

    2010-01-01

    ... INSPECTION AND CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS Imported Poultry Products § 381.208... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Poultry products offered for entry and....208 Section 381.208 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF...

  14. 78 FR 22761 - Delegation of Functions Under Sections 404 and 406 of Public Law 112-208

    Science.gov (United States)

    2013-04-16

    ...--Delegation of Functions Under Sections 404 and 406 of Public Law 112-208 Presidential Determination No. 2013... and 406 of Public Law 112-208 Memorandum for the Secretary of State [and] the Secretary of the... conferred upon the President by sections 404 and 406 of Public Law 112-208 as follows: I hereby delegate to...

  15. 22 CFR 208.325 - What happens if I do business with an excluded person in a covered transaction?

    Science.gov (United States)

    2010-04-01

    ... person, we may disallow costs, annul or terminate the transaction, issue a stop work order, debar or... person in a covered transaction? 208.325 Section 208.325 Foreign Relations AGENCY FOR INTERNATIONAL... Regarding Transactions Doing Business with Other Persons § 208.325 What happens if I do business with an...

  16. 12 CFR 208.71 - What are the requirements to invest in or control a financial subsidiary?

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false What are the requirements to invest in or control a financial subsidiary? 208.71 Section 208.71 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF... SYSTEM (REGULATION H) Financial Subsidiaries of State Member Banks § 208.71 What are the requirements to...

  17. Asymptotic three-particle approach to the Coulomb breakup process {sup 6}Li + {sup 208}Pb → {sup 208}Pb + α + d

    Energy Technology Data Exchange (ETDEWEB)

    Igamov, S. B., E-mail: igamov@inp.uz [Uzbek Academy of Sciences, Institute of Nuclear Physics (Uzbekistan)

    2017-03-15

    On the basis of the distorted-wave method, experimental data on the triple-differential cross section for the Coulomb breakup reaction {sup 208}Pb({sup 6}Li, αd){sup 208}Pb are analyzed by employing a correct expression for the final-state {sup 208}Pb–α–d three-particle Coulomb wave function. It is shown that the effect of final-state three-particle Coulomb dynamics can be used to assess the kinematical condition of clean Coulomb breakup processes. New values of the astrophysical S factor for the direct-radiative-capture reaction d(α, γ){sup 6}Li at ultralow energies in the range of 70 ≤ E{sub dα} ≤ 600 keV were extracted from experimental data. The value of S(0) = 1.60 ± 0.17 MeV nb was obtained.

  18. Analysis of the neutron energy spectra from the sup(208)Pb (p,n) sup(208)Bi reaction at Esub(p)=200 MeV

    International Nuclear Information System (INIS)

    Ershov, S.N.; Fayans, S.A.; Gareev, F.A.; Pyatov, N.I.

    1986-01-01

    Microscopic calculation of the small-angle neutron energy spectra from the 208 Pb (p, n) 208 Bi reaction at Esub(p)=200 MeV are presented. It is shown that the distorted-wave impulse approximation and the microscopic theory of finite Fermi systems can be employed for describing the low-energy excitation region 0 <= Q <= 30 MeV with small momentum transfers. A quantitative estimate is obtained for the local charge of quasiparticles esub(q)[σtau]=0.8 that characterizes the quenching of the integral strength of spin-flip low-energy transitions and the relevant effects are discussed

  19. Study of fusion mechanism of halo nuclear 11Be+208Pb by applying QMD model

    International Nuclear Information System (INIS)

    Wang Ning; Li Zhuxia

    2001-01-01

    The authors have studied the fusion reaction for 11 Be + 208 Pb near barrier by applying QMD model, and find that in t he fusion reaction induced by halo nuclei there simultaneously exist two mechanisms competing with each other. On one hand, 11 Be is a weakly bound nuclear system and is easily broke up caused by the interaction with target, when it approaches to target, so the fusion cross section is suppressed. On the other hand, several neutrons of 11 Be transfer into 208 Pb and interact with 208 Pb to cause the local radius of 208 Pb increase and result in an enhancement of fusion cross section. The fusion cross sections calculated show an enhancement near barrier, and the calculated results agree with the experimental data reasonably well

  20. E2, E4 and E6 statistical decay spectra in 208Pb

    International Nuclear Information System (INIS)

    Teruya, N.; Wolynec, E.; Dias, H.

    1987-10-01

    Statistical decay spectra for the decay of giant resonances in 208 Pb are calculated using Hauser-Feshbach formalism and the experimental levels of the residual nucleus. The predicted decay spectra are compared with available experimental results. (author) [pt

  1. 48 CFR 253.208-2 - DD Form 448-2, Acceptance of MIPR.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448-2, Acceptance... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.208-2 DD Form 448-2, Acceptance of MIPR. Follow the procedures at PGI 253.208-2 for use of DD Form 448-2. [71 FR 39005...

  2. Absence of large M1 excitations in 208Pb below 8.4 MeV

    International Nuclear Information System (INIS)

    Holt, R.J.; Jackson, H.E.; Laszewski, R.M.; Specht, J.R.

    1979-01-01

    A very high-resolution measurement of the 208 Pb(γ-n 0 ) 207 Pb reaction was performed by use of the unique picopulse and the newly-installed neutron flight paths at the ANL electron linac facility. The 7.99-MeV resonance (E/sub n/ = 610 keV) exhibited a level-level interference pattern with the 7.98-MeV, E1 resonance in 208 Pb. 1 figure

  3. Study of fusion cross-sections of 16O + 208Pb and 28Si + 208Pb reactions by effective soft-core nucleon-nucleon interaction

    International Nuclear Information System (INIS)

    Ghodsi, O. N.; Mahmodi, M.; Ariai, J.; O. N. Ghodsi)

    2007-01-01

    In this paper, the cross-sections of fusion reactions 16 O + 208 Pb, 28 Si + 208 Pb, 40 C + 40 Ca, 40 Ca + 48 Ca, 58 Ni + 58 Ni, and 16 O + 154 Sm at bombarding energies above and near the fusion barrier have been investigated. The fusion cross-sections have been studied by means of the Monte Carlo method and effective soft-core nucleon-nucleon interaction. One adjustable parameter was used in these calculations. This parameter can change the strength and repulsive parts of soft-core potential values. It has to be adjusted, so that the analytical results are in acceptable agreement with the experimental data. In our calculations, we have taken the range of the nucleon-nucleon soft-core interaction to be constant and equal to that of the M3Y-Raid potential. Results show that the higher values for the diffusion parameter in the Woods-Saxon potential obtained from a careful analysis of 16 O + 208 Pb and 28 Si + 208 Pb reactions are due to the many particle effects on the nucleon-nucleon potential. (author)

  4. Study of fusion cross-sections of 16O + 208Pb and 28Si + 208Pb reactions by effective soft-core nucleon-nucleon interaction

    Directory of Open Access Journals (Sweden)

    Ghodsi Omid N.

    2007-01-01

    Full Text Available In this paper, the cross-sections of fusion reactions 16O + 208Pb, 28Si + 208Pb, 40C + + 40Ca, 40Ca + 48Ca, 58Ni + 58Ni, and 16O + 154Sm at bombarding energies above and near the fusion barrier have been investigated. The fusion cross-sections have been studied by means of the Monte Carlo method and effective soft-core nucleon-nucleon interaction. One adjustable parameter was used in these calculations. This parameter can change the strength and repulsive parts of soft-core potential values. It has to be adjusted, so that the analytical results are in acceptable agreement with the experimental data. In our calculations, we have taken the range of the nucleon-nucleon soft-core interaction to be constant and equal to that of the M3Y-Raid potential. Results show that the higher values for the diffusion parameter in the Woods-Saxon potential obtained from a careful analysis of 16O + 208Pb and 28Si + 208Pb reactions are due to the many particle effects on the nucleon-nucleon potential.

  5. Measurement of conversion electrons with the $^{208}Pb(p,n)^{208}Bi$ reaction and derivation of the shell model proton neutron hole interaction from the properties of $^{208}Bi$

    CERN Document Server

    Maier, K H; Dracoulis, G D; Boutachkov, P; Aprahamian, A; Byrne, A P; Davidson, P M; Lane, G L; Marie-Jeanne, Mélanie; Nieminen, P; Watanabe, H

    2007-01-01

    Conversion electrons from 208Bi have been measured using singles and coincidence techniques with the 208Pb(p,n)208Bi reaction at 9 MeV. The new information on multipolarities and spins complements that available from recent gamma-gamma-coincidence studies with the same reaction [Boutachkov et al., Nucl. Phys. A768, 22 (2006)]. The results on electromagnetic decays taken together with information on spectroscopic factors from earlier single-particle transfer reaction measurements represent an extensive data set on the properties of the one-proton one-neutron-hole states below 3 MeV, a spectrum which is virtually complete. Comparison of the experimental observables, namely, energies, spectroscopic factors, and gamma-branching ratios, with those calculated within the shell model allows extraction of the matrix elements of the shell model residual interaction. More than 100 diagonal and nondiagonal elements can be determined in this way, through a least squares fit to the experimental data. This adjustment of the...

  6. Competition from the ν/sub e/ 208Pb → 208Bi e- reaction in a search for ν/sub μ/-bar → ν/sub e/-bar oscillation

    International Nuclear Information System (INIS)

    Toevs, J.W.; Kruse, H.W.

    1981-01-01

    Inverse beta-decay reactions produced by electron neutrinos may compete with muon neutrino reactions in experiments utilizing the neutrino flux from a beam stop. The cross section and angular distribution for one such reaction, ν/sub e/ 208 Pb → 208 Bi e - , have been calculated with the aid of the results of an investigation of 208 Pb (p,n) 208 Bi at low momentum transfer. The implications of this reaction on an experiment to study neutrino oscillation are discussed. 2 figures

  7. Study of the nuclear reactions 208Pb + 58Ni and 208Pb + 64Ni with a focusing time-of-flight spectrometer

    International Nuclear Information System (INIS)

    Sapotta, K.

    1983-01-01

    In the first part of this thesis the construction of a time-of-flight spectrometer for heavy ions with magnetic focusing is described. Then ion trajectories are calculated, and the effective spatial angle and the angular resolution are determined. In the second part the study of quasielastic transfer and deep inelastic reactions of 58 Ni and 64 Ni with 208 Pb at E=265 MeV respectively 260 MeV by means of this spectrometer is described. (HSI) [de

  8. Search for 1/sup +/ states in /sup 208/Pb by /sup 208/Pb(p, p') and the /sup 209/Bi(d, /sup 3/He) reactions

    Energy Technology Data Exchange (ETDEWEB)

    Ikegami, H.; Yamazaki, T.; Morinobu, S.; Katayama, I.; Fujiwara, M. [Osaka Univ., Suita (Japan). Research Center for Nuclear Physics; Ikegami, Hidetsugu; Muraoka, Mitsuo [eds.; Osaka Univ., Suita (Japan). Research Center for Nuclear Physics

    1980-01-01

    Proton inelastic scattering experiment on Pb-208 was carried out by using 65 MeV protons from a 230 cm AVF cyclotron, to study the 1/sup +/ states in Pb-208. The momentum of outgoing protons was analyzed by the magnetic spectrograph RAIDEN. The 7.06 MeV state was very weakly excited. In order to identify 1/sup +/ states from the angular distributions of the inelastic scattering, the proton spectra scattered from the well known 1/sup +/ state in Pb-206 were measured. because of masking by a strong neighbouring peak, the differential cross section of the 1/sup +/ state was measured only at two points. The comparison between the experiment and distorted wave calculation for the 1/sup +/ state (1.703 MeV) in Pb-206 was made, and the results implied that the 1/sup +/ states in Pb-208 would also be weakly excited even if these states are good particle-hole states, Next, Bi-209 (d, He-3) reaction experiment was performed. The comparison between the preliminary results and the calculated results based on the shell model is shown in a figure. The overall agreement between the experimental and theoretical results seems to be good. However, the existence of the 1/sup +/ state has not been confirmed, and will be confirmed in the next step to be done.

  9. Discerning the neutron density distribution of 208Pb from nucleon elastic scattering

    International Nuclear Information System (INIS)

    Karataglidis, S.; Amos, K.; University of Melbourne, VIC; Brown, B.A.; Deb, P.K.

    2001-01-01

    We seek a measure of the neutron density of 208 Pb from analyses of intermediate energy nucleon elastic scattering. The pertinent model for such analyses is based on coordinate space nonlocal optical potentials obtained from model nuclear ground state densities. As a calibration of the use of Skyrme-Hartree-Fock models the elastic scattering from 40 Cawas considered as well. Those potentials give predictions of integral observables and of angular distributions which show sensitivity to the neutron density. When compared with experiment, and correlated with analyses of electron scattering data, the results suggest that 208 Pb has a neutron skin thickness ∼ 0.17 fm

  10. Disentangling the transfer and breakup contributions for the inclusive 8 Li + 208 Pb reaction

    International Nuclear Information System (INIS)

    Moro, A.M.; Crespo, R.; Garcia M, H.; Aguilera, E.F.; Martinez Q, E.; Gomez C, J.; Nunes, F.M.

    2003-01-01

    An analysis of the 8 Li + 208 Pb reaction at energies around the Coulomb barrier is presented. The study is focused on the elastic and one-neutron removal channels. For the elastic scattering, an optical model analysis of the experimental data is performed. The observed 7 Li is interpreted as the superposition of the one-neutron transfer reaction, 208 Pb ( 8 Li, 7 Li) 209 Pb, and the breakup reaction. The separate contribution of each one of these processes has been calculated within the DWBA formalism. The sum of both contributions explains adequately the experimental angular distribution of 7 Li. (Author)

  11. Reanalysis of electron scattering and muonic x-ray data for 208Pb

    International Nuclear Information System (INIS)

    Frair, J.L.; Heisenberg, J.; Negele, J.W.

    1977-01-01

    A simultaneous analysis was performed for the world's supply of data on lead 208. A total of 14 sets of electron scattering data were analyzed along with six independent muonic transition energies. A previously used Fourier Bessel expansion program was expanded to include the full set of available data. The fit was done starting with the density distribution and using 13 expansion coeffients with a cutoff radius of 11 fm. The results are tabulated for muonic energy levels. Interior charge densities of lead 208, differential cross sections, per cent of experimental deviation from the fit, and charge density are plotted. 8 references

  12. Sensitivity of the electric dipole polarizability to the neutron skin thickness in {sup 208}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Roca-Maza, X.; Agrawal, B. K.; Colo, G.; Nazarewicz, W.; Paar, N.; Piekarewicz, J.; Reinhard, P.-G.; Vretenar, D. [INFN, sezione di Milano, via Celoria 16, I-20133 Milano (Italy); Saha Institute of Nuclear Physics, Kolkata 700064 (India); Dipartimento di Fisica, Universita degli Studi di Milano and INFN, Sezione di Milano, 20133 Milano (Italy); Department of Physics and Astronomy, University of Tennessee, Knoxville, Tennessee 37996 (United States) and Institute of Theoretical Physics, University of Warsaw, Hoza 69, PL-00-681 Warsaw (Poland); Physics Department, Faculty of Science, University of Zagreb, Zagreb (Croatia); Department of Physics, Florida State University, Tallahassee, FL 32306 (United States); Institut fuer Theoretische Physik II, Universitaet Erlangen-Nuernberg, Staudtstrasse 7, D-91058 Erlangen (Germany); Physics Department, Faculty of Science, University of Zagreb, Zagreb (Croatia)

    2012-10-20

    The static dipole polarizability, {alpha}{sub D}, in {sup 208}Pb has been recently measured with highresolution via proton inelastic scattering at the Research Center for Nuclear Physics (RCNP) [1]. This observable is thought to be intimately connected with the neutron skin thickness, r{sub skin}, of the same nucleus and, more fundamentally, it is believed to be associated with the density dependence of the nuclear symmetry energy. The impact of r{sub skin} on {alpha}{sub D} in {sup 208}Pb is investigated and discussed on the basis of a large and representative set of relativistic and non-relativistic nuclear energy density functionals (EDF) [2].

  13. Triple-differential cross section of the 208Pb(6Li, αd)208 Pb Coulomb breakup and astrophysical S-factor of the d(α,γ)6 Li reaction at extremely low energies

    International Nuclear Information System (INIS)

    Igamov, S.B.; Yarmukhamedov, R.

    1999-10-01

    A method of calculation of the triple-differential cross section of the 208 Pb( 6 Li, αd) 208 Pb Coulomb breakup at astrophysically relevant energies E of the relative motion of the breakup fragments, taking into account the three-body (α - d - 208 Pb) Coulomb effects and the contributions from the E1- and E2- multipoles, including their interference, has been proposed. The new results for the astrophysical S-factor of the direct radiative capture d(α, γ) 6 Li reaction at E ≤ 250 keV have been obtained. It is shown that the experimental triple-differential cross section of the 208 Pb( 6 Li, αd) 208 Pb Coulomb breakup can also be used to give information about the value of the modulus squared of the nuclear vertex constant for the virtual 6 Li → α + d. (author)

  14. THREE-VALENCE-PARTICE NUCLEI IN THE 132Sn and 208 Pb REGIONS

    International Nuclear Information System (INIS)

    Benchikh, L.; Draoui, B.; Latfaoui, M.; Aissaoui, L.

    2011-01-01

    Full text: Among the nuclei of the nuclear charter, the nuclei around closed shells play a key role in understanding the effective interaction properties between nucleons far from the valley of stability; particulary, the nuclei of a few valence nucleons around doubly magic 208 28Pb126 and 132 50Sn82 nuclei. The interest of both regions 208Pb and 132Sn lies in the fact that there is a great similarity between their nuclear spectroscopic properties. The single energy gaps in both cases are comparable and the orbitals above and below these gaps are similarly ordered. Each single state in the region of 132Sn has its counterpart in that of 208Pb. An interesting predictive consequence, the interactions of the Sn region, difficult region to reach experimentally, can be estimated from their corresponding ones constructed to describe the nuclei of the Pb region. Because of the importance of the similarity existing between the spectroscopy of these two regions, we are interested in nuclei with three valence nucleons in the lead and Tin regions on the basis of experimental data (spin, parity and energy states). In this context, the theoretical study is conducted within the shell model using the MSDI interaction for the energy spectra calculations of the studied nuclei. The calculated results are in good agreement with the available experimental data and show evidence that a close resemblance between the spectroscopy of these two regions persists when moving away from the immediate neighbours of doubly magic 132Sn and 208Pb.

  15. Complete dipole response in 208Pb from high-resolution polarized proton scattering at 0 deg

    International Nuclear Information System (INIS)

    Neumann-Cosel, P. von; Kalmykov, Y.; Poltoratska, I.; Ponomarev, V. Yu.; Richter, A.; Wambach, J.; Adachi, T.; Fujita, Y.; Matsubara, H.; Sakemi, Y.; Shimizu, Y.; Tameshige, Y.; Yosoi, M.; Bertulani, C. A.; Carter, J.; Fujita, H.; Dozono, M.; Fujita, K.; Hashimoto, H.; Hatanaka, K.

    2009-01-01

    The structure of electric and magnetic dipole modes in 208 Pb is investigated in a high-resolution measurement of the (p-vector,p-vector') reaction under 0 deg. First results on the E1 strength in the region of the pygmy dipole resonance are reported.

  16. 18 CFR 154.208 - Service of tariff filings on customers and other parties.

    Science.gov (United States)

    2010-04-01

    ... SCHEDULES AND TARIFFS Procedures for Changing Tariffs § 154.208 Service of tariff filings on customers and... customers and state regulatory commissions that have made a standing request for such service. (c) Within... section, service upon the designated recipient will be deemed service upon the customer or other party. (e...

  17. 42 CFR 3.208 - Continued protection of patient safety work product.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Continued protection of patient safety work product... GENERAL PROVISIONS PATIENT SAFETY ORGANIZATIONS AND PATIENT SAFETY WORK PRODUCT Confidentiality and Privilege Protections of Patient Safety Work Product § 3.208 Continued protection of patient safety work...

  18. Structures excited by heavy ions in 208Pb target. Interpretation involving giant resonances and multiphonon excitations

    International Nuclear Information System (INIS)

    Chomaz, P.

    1984-01-01

    Kinetic energy spectra of heavy fragments from the 36Ar+208Pb reaction at 11 MeV/n and 20 Ne+ 208 Pb at 30 MeV/n have been measured with a time of flight spectrometer. Numerous structures ranging up to 100 MeV excitation energy are observed in the inelastic and few nucleon transfer channels. These structures are shown to be due to an excitation of the 208 Pb target nucleus and not to decay products of excited ejectiles. Positions of low lying structures (E* 208 Pb. The linear response of the target nucleus to the external field created by the projectile is calculated microscopically in the Random Phase Approximation resolved using the Green's function method in coordinate space with a Skyrme interaction. In the independant quasi-boson approximation multiple phonon excitations reproduce the main features of the experimental data and appear as a plausible interpretation of the observed structures. The theoretical calculations and experimental observations suggest that multiphonon excitations play an important role in heavy ion reactions and contribute strongly to the kinetic energy dissipation [fr

  19. Pionic 4f-3d X-rays from 208Pb and 209Bi

    International Nuclear Information System (INIS)

    Olin, A.; Forsman, J.W.; MacDonald, J.A.; Marshall, G.M.; Numao, T.; Poffenberger, P.R.; Van Esbroek, P.; Kunselman, A.R.; Olaniyi, B.H.

    1985-01-01

    The X-ray energies and widths of the pionic 4f-3d and 5g-4f transitions have been measured in 208 Pb and 209 Bi. The 3d widths obtained are in reasonable agreement with theory, and do not support the anomalously small values previously reported. (orig.)

  20. 8 CFR 208.15 - Definition of “firm resettlement.”

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Definition of âfirm resettlement.â 208.15... resettlement.” An alien is considered to be firmly resettled if, prior to arrival in the United States, he or... resident status, citizenship, or some other type of permanent resettlement unless he or she establishes: (a...

  1. 49 CFR 24.208 - Aliens not lawfully present in the United States.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Aliens not lawfully present in the United States... Requirements § 24.208 Aliens not lawfully present in the United States. (a) Each person seeking relocation... of an individual, that he or she is either a citizen or national of the United States, or an alien...

  2. Production and identification of new, neutron-rich nuclei in the {sup 208}Pb region

    Energy Technology Data Exchange (ETDEWEB)

    Rykaczewski, K. [Oak Ridge National Lab., TN (United States). Physics Div.]|[ISOLDE-CERN, Geneva (Switzerland)]|[Univ. of Warsaw (Poland); Kurpeta, J.; Plochocki, A. [Univ. of Warsaw (Poland)] [and others

    1998-11-01

    The recently developed methods allowing the experimental studies on new neutron-rich nuclei beyond doubly-magic {sup 208}Pb are briefly described. An identification of new neutron-rich isotopes {sup 215}Pb and {sup 217}Bi, and new decay properties of {sup 216}Bi studied by means of a pulsed release element selective technique at PS Booster-ISOLDE are reported.

  3. 46 CFR 180.208 - Survival craft-vessels operating on rivers routes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft-vessels operating on rivers routes. 180... VESSELS (UNDER 100 GROSS TONS) LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 180.208 Survival craft—vessels operating on rivers routes. (a) Except as allowed by paragraphs (c), (d...

  4. 46 CFR 117.208 - Survival craft-vessels operating on rivers routes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on rivers routes. 117... LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 117.208 Survival craft—vessels... vessel certificated to operate on a rivers route in warm water is not required to carry survival craft...

  5. 7 CFR 3550.208 - Reamortization using promissory note interest rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Reamortization using promissory note interest rate... § 3550.208 Reamortization using promissory note interest rate. Reamortization using the promissory note interest rate may be authorized when RHS determines that reamortization is required to enable the borrower...

  6. Direct and statistical gamma decay of the giant quadrupole resonance of 208Pb

    International Nuclear Information System (INIS)

    Dias, H.; Hussein, M.S.; Carlson, B.V.; Merchant, A.C.

    1986-03-01

    The gamma decay of the giant quadrupole resonance of 208 Pb is discussed. The relative contribution of the decay via the compound nucleus is calculated from the statistical theory. It is found that the compound decay is as important as the direct decay. (Author) [pt

  7. 48 CFR 253.208-1 - DD Form 448, Military Interdepartmental Purchase Request.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448, Military... DD Form 448, Military Interdepartmental Purchase Request. Follow the procedures at PGI 253.208-1 for use of DD Form 448. [71 FR 39005, July 11, 2006] ...

  8. 33 CFR 208.32 - Sanford Dam and Lake Meredith, Canadian River, Tex.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Sanford Dam and Lake Meredith... OF THE ARMY, DEPARTMENT OF DEFENSE FLOOD CONTROL REGULATIONS § 208.32 Sanford Dam and Lake Meredith, Canadian River, Tex. The Bureau of Reclamation, or its designated agent, shall operate the Sanford Dam and...

  9. 33 CFR 208.34 - Norman Dam and Lake Thunderbird, Little River, Okla.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Norman Dam and Lake Thunderbird... OF THE ARMY, DEPARTMENT OF DEFENSE FLOOD CONTROL REGULATIONS § 208.34 Norman Dam and Lake Thunderbird, Little River, Okla. The Bureau of Reclamation, or its designated agent, shall operate Norman Dam and Lake...

  10. 33 CFR 208.29 - Arbuckle Dam and Lake of the Arbuckles, Rock Creek, Okla.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Arbuckle Dam and Lake of the..., DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE FLOOD CONTROL REGULATIONS § 208.29 Arbuckle Dam and Lake of the... Dam and Lake of the Arbuckles in the interest of flood control as follows: (a) Flood control storage...

  11. [An analysis of clinical characteristic and related risk factors in 208 cirrhotic patients complicated with infections].

    Science.gov (United States)

    Zhang, G H; Wang, M; Wang, L; Wang, X M; Wang, Y; Ou, X J; Jia, J D

    2018-02-01

    Objective: To analyze the clinical features and risk factors of cirrhotic patients complicated with infections. Methods: The clinical and laboratory characteristics of cirrhotic patients complicated with infections hospitalized from April 2014 to June 2017 were retrospectively analyzed. Relevant risk factors for infection and mortality were explored. Results: The overall incidence of infections was 17.6% in 1 670 hospitalized cirrhotic patients. Among the recruited 208 patients in this study, alcoholic, viral hepatitis B or C and autoimmune liver diseases accounted for 29.8% (62/208), 26.0% (54/208), and 22.1% (46/208), respectively. The most common infection site was respiratory tract (70.2%), followed by urinary tract, intestinal and intra-abdomen. Forty-six pathogens were isolated from 32 patients, including 22 (47.8%) Gram negative bacteria, 16 (34.8%) Gram positive bacteria and 2(4.3%) mycobacterium tuberculosis, 5 (10.9%) fungi and 1 (2.2%) mycoplasma. The mortality in patients with nosocomial infections (16.7%,7/42) was higher than that in patients with community-acquired infections (6.0%,10/166, P =0.025). All 17 deaths occurred in decompensated cirrhosis. Multivariate analysis demonstrated that hepatic encephalopathy and prothrombin time were independent risk factors of mortality. Conclusions: Patients with decompensated cirrhosis are more susceptible to infections. Hepatic encephalopathy and prothrombin time are independent risk factors for death.

  12. 44 CFR 208.37 - Reimbursement for equipment and supply costs incurred during Activation.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Reimbursement for equipment... SEARCH AND RESCUE RESPONSE SYSTEM Response Cooperative Agreements § 208.37 Reimbursement for equipment and supply costs incurred during Activation. (a) Allowable costs. DHS will reimburse costs incurred...

  13. 44 CFR 208.40 - Reimbursement of fringe benefit costs during Activation.

    Science.gov (United States)

    2010-10-01

    ... reimbursement sought from DHS. (c) DHS will not reimburse the Sponsoring Agency for fringe benefit costs for... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Reimbursement of fringe... RESCUE RESPONSE SYSTEM Response Cooperative Agreements § 208.40 Reimbursement of fringe benefit costs...

  14. Production and identification of new, neutron-rich nuclei in the 208Pb region

    International Nuclear Information System (INIS)

    Rykaczewski, K.; Kurpeta, J.; Plochocki, A.; Karny, M.; Szerypo, J.; Evensen, A.-H.; Kugler, E.; Lettry, J.; Ravn, H.; Duppen, P. van; Andreyev, A.; Huyse, M.; Woehr, A.; Jokinen, A.; Aeystoe, J.; Nieminen, A.; Huhta, M.; Ramdhane, M.; Walter, G.; Hoff, P.

    1998-01-01

    The recently developed methods allowing the experimental studies on new neutron-rich nuclei beyond doubly-magic 208 Pb are briefly described. An identification of new neutron-rich isotopes 215 Pb and 217 Bi, and new decay properties of 216 Bi studied by means of a pulsed release element selective technique at PS Booster-ISOLDE are reported

  15. 8 CFR 208.11 - Comments from the Department of State.

    Science.gov (United States)

    2010-01-01

    ....11 Section 208.11 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS... Department of State. (a) U.S. Citizenship and Immigration Services (USCIS) may request, at its discretion... provided an opportunity to review and respond to such comments prior to the issuance of any decision to...

  16. Study of fragmentation potential for doubly magic 208Pb daughter cluster radioactivity

    International Nuclear Information System (INIS)

    Sukhmanpreet Kaur; Kaur, Mandeep; Singh, BirBikram

    2017-01-01

    In present work, the selected CR decays of different trans-lead parent nuclei are investigated within the collective clusterisation approach of quantum mechanical fragmentation theory (QMFT), specifically, which lead to 208 Pb daughter nucleus, always, through emission of clusters 14 C, 18,20 O, 22 Ne, 23 F, 24,26 Ne, 28,30 Mg and 34 Si

  17. 5 CFR 792.208 - What is the definition of executive agency?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false What is the definition of executive... Legislation and to Whom Does It Apply? § 792.208 What is the definition of executive agency? The term... Accounting Office. ...

  18. Complete Electric Dipole Response and the Neutron Skin in 208Pb

    NARCIS (Netherlands)

    Tamii, A.; Poltoratska, I.; Neumann-Cosel, P. von; Fujita, Y.

    2011-01-01

    A benchmark experiment on 208Pb shows that polarized proton inelastic scattering at very forward angles including 0◦ is a powerful tool for high-resolution studies of electric dipole (E1) and spin magnetic dipole (M1) modes in nuclei over a broad excitation energy range to test up-to-date nuclear

  19. 49 CFR 40.208 - What problem requires corrective action but does not result in the cancellation of a test?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What problem requires corrective action but does not result in the cancellation of a test? 40.208 Section 40.208 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Problems...

  20. 20 CFR 652.208 - How are core services and intensive services related to the methods of service delivery described...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How are core services and intensive services related to the methods of service delivery described in § 652.207(b)(2)? 652.208 Section 652.208 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR ESTABLISHMENT AND...

  1. 5 CFR 2640.302 - Waivers issued pursuant to 18 U.S.C. 208(b)(3).

    Science.gov (United States)

    2010-01-01

    ... actual or potential profit or loss or cost of the matter to the company issuing the stock, the change in...) Requirements for issuing an individual waiver under 18 U.S.C. 208(b)(3). Pursuant to 18 U.S.C. 208(b)(3), an...) The type of interest that is creating the disqualification (e.g. stock, bonds, real estate, other...

  2. 20 CFR 429.208 - How do you determine the award? Is the settlement of my claim final?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false How do you determine the award? Is the settlement of my claim final? 429.208 Section 429.208 Employees' Benefits SOCIAL SECURITY ADMINISTRATION... value of the item in question, if you retain the item. (b) Depreciation in value is determined by...

  3. 31 CFR 538.208 - Prohibited grant or extension of credits or loans to the Government of Sudan.

    Science.gov (United States)

    2010-07-01

    ... loans to the Government of Sudan. Except as otherwise authorized, the grant or extension of credits or... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Prohibited grant or extension of credits or loans to the Government of Sudan. 538.208 Section 538.208 Money and Finance: Treasury...

  4. Atipias de Células Escamosas de Significado Indeterminado (ASCUS): estudo de 208 Casos Atypical Squamous Cells of Undetermined Significance (ASCUS): study of 208 Cases

    OpenAIRE

    José Eleutério Junior; Diane Isabelle Magno Cavalcante; Maria Tereza M. P. Dias; Rossana M. Alves; Gabriela C. Queiroz; Aline R. Proença

    2000-01-01

    Objetivos: avaliar aspectos clínicos, colposcópicos e acompanhamento citológico de quadros classificados como atipias de células escamosas de significado indeterminado (ASCUS). Métodos: foram analisados retrospectivamente 208 casos de ASCUS diagnosticados entre 1996 e 1998 e tabulados quanto a idade, queixas clínicas, colposcopia e seguimento. Resultados: a relação ASCUS:lesão intra-epitelial escamosa foi de 1:1,2, confirmando adequado controle de qualidade. Pacientes com menos de 35 anos cor...

  5. Study of the influence of color van der Waals forces and of non-Coulombian effects in 208pb+208pb scattering using a high-precision experiment

    International Nuclear Information System (INIS)

    Casandjian, Jean-Marc

    1996-01-01

    This work deals with the precise measurement of the absolute angular position of the elastic 208 pb+ 208 pb scattering cross section oscillations. The main objective is to verify if all of the elastic scattering ingredients are known even with an angular position precision of a few milli-degrees or if it is necessary to introduce new elements such as the color van der Waals force. This experiment was performed at Ganil. We obtained a precision of 0.004 deg. on the absolute cross section oscillation position and an angular shift of a few hundredths of degrees in relation to the expected position of a pure coulomb scattering. The attainment of this precision required particular precautions in the measurement of the absolute energy target position and scattering angle. First, the angular straggling on a thin target and the production of δ electrons during the scattering is studied. Next the origin of the angular shift is examined by the calculation of all the potentials that act during the scattering. The agreement between experimentation and theory allowed us to set a new limit on the color van der Waals interaction. (author) [fr

  6. miR-208-3p promotes hepatocellular carcinoma cell proliferation and invasion through regulating ARID2 expression

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Peng; Wu, Dingguo; You, Yu; Sun, Jing; Lu, Lele; Tan, Jiaxing; Bie, Ping, E-mail: bieping2010@163.com

    2015-08-15

    MicroRNAs (miRNAs) are small non-coding RNAs that negatively regulate gene expression at post-transcriptional level. miRNA dysregulation plays a causal role in cancer progression. In this study, miR-208-3p was highly expressed and directly repressed ARID2 expression. As a result, ARID2 expression in hepatocellular carcinoma (HCC) was decreased. In vitro, miR-208-3p down-regulation and ARID2 over-expression elicited similar inhibitory effects on HCC cell proliferation and invasion. In vivo test results revealed that miR-208-3p down-regulation inhibited HCC tumorigenesis in Hep3B cells. Moreover, ARID2 was possibly a downstream element of transforming growth factor beta1 (TGFβ1)/miR-208-3p/ARID2 regulatory pathway. These findings suggested that miR-208-3p up-regulation is associated with HCC cell progression and may provide a new target for liver cancer treatment. - Highlights: • miR-208-3p was highly expressed and directly repressed the expression of ARID2 in HCC. • miR-208-3p contributed to HCC cell progression both in vitro and in vivo. • Over-expression of ARID2 inhibited the HCC cell proliferation and invasion. • Restoration of ARID2 partly reversed the the effect of miR-208-3p down-regulation on HCC cells. • Newly regulatory pathway: miR-208-3p mediated the repression of ARID2 by TGFβ1 in HCC cells.

  7. Self-consistent Hartree-Fock RPA calculations in 208Pb

    Science.gov (United States)

    Taqi, Ali H.; Ali, Mohammed S.

    2018-01-01

    The nuclear structure of 208Pb is studied in the framework of the self-consistent random phase approximation (SCRPA). The Hartree-Fock mean field and single particle states are used to implement a completely SCRPA with Skyrme-type interactions. The Hamiltonian is diagonalised within a model space using five Skyrme parameter sets, namely LNS, SkI3, SkO, SkP and SLy4. In view of the huge number of the existing Skyrme-force parameterizations, the question remains which of them provide the best description of data. The approach attempts to accurately describe the structure of the spherical even-even nucleus 208Pb. To illustrate our approach, we compared the binding energy, charge density distribution, excitation energy levels scheme with the available experimental data. Moreover, we calculated isoscalar and isovector monopole, dipole, and quadrupole transition densities and strength functions.

  8. The dispersive optical model for n + [sup 208]Pb and n + [sup 209]Bi

    Energy Technology Data Exchange (ETDEWEB)

    Walter, R.L. (Dept. of Physics, Duke Univ., Durham, NC (United States) Triangle Univ. Nuclear Lab., Durham, NC (United States)); Weisel, G.J. (Dept. of Physics, Duke Univ., Durham, NC (United States) Triangle Univ. Nuclear Lab., Durham, NC (United States)); Das, R.K. (Dept. of Physics, Duke Univ., Durham, NC (United States) Triangle Univ. Nuclear Lab., Durham, NC (United States)); Tornow, W. (Dept. of Physics, Duke Univ., Durham, NC (United States) Triangle Univ. Nuclear Lab., Durham, NC (United States)); Howell, C.R. (Dept. of Physics, Duke Univ., Durham, NC (United States) Triangle Univ. Nuclear Lab., Durham, NC (United States))

    1993-06-01

    The dispersive optical model (DOM) provides a natural connection between the shell model potential for bound states and the optical model for nucleon scattering at positive energies. At TUNL we have developed DOMs for neutron scattering for ten nuclei between [sup 27]Al and [sup 209]Bi. In these studies we rely on TUNL measurements of differential cross-section ([sigma]([theta])) and analyzing power, as well as a wealth of [sigma]([theta]) and total cross section measurements from numerous other laboratories. In this paper we briefly outline the DOM method and the achievements in describing scattering data for n + [sup 208]Pb and n + [sup 209]Bi and single-particle bound-state data for neutrons in [sup 208]Pb. (orig.)

  9. Neutron skin of 208 Pb in consistency with neutron star observations

    CERN Document Server

    Miyazaki, K

    2007-01-01

    The renormalized meson-nucleon couplings are applied to the relativistic optical model of p-208Pb elastic scattering at T_{lab}=200MeV. We calculate the strength of the vector potential at nuclear center as varying the neutron radius of 208Pb. The neutron skin thickness S_{n} is determined in the comparison of the calculated potential with the phenomenological one. We find a value S_{n}=0.118fm being consistent with the astronomical observations of massive neutron stars (NSs), the standard scenario of NS cooling and the experimental nuclear symmetry energy in terrestrial laboratory. The value is complementary to the previous result S_{n}=0.119fm in the analysis of elastic scattering above T_{lab}=500MeV within the relativistic impulse optical model.

  10. Low energy 16O+208Pb elastic scattering: an attempt to analyze the microscopic effective potential

    International Nuclear Information System (INIS)

    Mau, N.V.; Ferrero, J.L.; Pacheco, J.C.; Bilwes, B.

    1991-03-01

    Elastic scattering of 16 O on 208 Pb is studied at 96, 104, 129.5, 192, 216.6 and 312.6 MeV. The 16 O+ 208 Pb potential is calculated first in the closure approximation model and compared to semi-phenomenological potentials. Then detailed contributions to the polarization real potential and to the imaginary potential due to the coupling of the elastic channels to the inelastic channels are calculated. The results are compared to the authors' model potential and used to test the main assumptions of the model. From that comparison a qualitative interpretation of the success of the model is proposed. At last the elastic scattering cross sections are calculated and compared to the data. (author) 41 refs., 6 figs., 5 tabs

  11. Correlated nucleon motion and fractional occupation of orbitals in 208Pb

    International Nuclear Information System (INIS)

    De Witt Huberts, Peter K.A.

    1999-01-01

    The low-energy states of nearly closed-shell nuclei can be interpreted as having quasi-particles in single-particle orbitals. The difference between physical particle and quasi particle, resulting from correlations, is quantified by the quasi-hole strength z that represents the probability of the quasi-particle being a physical particle. We present empirical evidence from quasi-free proton knockout with electrons for a substantially quenched z-value for the 3s orbital in 208 Pb. With z values derived from (e,e'p) and elastic electron-scattering data the absolute occupation for the 3s orbital in 208 Pb is derived. Results from both theory and experiment imply that only ∼ 2/3 of the nucleons act as independent particles bound in an average potential

  12. E2, E4, and E6 statistical decay spectra in 208Pb

    International Nuclear Information System (INIS)

    Teruya, N.; Wolynec, E.; Dias, H.

    1989-01-01

    Statistical decay spectra for the decay of giant resonances in 208 Pb by one neutron emission are calculated using the Hauser-Feshbach formalism and the experimental levels of the residual nucleus. The predicted decay spectra are compared with available experimental results. It is shown that the decay spectra are sensitive to multipole ad-mixtures of the excited state and can be used to study such admixtures. The available experimental data for the decay of the E2 resonances in 208 Pb contain spurious peaks that do not belong to the spectrum of 207 Pb. Theuuncertainty of the experimental data make it impossible to decide whether the decay is purely E2 or a mixture of 80% E2 plus 20% E6. (author) [pt

  13. Transverse energy production in 208Pb+Pb collisions at 158 GeV per nucleon

    International Nuclear Information System (INIS)

    Alber, T.; Appelshaeuser, H.; Baechler, J.; Bartke, J.; Bialkowska, H.; Bieser, F.; Bloomer, M.A.; Blyth, C.O.; Bock, R.; Bormann, C.; Brady, F.P.; Brockmann, R.; Buncic, P.; Caines, H.L.; Cebra, D.; Chan, P.; Cooper, G.E.; Cramer, J.G.; Cramer, P.B.; Csato, P.; Derado, I.; Dunn, J.; Eckardt, V.; Eckhardt, F.; Euler, S.; Ferguson, M.I.; Fischer, H.G.; Fodor, Z.; Foka, P.; Freund, P.; Fuchs, M.; Gal, J.; Gazdzicki, M.; Gladysz, E.; Grebieszkow, J.; Guenther, J.; Harris, J.W.; Heck, W.; Hegyi, S.; Hill, L.A.; Huang, I.; Howe, M.A.; Igo, G.; Irmscher, D.; Jacobs, P.; Jones, P.G.; Kadija, K.; Kecskemeti, J.; Kowalski, M.; Kuehmichel, A.; Lasiuk, B.; Margetis, S.; Mitchell, J.W.; Mock, A.; Nelson, J.M.; Odyniec, G.; Palinkas, J.; Palla, G.; Panagiotou, A.D.; Petridis, A.; Piper, A.; Poskanzer, A.M.; Prindle, D.J.; Puehlhofer, F.; Rauch, W.; Renfordt, R.; Retyk, W.; Ritter, H.G.; Roehrich, D.; Rudolph, H.; Runge, K.; Sandoval, A.; Sann, H.; Schaefer, E.; Schmitz, N.; Schoenfelder, S.; Seyboth, P.; Seyerlein, J.; Sikler, F.; Skrzypczak, E.; Stock, R.; Stroebele, H.; Szentpetery, I.; Sziklai, J.; Toy, M.; Trainor, T.A.; Trentalange, S.; Vassiliou, M.; Vesztergombi, G.; Vranic, D.; Wenig, S.; Whitten, C.; Wienold, T.; Wood, L.; Zimanyi, J.; Zhu, X.; Zybert, R.

    1995-01-01

    Measurements of the forward and the transverse energy in 158 GeV per nucleon 208 Pb+Pb collisions are presented. A total transverse energy of about 1 TeV is created in central collisions. An energy density of about 3GeV/fm 3 is estimated for near head-on collisions. Only statistical fluctuations are seen in the ratio of electromagnetic to hadronic transverse energy. copyright 1995 The American Physical Society

  14. Study of the threshold anomaly in the scattering of polarized 7Li from 208Pb

    International Nuclear Information System (INIS)

    Martel, I.; Gomez-Camacho, J.; Blyth, C.O.; Davis, N.J.; Rusek, K.; Connell, K.A.; Lilley, J.S.; Bailey, M.W.

    1995-01-01

    Experimental data on elastic and inelastic analysing powers T 20 and inelastic cross sections for the scattering of polarized 7 Li from a 208 Pb target are presented. The experimental data are analyzed with DWBA and coupled channels calculations, which show the sensitivity of the experimental data to the real and imaginary parts of the nuclear transition form factor. This study reveals the existence of a threshold anomaly for the transition terms of the interaction. ((orig.))

  15. The quadrupole moment of the first 3- state in 208Pb

    International Nuclear Information System (INIS)

    Joye, A.M.R.; Baxter, A.M.; Fewell, M.P.; Kean, D.C.; Spear, R.H.

    1977-04-01

    The B(E3; 0 + →3 - ) and quadrupole moment, Qsub(3 - ), of the first excited state of 208 Pb have been measured by the reorientation effect in Coulomb excitation, giving B(E3; 0 + →3 - ) = 0.665 +- E 2 B 3 and Qsub(3 - ) = -0.42 +- 0.32 EB. This value for Qsub(3 - ) is much smaller in magnitude than those obtained by Barnett et al., and is consistent with most theoretical predictions. (Author)

  16. Magnetic susceptibility and M1 transitions in /sup 208/Pb. [Sum rules

    Energy Technology Data Exchange (ETDEWEB)

    Traini, M; Lipparini, E; Orlandini, G; Stringari, S [Dipartimento di Matematica e Fisica, Universita di Trento, Italy

    1979-04-16

    M1 transitions in /sup 208/Pb are studied by evaluating energy-weighted and inverse energy-weighted sum-rules. The role of the nuclear interaction is widely discussed. It is shown that the nuclear potential increases the energy-weighted sum rule and lowers the inverse energy-weighted sum rule, with respect to the prediction of the pure shell model. Values of strengths and excitation energies are compared with experimental results and other theoretical calculations.

  17. Spreading effects on the isovector dipole strength distribution in 208Pb

    International Nuclear Information System (INIS)

    Adachi, S.; Nguyen van Giai

    1984-01-01

    There is seemingly a difficulty with all Hartree-Fock RPA calculations to describe correctly the distribution of dipole strength in heavy nuclei above the giant dipole region. We investigate in a consistent framework the effects of damping into more complex configurations. We show that in 208 Pb, this damping leads to a smooth distribution at higher energies while it gives a satisfactory description of the spreading width of the giant dipole resonance. (orig.)

  18. The 208Pb(7Li,6He)209Bi reaction at 52 MeV

    International Nuclear Information System (INIS)

    Zeller, A.F.; Weisser, D.C.; Ophel, T.R.; Hebbard, D.F.

    1979-11-01

    Single proton transfers to low lying levels in 209 Bi from the 208 Pb(7Li, 6 He) reaction at 52 MeV have been measured and spectroscopic factors derived from an EFR-DWBA analysis. Relative spectroscopic factors are in good agreement with light ion results and previous heavy ion work. Absolute spectroscopic factors were generally too large and the peaks of the angular distributions were out of phase with the DWBA calculations by 1 0 - 4 0

  19. A simple functional form for proton-208Pb total reaction cross sections

    International Nuclear Information System (INIS)

    Majumdar, S.; Deb, P.K.; Amos, K.

    2001-01-01

    A simple functional form has been found that gives a good representation of the total reaction cross sections for the scattering from 208 Pb of protons with energies in the range 30 to 300 MeV. The ratios of the total reaction cross sections calculated under this approximations compared well (to within a few percent) to those determined from the microscopic optical model potentials

  20. Cluster folding-model for quasi-elastic scattering of 23Na from 208Pb

    International Nuclear Information System (INIS)

    Kabir, A.; Johnson, R.C.; Tostevin, M.H.

    1991-01-01

    A cluster model of 23 Na is used to calculate the 23 Na-target interaction potentials by folding the cluster wavefunction with the cluster-target interaction potentials. Coupled channels calculations are carried out for the quasi-elastic scattering of polarized 23 Na from 208 Pb at 170 MeV and compared with recent experiments. Qualitative agreement with experiment is obtained when the interaction is adjusted by a single overall normalization constant. (author)

  1. Comment on ''Energy partition in near-barrier strongly damped collisions 58Ni+208Pb''

    International Nuclear Information System (INIS)

    Viola, V.E.; Kwiatkowski, K.; Breuer, H.; Planeta, R.

    1993-01-01

    Chatterjee et al. [Phys. Rev. C 44, R2249 (1991)] report that the sharing of dissipated energy in the 58 Ni + 208 Pb reaction at E/A=6.5 MeV is not influenced appreciably by the direction and magnitude of net charge (and mass) transfer. We point out that neither this conclusion nor one arguing for a correlation between mass flow and excitation energy division is supported by the data and analysis presented in their communication

  2. Nuclear structure from N ≅ Z to N > Z - 100Sn, 78Ni, 208Pb

    International Nuclear Information System (INIS)

    Grawe, H.; Gorska, M.; Rejmund, M.; Pfuetzner, M.; Brown, B.A.; Maier, K.H.

    1998-07-01

    The single particle (hole) energies in 100 Sn, as extrapolated by a shell model analysis of the neighbouring nuclei, show a remarkable similarity to those in 56 Ni, one major shell lower. This is borne out in nearly identical I π =2 + excitation energies, implying E(2 + )≅3 MeV in 100 Sn, and a large neutron effective E2 charge e≥1.6e. In contrast a small proton polarisation charge δe≤0.3e is found, pointing to a large isovector charge. In 104 Sn for the first time in this region strong E3 transitions with B(E3)≥17 Wu were identified, indicating E(3 - )≅3 MeV in 100 Sn. Isomer spectroscopy beyond 68 Ni following fragmentation of a 60.3 A MeV 86 Kr beam has provided first evidence on the neutron polarisation charge and the occupation of the νg 9/2 orbital beyond N=40, which is at variance with shell model calculations using realistic interactions. The N=40 subshell effect seen in E(2 + ) is not borne out in 2n separation energies. On the other hand the νg 9/2 -f 5/2 splitting of single quasiparticle energies in Ni, Fe and Cr isotopes, as deduced from M2 isomers, give no hint for deformation at Z 208 Pb a number of new isomers were observed in the fragmentation of a 1000 A MeV 238 U beam, while 3 - excitations on high spin configurations in and adjacent to 208 Pb were identified in inelastic collisions of 208 Pb+ 208 Pb. E2 and E3 strengths from stretched configurations are compared to model expectations. (orig.)

  3. Single nucleotide polymorphisms in ZNF208 are associated with increased risk for HBV in Chinese people.

    Science.gov (United States)

    Li, Hengxin; Chen, Jun; Zhang, RuiZhi; Xu, Ran; Zhang, Zhe; Ren, Le; Yang, Qi; Tian, Yumei; Li, Daxu

    2017-12-22

    Single nucleotide polymorphisms (SNPs) in ZNF208 may be associated with susceptibility to Hepatitis B virus (HBV). In the current study, we analyzed the association between ZNF208 SNPs and risk of HBV in 242 HBV patients and 300 healthy subjects from the Xi'an area of Chinese Han Population. Of the five SNPs examined, rs2188971 (OR: 1.36, 95% CI: 1.04-1.76, P = 0.022), rs8103163 (OR: 1.40, 95% CI: 1.08-1.82, P = 0.010) and rs7248488 (OR: 1.38, 95% CI: 1.07-1.79, P = 0.014) were correlated with HBV susceptibility based on Chi-square tests. After the P -values were adjusted by Bonferroni correction, there only rs8103163 ( P = 0.050) was slightly with increased HBV risk. Additionally, haplotype A rs2188972 T rs2188971 A rs8103163 A rs7248488 (OR = 1.42; 95% C I, 1.10-1.85; P = 0.008) was found to increase susceptibility of suffering from HBV. These findings suggest that ZNF208 polymorphisms may contribute to the development of HBV.

  4. The First Outbreak Caused by Acinetobacter baumannii ST208 and ST195 in China

    Directory of Open Access Journals (Sweden)

    Junyan Qu

    2016-01-01

    Full Text Available This study aimed to analyze the clinical characteristics of patients and molecular mechanisms of the first outbreak mainly caused by sequence types (STs 208 multidrug resistant (MDR Acinetobacter baumannii in China. A total of 10 clinical samples were collected from 5 patients who were involved in the outbreak. Bacterial identification and antibiotic sensitivity tests were performed by the VITEK-2 COMPACT automated system. MICs of tigecycline for clinical isolates were determined using broth microdilution. The clonal relatedness of A. baumannii clinical isolates in our local settings was determinated by pulsed-field gel electrophoresis (PFGE and multilocus sequence typing (MLST. A total of 7 A. baumannii strains were isolated and all were MDR strains; two of them were carbapenem-nonsusceptible strains. blaOXA-23 was the only acquired carbapenemase gene in the isolates. The isolates belonged to a single clonal pulsotype determined by PFGE and two sequences types (STs determined by MLST. The isolates belonged to the globally disseminated clonal complex 92, among which ST195 and ST208 were the most common sequence types (71.43% and 28.57%. The outbreak was successfully controlled by stringent infection control measures, especially improving the hand hygiene compliance and enhancing antimicrobial stewardship. In conclusion, this is the first description of an outbreak caused mainly by A. baumannii of ST208 in China. Infection control measures should be strengthened when infection outbreaks in hospital.

  5. Spectroscopic factors measurement of the five first energy levels of lead 208 nucleus using the 208Pb(e,e'p207Tl* huge pulse transfer reaction

    International Nuclear Information System (INIS)

    Medaglia, R.

    1999-08-01

    In this work, the spectral functions and the spectroscopic factors of the first five energy levels of the lead 208 nucleus have been measured using the 208 Pb(e,e'p) 207 Tl * reaction. The aim is to characterize the effect of the nuclear environment on pulse and energy distributions of protons. In order to minimize the ejected proton-residual nucleus interactions in the final state, the measurement has been performed at 750 and 570 MeV/c pulse transfers, and thus for proton kinetic energies of 263 MeV and 161 MeV, contrarily to a previous measurement performed at 100 MeV. A kinematics with a transverse electromagnetic coupling, instead of a longitudinal one, has been used because of the important coupling dependence observed for medium nuclei. The experiment has been carried out at the NIKHEF electron accelerator and smoothing ring. The pulse distributions of the first five energy levels for a proton pulse range of 0 to 300 MeV/c have been extracted from the (e,e'p) cross sections. An integration of model-dependent distributions gives the spectroscopic factors which indicate the number of protons of each level. These data rae compared to models that include both the proton interactions in the final state and the coulomb distortions. The Pavie model reproduces well the observed distributions and the transfer dependence, while the Ohio model does not. The spectroscopic factors obtained with the Pavie model are the same for both transfers and are 20% higher as an average than the previous experiment performed at 450 MeV/c. However, they are 30% below the shell model. The uncertain estimation of the reaction mechanisms does not allow to consider this reduction as being due exclusively to nuclear structure effects. (J.S.)

  6. Phase-shift analysis of neutron-209Bi scattering and its comparison to neutron-208Pb scattering

    International Nuclear Information System (INIS)

    Chen, Z.P.; Tornow, W.; Walter, R.L.

    1995-01-01

    Published n- 209 Bi elastic differential cross-section, analyzing power, and total cross-section data in the energy range from 1.5 to 14 MeV were analyzed via a phase-shift analysis in order to find out whether these data show similar, unexplained resonance structures as observed recently for n- 208 Pb scattering. Although the n- 209 Bi and n- 208 Pb data are very similar, some of the phase shifts are quite different for the two systems. Only one resonancelike structure was observed for n- 209 Bi scattering in the excitation energy range from 9 to 18 MeV compared to eleven in the n- 208 Pb system, implying that n- 209 Bi data are probably more suitable than the classical n- 208 Pb system for detailed mean-field analyses approached through dispersion-relation optical models

  7. 5 CFR 892.208 - Can I change my enrollment from self and family to self only at any time?

    Science.gov (United States)

    2010-01-01

    ... MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL FLEXIBLE BENEFITS PLAN: PRE-TAX PAYMENT OF HEALTH BENEFITS PREMIUMS Eligibility and Participation § 892.208 Can I change my enrollment from...

  8. Coupled-channels analyses for 9,11Li + 208Pb fusion reactions with multi-neutron transfer couplings

    Science.gov (United States)

    Choi, Ki-Seok; Cheoun, Myung-Ki; So, W. Y.; Hagino, K.; Kim, K. S.

    2018-05-01

    We discuss the role of two-neutron transfer processes in the fusion reaction of the 9,11Li + 208Pb systems. We first analyze the 9Li + 208Pb reaction by taking into account the coupling to the 7Li + 210Pb channel. To this end, we assume that two neutrons are directly transferred to a single effective channel in 210Pb and solve the coupled-channels equations with the two channels. By adjusting the coupling strength and the effective Q-value, we successfully reproduce the experimental fusion cross sections for this system. We then analyze the 11Li + 208Pb reaction in a similar manner, that is, by taking into account three effective channels with 11Li + 208Pb, 9Li + 210Pb, and 7Li + 212Pb partitions. In order to take into account the halo structure of the 11Li nucleus, we construct the potential between 11Li and 208Pb with a double folding procedure, while we employ a Woods-Saxon type potential with the global Akyüz-Winther parameters for the other channels. Our calculation indicates that the multiple two-neutron transfer process plays a crucial role in the 11Li + 208Pb fusion reaction at energies around the Coulomb barrier.

  9. Decay of the isoscalar giant monopole resonance in 208Pb and 238U

    International Nuclear Information System (INIS)

    Woude, A. van der

    1985-01-01

    In this paper, the neutron decay of the giant monopole resonance (GMR) of 208 Pb and the alpha decay of the GMR of 238 U is studied. The GMR is excited by inelastic alpha-scattering at small angles (0-3deg) using 120 MeV alpha particles. The interference of other processes like the knock-out process with the particle decay of these resonances is considered. Coincidence neutron and alpha spectra are presented, as well as E2/E0 strength distributions. (Auth.)

  10. Atipias de Células Escamosas de Significado Indeterminado (ASCUS): estudo de 208 Casos

    OpenAIRE

    Eleutério Junior, José; Cavalcante, Diane Isabelle Magno; Dias, Maria Tereza M. P.; Alves, Rossana M.; Queiroz, Gabriela C.; Proença, Aline R.

    2000-01-01

    Objetivos: avaliar aspectos clínicos, colposcópicos e acompanhamento citológico de quadros classificados como atipias de células escamosas de significado indeterminado (ASCUS). Métodos: foram analisados retrospectivamente 208 casos de ASCUS diagnosticados entre 1996 e 1998 e tabulados quanto a idade, queixas clínicas, colposcopia e seguimento. Resultados: a relação ASCUS:lesão intra-epitelial escamosa foi de 1:1,2, confirmando adequado controle de qualidade. Pacientes com menos de 35 anos cor...

  11. Nucleon transfer reactions to rotational states induced by 206,208PB projectiles

    International Nuclear Information System (INIS)

    Wollersheim, H.J.; DeBoer, F.W.N.; Emling, H.; Grein, H.; Grosse, E.; Spreng, W.; Eckert, G.; Elze, Th.W.; Stelzer, K.; Lauterbach, Ch.

    1986-01-01

    In a systematic study of nucleon transfer reactions accompanied by Coulomb excitation the authors bombarded 152 Sm, 160 Gd and 232 Th with 206, 208 Pb beams at incident energies close to the Coulomb barrier. Particle-gamma coincidence techniques were used to identify excited states of reaction products populated through inelastic scattering and in nucleon transfer reactions. Large cross sections were observed for one- and two-neutron pick-up from 232 Th at an incident energy of 6.4 MeV/μ. The results are analyzed in the framework of semiclassical models

  12. Electric dipole response of {sup 208}Pb and constraints on the symmetry energy

    Energy Technology Data Exchange (ETDEWEB)

    Tamii, A. [Research Center for Nuclear Physics, Osaka University, 10-1 Mihogaoka, Ibaraki 567-0047 (Japan)

    2014-05-02

    The electric dipole (E1) response of {sup 208}Pb has been precisely determined by measuring polarized proton inelastic scattering at very forward angles including zero degrees. The electric dipole polarizability, that is defined as the inverse energy-weighted sum rule of the E1 reduced transition strength, has been extracted as α{sub D} = 20.1 ±0.6 fm{sup 3}. A constraint band has been extracted in the plane of the symmetry energy (J) and its slope parameter (L) at the saturation density.

  13. Microscopic optical potential for 208Pb in the nuclear structure approach

    International Nuclear Information System (INIS)

    Bernard, V.; Nguyen Van Gai.

    1979-04-01

    The optical potential for nucleon- 208 Pb scattering below 30 MeV is calculated microscopically as the sum of a real Hartree-Fock term and a complex correction term arising from the coupling to excited states of the target. The Skyrme effective interaction is used to generate the Hartree-Fock field, the RPA excited states and the coupling. A complex local equivalent potential is defined and used to calculate scattering and absorption cross-sections. The real part of the optical potential is reasonably well described in this approach while the imaginary part is too weak. Inclusion of rearrangement processes could improve the agreement with experiment

  14. Fission threshold determination of 209Bi and sup(204,206,207,208)Pb by electrofission

    International Nuclear Information System (INIS)

    Tuerck, D.

    1975-01-01

    At the Darmstadt electron linear accelerator the cross sections for the electrofission of 209 Bi were measured for electron energies between 24 and 70 MeV, for the separated lead isotopes sup(204,206,207,208)Pb between 38 and 50 MeV. For the determination of the fission thresholds the cross sections were examined by the virtuel photon method using calculations in first Born approximation for the point nucleus with Coulomb wave functions. The analytic functions fitting the fission probability were based on level densities after the Fermi-gas-model. (orig./WL) [de

  15. Experimental and theoretical investigations of the decays of 206Fr and 208Fr

    International Nuclear Information System (INIS)

    Ritchie, B.G.

    1979-01-01

    206 Fr and 208 Fr were mass separated and observed with large-volume semiconductor detectors in calibrated geometries. Alpha, gamma, and electron singles and gamma-gamma and gamma-electron coincidence data were taken. The alpha decay experiments permitted the determination of the alpha branching ratios for 206 208 Fr as well as 205 207 Fr. The method used includes the information obtained from the electron capture decay studies of those nuclei. The alpha branching ratios obtained are generally higher than those reported previously. Energies and half-lives are in general agreement with previous measurements. The alpha measurements also revealed the presence of a heretofore unobserved alpha-emitting isomer in 206 Fr. The isomer has a half-life of 0.7 +- 0.1 seconds, and the energy of the associated alpha decay is 6.930 +- 0.005 MeV. Gamma data taken with the alpha measurements suggest that the isomeric level is 531 keV above the 206 Fr ground state, with the associated alpha decay populating a level at 391 keV in the 202 At nucleus. Measured alpha branching ratios were analyzed with the Rasmussen reduced width formalism. All observed francium decays were deduced to be unhindered. This study produced detailed level schemes for 206 Rn and 208 Rn. The gamma and electron data permitted the determination of internal conversion coefficients, multipolarities, spins, and parities. It appears from systematics that two different bands of states above J/sup π/ = 4+ are populated by in-beam studies. The deduced level scheme of 208 Rn was studied in the interacting boson approximation (IBA) with the computer code PHINT. The level scheme is readily explained with this model up to around 2 MeV. Good agreement between theory and experiment was also obtained for 204 Rn and 206 Rn, but the limited detail in these decay schemes does not provide conclusive evidence for the applicability of the IBA. 28 figures, 10 tables

  16. Radiogenic lead with dominant content of {sup 208}Pb: New coolant and neutron moderator for innovative nuclear reactors

    Energy Technology Data Exchange (ETDEWEB)

    Shmelev, A. N.; Kulikov, G. G.; Kryuchkov, E. F.; Apse, V. A.; Kulikov, E. G. [National Research Nuclear Univ. MEPhI, Kashirskoe shosse, 31, 115409, Moscow (Russian Federation)

    2012-07-01

    The advantages of radiogenic lead with dominant content of {sup 208}Pb as a reactor coolant with respect to natural lead are caused by unique nuclear properties of {sup 208}Pb which is a double-magic nucleus with closed proton and neutron shells. This results in significantly lower micro cross section and resonance integral of radiative neutron capture by {sup 208}Pb than those for numerous light neutron moderators. The extremely weak ability of {sup 208}Pb to absorb neutrons results in the following effects. Firstly, neutron moderating factor (ratio of scattering to capture cross sections) is larger than that for graphite and light water. Secondly, age and diffusion length of thermal neutrons are larger than those for graphite, light and heavy water. Thirdly, neutron lifetime in {sup 208}Pb is comparable with that for graphite, beryllium and heavy water what could be important for safe reactor operation. The paper presents some results obtained in neutronics and thermal-hydraulics evaluations of the benefits from the use of radiogenic lead with dominant content of {sup 208}Pb instead of natural lead as a coolant of fast breeder reactors. The paper demonstrates that substitution of radiogenic lead for natural lead can offer the following benefits for operation of fast breeder reactors. Firstly, improvement of the reactor safety thanks to the better values of coolant temperature reactivity coefficient and, secondly, improvement of some thermal-hydraulic reactor parameters. Radiogenic lead can be extracted from thorium sludge without isotope separation as {sup 208}Pb is a final isotope in the decay chain of {sup 232}Th. (authors)

  17. Evolution of fast reactor core spectra in changing a heavy liquid metal coolant by molten PB-208

    Energy Technology Data Exchange (ETDEWEB)

    Blokhin, D. A.; Mitenkova, E. F. [Nuclear Safety Inst., Russian Academy of Sciences, B. Tulskaya 52, Moscow, 115119 (Russian Federation); Khorasanov, G. L.; Zemskov, E. A.; Blokhin, A. I. [State Scientific Center, Russian Federation, Inst. of Physics and Power Engineering, Bondarenko Square 1, Obninsk, 249033 (Russian Federation)

    2012-07-01

    In the paper neutron spectra of fast reactor cooled with lead-bismuth or lead-208 are given. It is shown that in changing the coolant from lead-bismuth to lead-208 the core neutron spectra of the fast reactor FR RBEC-M are hardening in whole by several percents when a little share of low energy neutrons (5 eV - 50 keV) is slightly increasing. The shift of spectra to higher energies permits to enhance the fuel fission while the increased share of low energy neutrons provides more effective conversion of uranium-238 into plutonium due to peculiarity of {sup 238}U neutron capture cross section. Good neutron and physical features of molten {sup 208}Pb permit to assume it as perspective coolant for fast reactors and accelerator driven systems. The one-group cross sections of neutron radiation capture, {sigma}(n,g), by {sup 208}Pb, {sup 238}U, {sup 99}Tc, mix of lead and bismuth, {sup nat}Pb-Bi, averaged over neutron spectra of the fast reactor RBEC-M are given. It is shown that one-group cross sections of neutron capture by material of the liquid metal coolant consisted from lead enriched with the stable lead isotope, {sup 208}Pb, are by 4-7 times smaller {sigma}(n,g) for the coolant {sup nat}Pb-Bi. The economy of neutrons in the core cooled with {sup 208}Pb can be used for reducing reactor's initial fuel load, increasing fuel breeding and transmutation of long lived fission products, for example {sup 99}Tc. Good neutron and physical features of lead enriched with {sup 208}Pb permit to consider it as a perspective low neutron absorbing coolant for fast reactors and accelerator driven systems. (authors)

  18. Identification of rotating and vibrating tetrahedrons in the heavy nucleus {sup 208}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Heusler, A.

    2017-11-15

    Ten known states in the heavy nucleus {sup 208}Pb at 2.6 < E{sub x} < 7.9 MeV are described by rotating and vibrating tetrahedrons. The 3{sup -} and 4{sup +} yrast states are the first members of the rotational band. A 2{sup ±} doublet state with the 2{sup +} yrast state as one member and the newly recognized 2{sup -} yrast state as the other member, the 1{sup -} yrast state, and the third 0{sup +} state are the heads of the three elementary tetrahedral rotating and vibrating bands. The newly recognized state at E{sub x} = 4142 keV was assigned spin 2 in 1975 and is suggested to have negative parity by the absent {sup 208}Pb(α, α{sup '}) excitation. Four more states at 5.7 < E{sub x} < 7.9 MeV are identified as the next members of the three elementary tetrahedral rotating and vibrating bands. The ambiguous spin assignment to the state at E{sub x} = 7020 keV is settled with 3{sup -}, the state at E{sub x} = 7137 keV is assigned 4{sup -}. (orig.)

  19. Note on neutron scattering and the optical model near A = 208

    International Nuclear Information System (INIS)

    Guenther, P.; Havel, D.; Smith, A.

    1976-09-01

    Elastic neutron scattering cross sections of 206 Pb, 207 Pb, 208 Pb and 209 Bi are measured at incident neutron energy intervals of approx. 25 keV from 0.6 to 1.0 MeV with resolutions of approx. 25 keV. Optical model parameters are obtained from the energy-averaged experimental results for each of the isotopes. The observed elastic-neutron-scattering distributions and derived parameters for the lead isotopes (doubly magic or neutron holes in the closed shell) tend to differ from those of 209 Bi (doubly closed shell plus a proton). These potentials, derived in the approx. spherical region of A approximately 208, are extrapolated for the analysis of total and scattering cross sections of 238 U introducing only a small N-Z/A dependence and the known deformation of 238 U. Good descriptions of 238 U total cross sections are obtained from a few hundred keV to 10.0 MeV and the prediction of measured scattering distributions in the low MeV region are as suitable as frequently reported with other specially developed potentials

  20. Recovery of lead-208 radiogenic of residues of thorium with rare earth

    International Nuclear Information System (INIS)

    Ferreira, J.C.; Freitas, A.A. de; Seneda, J.A.F.; Carvalho, M.S. de; Abrao, A.

    2008-01-01

    In the middle of the years 1970 in IPEN, considerable work for the purification and conversion of uranium and thorium project, the production of thorium nitrate, a pilot scale from different compounds of Thorium was accomplished; This installation of thorium nitrate produced for national marketing, given the industry of incandescent lighting gas mangles.. The method used by this installation was the purification by solvent extraction with pulsed columns. The thorium was in the organic phase, which was reversed as of thorium nitrate with a high degree of purity. The aqueous phase of this chemical process, containing impurities, some not extracted thorium and virtually all rare earths was precipitated in the form of a hydroxide. This was called RETOTER hydroxide (residue of Thorium and Rare Earth). This residue containing thorium, rare earth and some impurities such as lead-208 product of the decay of thorium-232 were stored in the shed of safeguarding IPEN for further recovery of thorium and rare earth. In this work was studied the recovery of lead-208, nuclear material of interest, separating it by the technique of cementation , where it adds zinc metallic to an acid solution of RETOTER, holding up the lead on the surface of the metallic zinc. (author)

  1. Measurement of the Parity Violating Asymmetry in Elastic Electron Scattering off 208Pb

    Energy Technology Data Exchange (ETDEWEB)

    Wexler, Jonathan [Univ. of Massachusetts, Amherst, MA (United States)

    2014-09-01

    The Lead Radius Experiment (PREX) was carried out in order to provide a model-independent measurement of the RMS radius √<$2\\atop{n}$> of the neutron distribution in the 208Pb nucleus. The parity-violating scattering asymmetry for longitudinally polarized 1.06 GeV electrons from an unpolarized 208Pb target was measured at Q2 = 0.00880 GeV2. This measurement was performed by the PREX collaboration in Hall A at Jefferson Laboratory in Newport News, VA, between March and June, 2010. The electron detectors used in this measurement were designed and fabricated by University of Massachusetts-Amherst and Smith College. The resulting parity-violating asymmetry was measured as APV = 656±60(stat.)±14(sys.) ppb. This asymmetry extrapolates to a difference in radii between the nuclear neutron and proton distributions of √<$2\\atop{n}$>-√<$2\\atop{p}$>=0.33$+0.16\\atop{-0.18}$ fm.

  2. The FIREBall-2 UV sample grating efficiency at 200-208nm

    Science.gov (United States)

    Quiret, S.; Milliard, B.; Grange, R.; Lemaitre, G. R.; Caillat, A.; Belhadi, M.; Cotel, A.

    2014-07-01

    The FIREBall-2 (Faint Intergalactic Redshifted Emission Balloon-2) is a balloon-borne ultraviolet spectro-imaging mission optimized for the study of faint diffuse emission around galaxies. A key optical component of the new spectrograph design is the high throughput cost-effective holographic 2400 ℓ =mm, 110x130mm aspherized reflective grating used in the range 200 - 208nm, near 28°deviation angle. In order to anticipate the efficiency in flight conditions, we have developed a PCGrate model for the FIREBall grating calibrated on linearly polarized measurements at 12° deviation angle in the range 240-350nm of a 50x50mm replica of the same master selected for the flight grating. This model predicts an efficiency within [64:7; 64:9]+/-0:7% (S polarization) and [38:3; 45]+/-2:2% (P-polarization) for the baseline aluminum coated grating with an Al2O3 natural oxidation layer and within [63:5; 65] +/-1% (S-polarization) and [51:3; 54:8] +/-2:8% (P-polarization) for an aluminum plus a 70nm MgF2 coating, in the range 200 - 208nm and for a 28°deviation angle. The model also shows there is room for significant improvements at shorter wavelengths, of interest for future deep UV spectroscopic missions.

  3. Study of the three-proton three-neutron-hole nucleus 208At

    International Nuclear Information System (INIS)

    Fant, B.; Weckstroem, T.

    1984-01-01

    Levels in 208 At were populated in the 209 Bi (α, 5n) reaction, and the subsequent radiation was studied using γ-spectroscopic methods including γ-ray excitation function and angular distribution, γγ(t) coincidence and γt measurements, as well as measurements of conversion electrons. The excited spectrum of 208 At is found to consist of two almost disconnected parts which are proposed to originate from seniority-three proton and neutron cascades. Two isometric states are observed. A Tsub(1/2)=45+-2ns state at 1090 keV is proposed to have the main configuration πhsub(9/2)j 0 2 +νsub(13/2) -1 jsub(0+) -2 and Jsup(π)=10 - . A high-spin isomer with Tsub(1/2)=1.5+-0.2 μs at 2276 keV is assigned to be the π(hsub(9/2) 2 isub(13/2))sub(29/2)+νfsub(5/2) -1 jsub(0+) -2 Jsup(π)=16 - state. Shell-model arguments are used to assign configurations to most of the observed levels. Transition rates are discussed. (orig.)

  4. Capture reactions of 40Ca and 48Ca with targets of 197Au and 208Pb

    International Nuclear Information System (INIS)

    Stokstad, R.; Chan, Y.; Chavez, E.

    1988-03-01

    The reactions of 40 Ca and 48 Ca with targets of 197 Au and 208 Pb have been measured in the region from below the interaction barrier to about twice the barrier energy. The fission-like fragments were detected in a pair of position-sensitive, multi-wire proportional counters and were identified from measurements of position and time using two-body kinematics. In the region above the barrier the cross sections for capture are less than those given by the touching condition, indicating that an /open quotes/extra push/close quotes/ is required to induce capture. The observations for 40 Ca and 48 Ca show different fissilities for the onset of the extra push and indicate that charge equilibration may be an important factor governing capture reactions. Below the barrier the cross sections show an enhancement relative to the prediction for a one dimensional barrier. The enhancements are larger for 40 Ca than for 48 Ca (for both targets) and this is in qualitative agreement with predictions based on the coupling of the relative motion to low-lying collective states. Both above and below the barrier, we find that the change in the light partner, from 48 Ca to 40 Ca, has a larger effect on the cross sections than the change from 208 Pb to 197 Au, after correction for the change in the Coulomb barrier. 16 refs., 7 figs

  5. Luteolin Inhibits Ischemia/Reperfusion-Induced Myocardial Injury in Rats via Downregulation of microRNA-208b-3p.

    Directory of Open Access Journals (Sweden)

    Chen Bian

    Full Text Available Luteolin (LUT, a kind of flavonoid which is extracted from a variety of diets, has been reported to convey protective effects of various diseases. Recent researches have suggested that LUT can carry out cardioprotective effects during ischemia/reperfusion (I/R. However, there have no reports on whether LUT can exert protective effects against myocardial I/R injury through the actions of specific microRNAs (miRs. The purpose of this study was to determine which miRs and target genes LUT exerted such function through.Expression of various miRs in perfused rat hearts was detected using a gene chip. Target genes were predicted with TargetScan, MiRDB and MiRanda. Anoxia/reoxygenation was used to simulate I/R. Cells were transfected by miR-208b-3p mimic, inhibitor and small interfering RNA of Ets1 (avian erythroblastosis virus E26 (v ets oncogene homolog 1. MiR-208b-3p and Ets1 mRNA were quantified by real-time quantitative polymerase chain reaction. The percentage of apoptotic cells was detected by annexin V-fluorescein isothiocyanate/propidium iodide dyeing and flow cytometry. The protein expression levels of cleaved caspase-3, Bcl-2, Bax, and Ets1 were examined by western blot analysis. A luciferase reporter assay was used to verify the combination between miR-208b-3p and the 3'-untranslated region of Ets1.LUT pretreatment reduced miR-208b-3p expression in myocardial tissue, as compared to the I/R group. And LUT decreased miR-208b-3p expression and apoptosis caused by I/R. However, overexpression of miR-208b-3p further aggravated the changes caused by I/R and blocked all the effects of LUT. Knockdown of miR-208b-3p expression also attenuated apoptosis, while knockdown of Ets1 promoted apoptosis. Further, the luciferase reporter assay showed that miR-208b-3p could inhibit Ets1 expression.LUT pretreatment conveys anti-apoptotic effects after myocardial I/R injury by decreasing miR-208b-3p and increasing Ets1 expression levels.

  6. Atipias de Células Escamosas de Significado Indeterminado (ASCUS: estudo de 208 Casos Atypical Squamous Cells of Undetermined Significance (ASCUS: study of 208 Cases

    Directory of Open Access Journals (Sweden)

    José Eleutério Junior

    2000-04-01

    Full Text Available Objetivos: avaliar aspectos clínicos, colposcópicos e acompanhamento citológico de quadros classificados como atipias de células escamosas de significado indeterminado (ASCUS. Métodos: foram analisados retrospectivamente 208 casos de ASCUS diagnosticados entre 1996 e 1998 e tabulados quanto a idade, queixas clínicas, colposcopia e seguimento. Resultados: a relação ASCUS:lesão intra-epitelial escamosa foi de 1:1,2, confirmando adequado controle de qualidade. Pacientes com menos de 35 anos corresponderam a 72,6% dos casos. Um grande número não tinha queixas clínicas (36,5%. Nos casos em que foi realizada colposcopia (n = 58, a zona de transformação atípica foi observada em 60%. A subclassificação das ASCUS em provavelmente displásico (D, provavelmente reativo (R e não-determinado (U indicou predominância do primeiro (65%. O acompanhamento de 86 pacientes mostrou que, após 3 a 6 meses (média de 4,5 meses, em 12,5% foi possível detectar citologicamente uma lesão intra-epitelial escamosa. Conclusão: com base nos resultados deste trabalho foi possível concluir que as ASCUS incidem em mulheres jovens, com queixas clínicas corriqueiras e apresentam correlação colposcópica positiva. Nestes casos o acompanhamento citológico se faz imprescindível para esclarecimento de lesão intra-epitelial escamosa subjacente ou subseqüente.Purpose: to assess clinical, colposcopic profile and follow-up of patients with a cytological report of atypical squamous cells of undetermined significance (ASCUS. Methods: a total of 208 cases of ASCUS diagnosed between 1996 e 1998 were analyzed retrospectively regarding age, symptoms, colposcopy and follow-up. Results: the ASCUS:SIL (squamous intraepithelial lesion ratio reported was 1:1.2, showing an adequate quality control. Most of the patients were between 15 and 35 years old (72.6 %. The majority referred no symptoms (36.5 %. The colposcopy showed (n = 58 the atypical zone of transformation in

  7. Precise determination of the neutron scattering length of lead isotopes 204Pb,207Pb and 208Pb by neutron interferometry

    International Nuclear Information System (INIS)

    Ioffe, A.; Ermakov, O.; Karpikhin, I.; Krupchitsky, P.; Mikula, P.; Lukas, P.; Vrana, M.

    2000-01-01

    The neutron scattering length of lead isotopes 204 Pb, 207 Pb and 208 Pb are determined by a set of neutron interferometry experiments. The obtained values b (208) =9.494(30) fm, b (207) =9.286(16) fm, b (204) =10.893(78) fm have much higher accuracy then current table data. Together with the precise value of b for natural lead, these results represent a complete set of data and allow one to calculate b (206) =9.221(69) fm, which is in the very good agreement with the present day experimental value. (orig.)

  8. Observation of excited states and isomeric decays in doubly-odd 208Fr

    International Nuclear Information System (INIS)

    Kanjilal, D.; Bhattacharya, S.; Goswami, A.; Kshetri, R.; Raut, R.; Saha, S.; Bhowmik, R.K.; Gehlot, J.; Jnaneswari, G.; Muralithar, S.; Singh, R.P.; Mukherjee, B.; Mukherjee, G.

    2009-01-01

    The nuclei near the doubly magic 208 Pb are predicted to exhibit various interesting structural phenomena, one of which is a wealth of isomerism. However, a detailed study of high spin states of 211, 212, 213 Fr has already been done. Structure of such trans-Lead nuclei can be interpreted in terms of the shell model states, and the high spin states of these nuclei are interpreted. One of the major interests in the spectroscopic investigation of these nuclei is the role played by the i 13/2 state in creating isomeric levels which decay through transitions of higher muiltipolarity, or are hindered by the close proximity of the levels below. A systematic study of these nuclei will possibly reveal many other interesting structural features

  9. High spin states and isomeric decays in doubly-odd 208Fr

    International Nuclear Information System (INIS)

    Kanjilal, D.; Bhattacharya, S.; Goswami, A.; Kshetri, R.; Raut, R.; Saha, S.; Bhowmik, R.K.; Gehlot, J.; Muralithar, S.; Singh, R.P.; Jnaneswari, G.; Mukherjee, G.; Mukherjee, B.

    2010-01-01

    Neutron deficient isotopes of francium (Z=87, N∼121-123) as excited nuclei were produced in the fusion-evaporation reaction: 197 Au( 16 O, xn) 213-x Fr at 100 MeV. The γ rays from the residues were observed through the high sensitivity Germanium Clover detector array INGA. The decay of the high spin states and the isomeric states of the doubly-odd 208 Fr nuclei, identified from the known sequence of ground state transitions, were observed. The half-lives of the E γ =194(2) keV isomeric transition, known from earlier observations, was measured to be T 1/2 =233(18) ns. A second isomeric transition at E γ =383(2) keV and T 1/2 =33(7) ns was also found. The measured half-lives were compared with the corresponding single particle estimates, based on the level scheme obtained from the experiment.

  10. Two-phonon giant resonances in 136Xe, 208Pb, and 238U

    International Nuclear Information System (INIS)

    Boretzky, K.; Gruenschloss, A.; Ilievski, S.; Adrich, P.; Aumann, T.; Bertulani, C.A.; Cub, J.; Dostal, W.; Eberlein, B.; Elze, T.W.; Emling, H.; Fallot, M.; Holeczek, J.; Holzmann, R.; Kozhuharov, C.; Kratz, J.V.; Kulessa, R.; Leifels, Y.; Leistenschneider, A.; Lubkiewicz, E.; Mordechai, S.; Ohtsuki, T.; Reiter, P.; Simon, H.; Stelzer, K.; Stroth, J.; Suemmerer, K.; Surowiec, A.; Wajda, E.; Walus, W.

    2003-07-01

    The excitation of the double-phonon giant dipole resonance was observed in heavy projectile nuclei impinging on targets of high nuclear charge with energies of 500-700 MeV/nucleon. New experimental data are presented for 136 Xe and 238 U together with further analysis of earlier data on 208 Pb. Differential cross sections dσ/dE * and dσ/dθ for electromagnetic excitations were deduced. Depending on the isotope, cross sections appear to be enhanced in comparison to those expected from a purely harmonic nuclear dipole response. The cumulative effect of excitations of two-phonon states composed of one dipole and one quadrupole phonon, of predicted anharmoniticies in the double-phonon dipole response, and of damping of the dipole resonance during the collision may account for the discrepancy. In addition, decay properties of two-phonon resonances were studied and compared to that of a statistical decay. (orig.)

  11. The investigation of inhalational allergen in 208 asthmatic infants and children

    International Nuclear Information System (INIS)

    Xie Yonggang; Zhang Yi; Liu Jian

    2002-01-01

    The aim of the study was to investigate the inhalational allergen in 208 asthmatic infants and children with allergen steep puncturing skin. The positive cases were 169(81.25%). There were 18 inhalational allergens in allergen steep. The positive rate of the dust acarus was 78.85%, and the dust was 35.58%, the smoke was 32.69% among the allergens. There was not any positive reaction in other allergens. There were no sexual differences in the positive rate. There was nothing with hypersusceptibility of the individual and the family. The positive rate of the infant was less than the child. There was significant difference of the positive rate in the age group (P < 0.01). The result indicated that dust acarus, air pollution or passive smoke was the quite dangerous factor in the many factors of the asthma. It was very important to strengthen the study of the infant and child prevention and cure

  12. 11Li Breakup on 208 at energies around the Coulomb barrier.

    Science.gov (United States)

    Fernández-García, J P; Cubero, M; Rodríguez-Gallardo, M; Acosta, L; Alcorta, M; Alvarez, M A G; Borge, M J G; Buchmann, L; Diget, C A; Falou, H A; Fulton, B R; Fynbo, H O U; Galaviz, D; Gómez-Camacho, J; Kanungo, R; Lay, J A; Madurga, M; Martel, I; Moro, A M; Mukha, I; Nilsson, T; Sánchez-Benítez, A M; Shotter, A; Tengblad, O; Walden, P

    2013-04-05

    The inclusive breakup for the (11)Li + (208)Pb reaction at energies around the Coulomb barrier has been measured for the first time. A sizable yield of (9)Li following the (11)Li dissociation has been observed, even at energies well below the Coulomb barrier. Using the first-order semiclassical perturbation theory of Coulomb excitation it is shown that the breakup probability data measured at small angles can be used to extract effective breakup energy as well as the slope of B(E1) distribution close to the threshold. Four-body continuum-discretized coupled-channels calculations, including both nuclear and Coulomb couplings between the target and projectile to all orders, reproduce the measured inclusive breakup cross sections and support the presence of a dipole resonance in the (11)Li continuum at low excitation energy.

  13. 11Li Breakup on 208Pb at Energies Around the Coulomb Barrier

    DEFF Research Database (Denmark)

    Fernández-García, J.P.; Cubero, M.; Rodríguez-Gallardo, M.

    2013-01-01

    The inclusive breakup for the 11Li+208Pb reaction at energies around the Coulomb barrier has been measured for the first time. A sizable yield of 9Li following the 11Li dissociation has been observed, even at energies well below the Coulomb barrier. Using the first-order semiclassical perturbation...... theory of Coulomb excitation it is shown that the breakup probability data measured at small angles can be used to extract effective breakup energy as well as the slope of B(E1) distribution close to the threshold. Four-body continuum-discretized coupled-channels calculations, including both nuclear...... and Coulomb couplings between the target and projectile to all orders, reproduce the measured inclusive breakup cross sections and support the presence of a dipole resonance in the 11Li continuum at low excitation energy....

  14. Fragmentation of polarized 23Na on 208Pb and the random-walk model

    International Nuclear Information System (INIS)

    Clarke, N.M.; Karban, O.; Blyth, C.O.; Choi, H.D.; Hall, S.J.; Roman, S.; Tungate, G.; Cole, A.J.; Davis, N.J.; Shotter, A.C.; Connell, K.A.

    1993-01-01

    Inclusive measurements are presented for the differential cross sections and tensor analyzing powers ( TT 20 and T 20 ) of ions produced by the fragmentation of a beam of polarized 23 Na incident on a 208 Pb target at an energy of 195.5 MeV (8.5 MeV/nucleon). The data are discussed in terms of a simple ''shape-effect'' model, and compared to the predictions of the nuclear random-walk model which has been extended to the calculation of aligned, deformed projectiles. This model reproduces the principal features of the differential cross sections and the trends as a function of mass loss, but gives poorer agreement for the analyzing powers

  15. Characterizing and improving passive-active shufflers for assays of 208-Liter waste drums

    International Nuclear Information System (INIS)

    Rinard, P.M.; Adams, E.L.; Menlove, H.O.; Sprinkle, J.K. Jr.

    1992-01-01

    A passive and active neutron shuffler for 208-L waste drums has been used to perform over 1500 active and 500 passive measurements on uranium and plutonium samples in 28 different matrices. The shuffler is now better characterized and improvements have been implemented or suggested. An improved correction for the effects of the matrix material was devised from flux-monitor responses. The most important cause of inaccuracies in assays is a localized instead of a uniform distribution of fissile material in a drum; a technique for deducing the distribution from the assay data and then applying a correction is suggested and will be developed further. A technique is given to detect excessive amounts of moderator that could make hundreds of grams of 235 U assay as zero grams. Sensitivities (minimum detectable masses) for 235 U with active assays and for 240 Pu eff with passive assays are presented and the effects of moderators and absorbers on sensitivities noted

  16. Reaction dynamics studies for the system 7Be + 208Pb at Coulomb barrier energies

    Directory of Open Access Journals (Sweden)

    Mazzocco M.

    2017-01-01

    Full Text Available The scattering process of the Radioactive Ion Beam 7Be from a 208Pb target was measured at three near-barrier energies. The quasi-elastic angular distributions were analyzed within the framework of the optical model to extract the reaction cross sections. The results are compared with those obtained for the reactions induced by the mirror projectile 7Li and by the lightest particle-stable lithium isotope 6Li on the same target. The angular distributions for the production of the two 7Be constituent clusters, namely 3He and 4He, were also measured. In agreement with what observed for the interaction of 7Be with lighter targets, the production of the heavier helium isotope resulted to be much more abundant than that of its lighter counterpart.

  17. LANDSAT supports data needs for EPA 208 planning. [water quality control and waste treatment management

    Science.gov (United States)

    1979-01-01

    Excerpts from federal legislation and regulations mandating areawide waster treatment management as a means of restoring and maintaining the integrity of the nation's water are presented along with requirements for grants to the states for water quality planning, management, and implementation. Experiences using LANDSAT to identify nonpoint sources of water pollution as well as land/use/land cover features in South Dakota, Kentucky, Georgia, New Jersey, and Texas are described. Present activities suggest that this type of remote sensing is an efficient, effective tool for areawide water quality planning. Interaction with cognizant federal, state, and local government personnel involved in EPA section 208 planning activities can guide the development of new capabilities and enhance their utility and prospect for use.

  18. Multineutron emission cross-sections of Pb-208 and Bi-209 for use in fusion technology

    International Nuclear Information System (INIS)

    Garg, S.

    1995-01-01

    Pb-208 and Bi-209 are considered as promising materials for fusion blankets because of their superior neutron multiplying characteristics. In this paper, emission cross-sections for neutrons, protons, alpha-particles and gamma-rays are investigated for these nuclides in the energy range 8-30 MeV using the framework of the multistep Hauser-Feshbach statistical theory combined with the Kalbach exciton model for the pre-equilibrium decay and the Brink - Axel model of the giant dipole resonance to account for the radiative capture competition. Appropriate optical model potential parameters are selected to evaluate the compound nucleus reaction cross-sections at different neutron incident energies. (n,n'), (n,2n), (n,3n), (n,4n) and the total production cross-sections for neutrons, protons, alpha-particles and gamma-rays are inferred by performing consistent calculations. (author). 22 refs, 3 figs

  19. Reaction dynamics studies for the system 7Be + 208Pb at Coulomb barrier energies

    Science.gov (United States)

    Mazzocco, M.; Boiano, A.; Boiano, C.; La Commara, M.; Manea, C.; Parascandolo, C.; Pierroutsakou, D.; Strano, E.; Torresi, D.; Acosta, L.; Di Meo, P.; Fernandez-Garcia, J. P.; Glodariu, T.; Grebosz, J.; Guglielmetti, A.; Marquinez-Duran, G.; Martel, I.; Nicoletto, M.; Pakou, A.; Sánchez-Benítez, A. M.; Sava, T.; Sgouros, O.; Signorini, C.; Soramel, F.; Soukeras, V.; Stroe, L.

    2017-11-01

    The scattering process of the Radioactive Ion Beam 7Be from a 208Pb target was measured at three near-barrier energies. The quasi-elastic angular distributions were analyzed within the framework of the optical model to extract the reaction cross sections. The results are compared with those obtained for the reactions induced by the mirror projectile 7Li and by the lightest particle-stable lithium isotope 6Li on the same target. The angular distributions for the production of the two 7Be constituent clusters, namely 3He and 4He, were also measured. In agreement with what observed for the interaction of 7Be with lighter targets, the production of the heavier helium isotope resulted to be much more abundant than that of its lighter counterpart.

  20. Evaluation at the medium energy region for Pb-208 and Bi-209

    International Nuclear Information System (INIS)

    Fukahori, Tokio; Pearlstein, S.

    1991-01-01

    Medium energy nuclear data in the 1--1000 MeV range is necessary to accelerator applications which include spallation neutron sources for radioactive waste treatment and accelerator shielding design, medical applications which include isotopes production and radiation therapy, and space applications. For the design of fission and fusion reactors, the nuclear data file for neutrons below 20 MeV is available and well evaluated. Evaluated nuclear data for protons and data in the medium energy region, however, have not been prepared completely. Evaluation in the medium energy region was performed using the theoretical calculation code ALICE-P or experimental data. In this paper, the evaluation of neutron and proton induced nuclear data for Pb-208 and Bi-209 has been performed using ALICE-P, empirical calculations and new systematics for the fission cross section. The evaluated data are compiled for possible inclusion in the ENDF/B-VI High Energy File. 204 refs., 51 figs., 9 tabs

  1. In-medium scaling law and electron scattering from high-spin states in 208Pb

    International Nuclear Information System (INIS)

    Arias de Saavedra, F.; Lallena, A.M.

    1994-01-01

    The effects of the environment modifications in the structure of the low-lying high-spin states of 208 Pb are studied by analyzing how the in-medium scaling law works on the excitation energies, wave functions, and electron scattering form factors corresponding to these states. It is shown that the consideration of f π * in addition to the effective ρ-meson mass does not affect too much most of the states analyzed. However, some of them appear to be extremely sensitive to its inclusion in the residual nucleon-nucleon interaction. As a result, a value of m ρ * /m ρ ∼f π * /f π ∼0.91 gives a good description of the (e,e') form factors of these particular states without any quenching factor. This value is in agreement with the one found for 48 Ca in a similar analysis performed in a previous work

  2. Proton-induced fission cross sections on "2"0"8Pb at high kinetic energies

    International Nuclear Information System (INIS)

    Rodriguez-Sanchez, J.L.; Benlliure, J.; Paradela, C.; Ayyad, Y.; Alvarez-Pol, H.; Cortina-Gil, D.; Pietras, B.; Ramos, D.; Vargas, J.; Taieb, J.; Chatillon, A.; Belier, G.; Boutoux, G.; Gorbinet, T.; Laurent, B.; Martin, J.F.; Pellereau, E.; Casarejos, E.; Rodriguez-Tajes, C.

    2014-01-01

    Total fission cross sections of "2"0"8Pb induced by protons have been determined at 370 A, 500 A, and 650 A MeV. The experiment was performed at GSI Darmstadt where the combined use of the inverse kinematics technique with an efficient detection setup allowed us to determine these cross sections with an uncertainty below 6%. This result was achieved by an accurate beam selection and registration of both fission fragments in coincidence which were also clearly distinguished from other reaction channels. These data solve existing discrepancies between previous measurements, providing new values for the Prokofiev systematics. The data also allow us to investigate the fission process at high excitation energies and small deformations. In particular, some fundamental questions about fission dynamics have been addressed, which are related to dissipative and transient time effects. (authors)

  3. Fragmentation of spin-dipole strength in {sup 90}Zr and {sup 208}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Marketin, T., E-mail: marketin@phy.hr [GSI Helmholtzzentrum fuer Schwerionenforschung, Planckstrasse 1, D-64291 Darmstadt (Germany); Physics Department, Faculty of Science, University of Zagreb, 10000 Zagreb (Croatia); Litvinova, E. [ExtreMe Matter Institute EMMI and Research Division, GSI Helmholtzzentrum fuer Schwerionenforschung, Planckstrasse 1, D-64291 Darmstadt (Germany); Vretenar, D. [Physics Department, Faculty of Science, University of Zagreb, 10000 Zagreb (Croatia); Ring, P. [Physik-Department der Technischen Universitaet Muenchen, D-85748 Garching (Germany)

    2012-01-05

    An extension of time-dependent covariant density functional theory that includes particle-vibration coupling is applied to the charge-exchange channel. Spin-dipole excitation spectra are calculated an compared to available data for {sup 90}Zr and {sup 208}Pb. A significant fragmentation is found for all three angular-momentum components of the spin-dipole strength as a result of particle-vibration coupling, as well as a shift of a portion of the strength to higher energy. A high-energy tail is formed in the strength distribution that linearly decreases with energy. Using a model-independent sum rule, the corresponding neutron skin thickness is estimated and shown to be consistent with values obtained at the mean-field level.

  4. Fragmentation of spin-dipole strength in 90Zr and 208Pb

    International Nuclear Information System (INIS)

    Marketin, T.; Litvinova, E.; Vretenar, D.; Ring, P.

    2012-01-01

    An extension of time-dependent covariant density functional theory that includes particle-vibration coupling is applied to the charge-exchange channel. Spin-dipole excitation spectra are calculated an compared to available data for 90 Zr and 208 Pb. A significant fragmentation is found for all three angular-momentum components of the spin-dipole strength as a result of particle-vibration coupling, as well as a shift of a portion of the strength to higher energy. A high-energy tail is formed in the strength distribution that linearly decreases with energy. Using a model-independent sum rule, the corresponding neutron skin thickness is estimated and shown to be consistent with values obtained at the mean-field level.

  5. Microsurgical clipping of ophthalmic artery aneurysms: surgical results and visual outcomes with 208 aneurysms.

    Science.gov (United States)

    Kamide, Tomoya; Tabani, Halima; Safaee, Michael M; Burkhardt, Jan-Karl; Lawton, Michael T

    2018-01-26

    OBJECTIVE While most paraclinoid aneurysms can be clipped with excellent results, new postoperative visual deficits are a concern. New technology, including flow diverters, has increased the popularity of endovascular therapy. However, endovascular treatment of paraclinoid aneurysms is not without procedural risks, is associated with higher rates of incomplete aneurysm occlusion and recurrence, and may not address optic nerve compression symptoms that surgical debulking can. The increasing endovascular management of paraclinoid aneurysms should be justified by comparisons to surgical benchmarks. The authors, therefore, undertook this study to define patient, visual, and aneurysm outcomes in the most common type of paraclinoid aneurysm: ophthalmic artery (OphA) aneurysms. METHODS Results from microsurgical clipping of 208 OphA aneurysms in 198 patients were retrospectively reviewed. Patient demographics, aneurysm morphology (size, calcification, etc.), clinical characteristics, and patient outcomes were recorded and analyzed. RESULTS Despite 20% of these aneurysms being large or giant in size, complete aneurysm occlusion was accomplished in 91% of 208 cases, with OphA patency preserved in 99.5%. The aneurysm recurrence rate was 3.1% and the retreatment rate was 0%. Good outcomes (modified Rankin Scale score 0-2) were observed in 96.2% of patients overall and in all 156 patients with unruptured aneurysms. New visual field defects (hemianopsia or quadrantanopsia) were observed in 8 patients (3.8%), decreased visual acuity in 5 (2.4%), and monocular blindness in 9 (4.3%). Vision improved in 9 (52.9%) of the 17 patients with preoperative visual deficits. CONCLUSIONS The most important risk associated with clipping OphA aneurysms is a new visual deficit. Meticulous microsurgical technique is necessary during anterior clinoidectomy, aneurysm dissection, and clip application to optimize visual outcomes, and aggressive medical management postoperatively might potentially

  6. 18 CFR 292.208 - Special requirements for hydroelectric small power production facilities located at a new dam or...

    Science.gov (United States)

    2010-04-01

    ... for hydroelectric small power production facilities located at a new dam or diversion. 292.208 Section... requirements for hydroelectric small power production facilities located at a new dam or diversion. (a) A hydroelectric small power production facility that impounds or diverts the water of a natural watercourse by...

  7. 12 CFR 741.208 - Mergers of federally insured credit unions: voluntary termination or conversion of insured status.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Mergers of federally insured credit unions... Insured State-Chartered Credit Unions § 741.208 Mergers of federally insured credit unions: voluntary... 708a and 708b of this chapter concerning mergers and voluntary termination or conversion of insured...

  8. 5 CFR 2640.301 - Waivers issued pursuant to 18 U.S.C. 208(b)(1).

    Science.gov (United States)

    2010-01-01

    ...(b)(1). 2640.301 Section 2640.301 Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS INTERPRETATION, EXEMPTIONS AND WAIVER GUIDANCE CONCERNING 18 U.S.C. 208 (ACTS AFFECTING A PERSONAL... profit or loss or cost of the matter to the company issuing the stock, the change in the value of real...

  9. Effects of the BET-inhibitor, RVX-208 on the HDL lipidome and glucose metabolism in individuals with prediabetes

    DEFF Research Database (Denmark)

    Siebel, Andrew L; Trinh, Si Khiang; Formosa, Melissa F

    2016-01-01

    (HDL lipidome) and glucose metabolism. MATERIALS AND METHODS: Twenty unmedicated males with prediabetes received 100mg b.i.d. RVX-208 and placebo for 29-33days separated by a wash-out period in a randomized, cross-over design trial. Plasma HDL-cholesterol and apoA-I were assessed as well as lipoprotein...

  10. 8 CFR 208.31 - Reasonable fear of persecution or torture determinations involving aliens ordered removed under...

    Science.gov (United States)

    2010-01-01

    ... HOMELAND SECURITY IMMIGRATION REGULATIONS PROCEDURES FOR ASYLUM AND WITHHOLDING OF REMOVAL Credible Fear of... officer shall review the summary with the alien and provide the alien with an opportunity to correct... determinations under this section shall have the authority described in § 208.9(c). (e) Referral to Immigration...

  11. Study of the 2n-evaporation channel in the 4,6He + 206,208Pb reactions

    Czech Academy of Sciences Publication Activity Database

    Lukyanov, S. M.; Penionzhkevich, Y. E.; Astabatian, R. A.; Demekhina, N.A.; Dlouhý, Zdeněk; Ivanov, M.P.; Kalpakchieva, R.; Kulko, A.A.; Markarian, E. R.; Maslov, V. A.; Revenko, R.V.; Skobelev, N. K.; Smirnov, V. I.; Sobolev, Yu. G.; Trazska, W.; Khlebnikov, S. V.

    2009-01-01

    Roč. 670, 4-5 (2009), s. 321-324 ISSN 0370-2693 Institutional research plan: CEZ:AV0Z10480505 Keywords : excitation functions * 208,206Pb Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 5.083, year: 2009

  12. High spin states and isomeric decays in doubly-odd {sup 208}Fr

    Energy Technology Data Exchange (ETDEWEB)

    Kanjilal, D.; Bhattacharya, S.; Goswami, A.; Kshetri, R.; Raut, R. [Nuclear and Atomic Physics Division, Saha Institute of Nuclear Physics, Kolkata 700064 (India); Saha, S., E-mail: satyajit.saha@saha.ac.i [Nuclear and Atomic Physics Division, Saha Institute of Nuclear Physics, Kolkata 700064 (India); Bhowmik, R.K.; Gehlot, J.; Muralithar, S.; Singh, R.P. [Inter University Accelerator Centre, New Delhi 110067 (India); Jnaneswari, G. [Department of Physics, Andhra University, Vishakhapatnam 530003 (India); Mukherjee, G. [Variable Energy Cyclotron Centre, Kolkata 700064 (India); Mukherjee, B. [Department of Physics, Visva Bharati, Santiniketan 731235 (India)

    2010-10-15

    Neutron deficient isotopes of francium (Z=87, N{approx}121-123) as excited nuclei were produced in the fusion-evaporation reaction: {sup 197}Au({sup 16}O, xn) {sup 213-x}Fr at 100 MeV. The {gamma} rays from the residues were observed through the high sensitivity Germanium Clover detector array INGA. The decay of the high spin states and the isomeric states of the doubly-odd {sup 208}Fr nuclei, identified from the known sequence of ground state transitions, were observed. The half-lives of the E{sub {gamma}=}194(2) keV isomeric transition, known from earlier observations, was measured to be T{sub 1/2}=233(18) ns. A second isomeric transition at E{sub {gamma}=}383(2) keV and T{sub 1/2}=33(7) ns was also found. The measured half-lives were compared with the corresponding single particle estimates, based on the level scheme obtained from the experiment.

  13. Elastic Neutron Scattering at 96 MeV from {sup 12}C and {sup 208}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Klug, J.; Blomgren, J.; Atac, A. [and others

    2003-04-01

    A facility for detection of scattered neutrons in the energy interval 50-130 MeV, SCANDAL (SCAttered Nucleon Detection AssembLy), has recently been installed at the 20-180 MeV neutron beam line of the The Svedberg Laboratory, Uppsala. Elastic neutron scattering from {sup 12}C and {sup 208}Pb has been studied at 96 MeV in the 10-70 deg interval. The achieved energy resolution, 3.7 MeV, is about an order of magnitude better than for any previous experiment above 65 MeV incident energy. The present experiment represents the highest neutron energy where the ground state has been resolved from the first excited state in neutron scattering. A novel method for normalization of the absolute scale of the cross section has been used. The estimated uncertainty, 3 %, is unprecedented for a neutron-induced differential cross section measurement on a nuclear target. The results are compared with modern optical model predictions, based on phenomenology or microscopic nuclear theory.

  14. A nonlocal application of the dispersive optical model to 208Pb

    Science.gov (United States)

    Keim, M. A.; Mahzoon, M. H.; Atkinson, M. C.; Charity, R. J.; Dickhoff, W. H.

    2017-09-01

    A nonlocal application of the dispersive optical model to neutrons and protons in 208Pb is presented. A nucleon self-energy is described by parametrized real and imaginary parts connected through a dispersion relation. This parametrization includes nonlocal Hartree-Fock and local Coulomb and spin-orbit real terms, and nonlocal volume and surface and local spin-orbit imaginary terms. A simple Gaussian nonlocality is employed, and appropriate asymmetry parameters are included to describe the N-Z dependence of the nucleus. These parameters are constrained by fitting to experimental data, including particle numbers, energy levels, the charge density, elastic-scattering angular distributions, reaction cross sections, and the neutron total reaction cross section. From the resulting nucleon self-energy, the neutron matter distribution and neutron skin are deduced. This work was supported by the US Department of Energy, Division of Nuclear Physics under Grant DE-FG02-87ER-40316, the US National Science Foundation under Grants PHY-1304242 and PHY-1613362, and the Washington University Office of Undergraduate Research.

  15. Dispersive versus constant-geometry models of the neutron-208Pb mean field

    International Nuclear Information System (INIS)

    Mahaux, C.; Sartor, R.

    1990-01-01

    Phenomenological optical-model analyses of differential elastic scattering cross sections of neutrons by 208 Pb indicate that the radius of the real part of the potential decreases with increasing energy in the domain 4< E<40 MeV. On the other hand, the experimental total cross section is compatible with a real potential whose radial shape is energy independent. In order to clarify this situation, we compare a 'constant geometry' model whose real part has an energy-independent radial shape with a 'dispersive model' whose real part has an energy-dependent radial shape calculated from the dispersion relation which connects the real and imaginary parts of the field. The following three main features are considered. (i) The junction of the optical-model potential with the shell-model potential at negative energy. (ii) The agreement between the calculated total and differential cross sections and their experimental values. (iii) The extent to which the real part of the optical-model potential can be accurately determined by analyzing the total cross section only. It is concluded that the presently available experimental data support the existence of an energy dependence of the radial shape of the real potential, in keeping with the dispersion relation. A new parametrization of a 'dispersive' mean field is also presented. It does not involve more parameters than the previously published one but takes better account of the physical properties of the spectral functions; it is shown to improve the agreement between predicted and experimental scattering data. (orig.)

  16. New high spin states and isomers in the {sup 208}Pb and {sup 207}Pb nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Broda, R.; Wrzesinski, J.; Pawlat, T. [and others

    1996-12-31

    The two most prominent examples of the heavy doubly closed shell (DCS) nuclei, {sup 208}Pb and {sup 132}Sn, are not accessible by conventional heavy-ion fusion processes populating high-spin states. This experimental difficulty obscured for a long time the investigation of yrast high-spin states in both DCS and neighboring nuclei and consequently restricted the study of the shell model in its most attractive regions. Recent technical development of multidetector gamma arrays opened new ways to exploit more complex nuclear processes which populate the nuclei of interest with suitable yields for gamma spectroscopy and involve population of moderately high spin states. This new possibility extended the range of accessible spin values and is a promising way to reach new yrast states. Some of these states are expected to be of high configurational purity and can be a source of important shell model parameters which possibly can be used later to check the validity of the spherical shell model description at yet higher spin and higher excitation energy. The nuclei in the closest vicinity of {sup 132}Sn are produced in spontaneous fission and states with spin values up to I=14 can be reached in fission gamma spectroscopy studies with the presently achieved sensitivity of gamma arrays. New results on yrast states in the {sup 134}Te and {sup 135}I nuclei populated in fission of the {sup 248}Cm presented at this conference illustrate such application of the resolving power offered by modern gamma techniques.

  17. Isomers in neutron-rich A ∼ 190 nuclides from 208Pb fragmentation

    International Nuclear Information System (INIS)

    Rykaczewski, Krzysztof Piotr; Caamano, M.; Banu, A.; Walker, P.M.; Morton, N.H.; Regan, P. H.; Regan, Patrick H; Pfutzner, M.; Podolyak, Zs.; Gerl, J.; Hellstrom, M.; Mayet, P.; Miernik, K.; Mineva, M.N.; Aprahamian, A.; Benlliure, J.; Bruce, A.M.; Butler, P.A.; Cortina Gil, D.; Cullen, D.M.; Doring, J.; Enqvist, T.; Fox, C.; Garces Narro, J.; Geissel, H.; Gelletly, W.; Giovinazzo, J.; Gorska, M.; Grawe, H.; Grzywacz, R.; Kleinbohl, A.; Korten, W.; Lewitowicz, M.; Lucas, R.; Mach, H.; O'Leary, C.D.; De Oliveira, F.; Pearson, C.J.; Rejmund, F.

    2004-01-01

    Relativistic projectile fragmentation of 208 Pb has been used to produce isomers in neutron-rich, A ∼ 190 nuclides. A forward-focusing spectrometer provided ion-by-ion mass and charge identification. The detection of gamma-rays emitted by stopped ions has led to the assignment of isomers in 188 Ta, 190 W, 192 Re, 193 Re, 195 Os, 197 Ir, 198 Ir, 200 Pt, 201 Pt, 202 Pt and 203 Au, with half-lives ranging from approximately 10 ns to 1 ms. Tentative isomer information has been found also for 174 Er, 175 Er, 185 Hf, 191 Re, 194 Re and 199 Ir. In most cases, time-correlated, singles gamma-ray events provided the first spectroscopic data on excited states for each nuclide. In 200 Pt and 201 Pt, the assignments are supported by gamma-gamma coincidences. Isomeric ratios provide additional information, such as half-life and transition energy constraints in particular cases. The level structures of the platinum isotopes are discussed, and comparisons are made with isomer systematics

  18. Direct reactions induced by 16O on 208Pb at high incident energy

    International Nuclear Information System (INIS)

    Mermaz, M.C.

    1978-01-01

    Direct reactions induced by 16 O mainly on 208 Pb at 20 MeV/nucleon are reviewed. The quasi-elastic transfer reaction, such as one-proton and one-neutron transfer respectively leading to 209 Bi and 209 Pb single-particle-states, is first discussed, the fragmentation of 16 O projectile on heavy targets is then envisaged. The one-nucleon transfer can be described within the framework of one-step processes using the DWBA formalism to calculate the cross sections. At high incident energy (312.6 MeV), transfer reactions involving nucleons from the deeper 1p 3/2 orbit of 16 O are kinematically favoured and well observed. At 20 MeV/A and above, a large part of the reaction cross sections seems to be due to the fragmentation of the projectile; more especially, an abrasion-ablation model have to be used in order to explain the general trend of the data (energy spectra and angular distribution)

  19. Hindrance of O16+Pb208 fusion at extreme sub-barrier energies

    Science.gov (United States)

    Esbensen, Henning; Mişicu, Şerban

    2007-11-01

    We analyze the fusion data for O16+Pb208 using coupled-channels calculations. We include couplings to the low-lying surface excitations of the projectile and target and study the effect of the (O16,O17) one-neutron pickup. The hindrance of the fusion data that is observed at energies far below the Coulomb barrier cannot be explained by a conventional ion-ion potential and defining the fusion in terms of ingoing-wave boundary conditions (IWBC). We show that the hindrance can be explained fairly well by applying the M3Y double-folding potential which has been corrected with a calibrated, repulsive term that simulates the effect of nuclear incompressibility. We show that the coupling to one-neutron transfer channels plays a crucial role in improving the fit to the data. The best fit is achieved by increasing the transfer strength by 25% relative to the strength that is required to reproduce the one-neutron transfer data. The larger strength is not unrealistic because the calculated inelastic plus transfer cross section is in good agreement with the measured quasielastic cross section. We finally discuss the problem of reproducing the fusion data at energies far above the Coulomb barrier. Here we do not account for the data when we apply the IWBC but the discrepancy is essentially eliminated by applying the M3Y+repulsion potential and a weak, short-ranged imaginary potential.

  20. Gastrointestinal foreign bodies in dogs and cats: a retrospective study of 208 cases.

    Science.gov (United States)

    Hayes, G

    2009-11-01

    To establish predilection sites of obstruction and to investigate clinical factors associated with a poor outcome. A retrospective study of 208 consecutive cases over a 48-month period from first-opinion practice. Overall, 91 per cent of cases recovered with higher survival rates from discrete foreign bodies (94 per cent in dogs and 100 per cent in cats) as opposed to linear foreign bodies (80 per cent in dogs and 63 per cent in cats). English bull terriers, springer spaniels, Staffordshire bull terriers, Border collies and Jack Russell terriers were over-represented. In dogs, 63 per cent of obstructions occurred in the jejunum but foreign objects were encountered at all points along the gastrointestinal tract. A longer duration of clinical signs, the presence of a linear foreign body and multiple intestinal procedures were associated with significantly increased mortality. Neither the degree of obstruction (partial or complete) nor the location of the foreign body was shown to have a significant influence on survival. Prompt presentation, diagnosis and surgical intervention improve the outcome of gastrointestinal obstruction by foreign bodies. At surgery, the minimal number of intestinal procedures should be performed to restore the integrity of the alimentary tract.

  1. Electric dipole excitation of {sup 208}Pb by polarized electron impact

    Energy Technology Data Exchange (ETDEWEB)

    Jakubassa-Amundsen, D.H. [University of Munich, Mathematics Institute, Munich (Germany); Ponomarev, V.Yu. [Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany)

    2016-03-15

    The cross sections and spin asymmetries for the excitation of 1{sup -} states in {sup 208}Pb by transversely polarized electrons with collision energy of 30-180MeV have been examined within the DWBA scattering formalism. As examples, we have considered a low-lying 1{sup -} state and also states belonging to the pygmy dipole and giant dipole resonances. The structure of these states and their corresponding transition charge and current densities have been taken from an RPA calculation within the quasiparticle phonon model. The complex-plane rotation method has been applied to achieve the convergence of the radial DWBA integrals for backward scattering. We have studied the behaviour of the cross sections and spin asymmetries as a function of electron energy and scattering angle. The role of the longitudinal and transversal contributions to the excitation has been thoroughly studied. We conclude that the spin asymmetry S, related to unpolarized outgoing electrons, is mostly well below 1% even at the backward scattering angles and its measurement provides a challenge for future experiments with polarized electrons. (orig.)

  2. Beam losses from ultraperipheral nuclear collisions between ^{208}Pb^{82+} ions in the Large Hadron Collider and their alleviation

    Directory of Open Access Journals (Sweden)

    R. Bruce

    2009-07-01

    Full Text Available Electromagnetic interactions between colliding heavy ions at the Large Hadron Collider (LHC at CERN will give rise to localized beam losses that may quench superconducting magnets, apart from contributing significantly to the luminosity decay. To quantify their impact on the operation of the collider, we have used a three-step simulation approach, which consists of optical tracking, a Monte Carlo shower simulation, and a thermal network model of the heat flow inside a magnet. We present simulation results for the case of ^{208}Pb^{82+} ion operation in the LHC, with focus on the ALICE interaction region, and show that the expected heat load during nominal ^{208}Pb^{82+} operation is 40% above the quench level. This limits the maximum achievable luminosity. Furthermore, we discuss methods of monitoring the losses and possible ways to alleviate their effect.

  3. Complete dipole strength distributions in 208Pb from high-resolution polarized proton scattering at 0°

    International Nuclear Information System (INIS)

    Von Neumann-Cosel, Peter

    2012-01-01

    Small-angle polarized proton scattering including 0° at incident energies of a few 100 MeV/nucleon is established as a new spectrospcopic tool for the study of E1 and M1 strength distributions. Experiments of this type have been realized recently at RCNP, Osaka, Japan with high energy resolution of the order 25 - 30 keV (FWHM). Using 208 Pb as an example, the physics potential of such data is discussed. It includes information on the properties of the Pygmy Dipole Resonance but also on complete E1 and M1 strength distributions and thus the gamma strength function. The E1 polarizability can be extracted with a precision of about 4% providing important experimental constraints on the neutron skin thickness in 208 Pb.

  4. Isospin character of low-lying pygmy dipole states in 208Pb via inelastic scattering of 17O ions.

    Science.gov (United States)

    Crespi, F C L; Bracco, A; Nicolini, R; Mengoni, D; Pellegri, L; Lanza, E G; Leoni, S; Maj, A; Kmiecik, M; Avigo, R; Benzoni, G; Blasi, N; Boiano, C; Bottoni, S; Brambilla, S; Camera, F; Ceruti, S; Giaz, A; Million, B; Morales, A I; Vandone, V; Wieland, O; Bednarczyk, P; Ciemała, M; Grebosz, J; Krzysiek, M; Mazurek, K; Zieblinski, M; Bazzacco, D; Bellato, M; Birkenbach, B; Bortolato, D; Calore, E; Cederwall, B; Charles, L; de Angelis, G; Désesquelles, P; Eberth, J; Farnea, E; Gadea, A; Görgen, A; Gottardo, A; Isocrate, R; Jolie, J; Jungclaus, A; Karkour, N; Korten, W; Menegazzo, R; Michelagnoli, C; Molini, P; Napoli, D R; Pullia, A; Recchia, F; Reiter, P; Rosso, D; Sahin, E; Salsac, M D; Siebeck, B; Siem, S; Simpson, J; Söderström, P-A; Stezowski, O; Theisen, Ch; Ur, C; Valiente-Dobón, J J

    2014-07-04

    The properties of pygmy dipole states in 208Pb were investigated using the 208Pb(17O, 17O'γ) reaction at 340 MeV and measuring the γ decay with high resolution with the AGATA demonstrator array. Cross sections and angular distributions of the emitted γ rays and of the scattered particles were measured. The results are compared with (γ, γ') and (p, p') data. The data analysis with the distorted wave Born approximation approach gives a good description of the elastic scattering and of the inelastic excitation of the 2+ and 3- states. For the dipole transitions a form factor obtained by folding a microscopically calculated transition density was used for the first time. This has allowed us to extract the isoscalar component of the 1- excited states from 4 to 8 MeV.

  5. Is the simultaneous pick-up mechanism predominant in hte 208Pb(p, t) 3+ transition

    International Nuclear Information System (INIS)

    Igarashi, Masamichi; Kubo, Ken-ichi.

    1981-01-01

    The roles of simultaneous (one-step) and sequential (two-step) transfer processes in the reaction 208 Pb(p, t) 206 Pb(3 + , 1.34 MeV.) are investigated. Both processes are accurately evaluated employing realistic wave functions and finite-range interactions. The sequential transfer process is found to be dominant in this reaction, contrary to the conclusion of Nagarajan et al. The comparison of the polarization asymmetry calculation with the data confirms this result. (author)

  6. Study of elastic pion scattering from 9Be, 28Si, 58Ni, and 208Pb at 162 MeV

    International Nuclear Information System (INIS)

    Devereux, M.J.

    1979-05-01

    Elastic pion scattering from 9 Be, 28 Si, 58 Ni, and 208 Pb at 162 MeV is analyzed and compared with an optical model theory which incorporates a pion--nucleon range. Excellent fits to the data are obtained in all but one case. The fitted values of the pion--nucleon range, as well as other fitted values are listed. 108 references

  7. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    International Nuclear Information System (INIS)

    Patin, Joshua B.

    2002-01-01

    The study of the reactions between heavy ions and 208 Pb, 209 Bi, 238 U, and 248 Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the 238 U( 18 O,xn) 256-x Fm, 238 U( 22 Ne,xn) 260-x No, and 248 Cm( 15 N,xn) 263-x Lr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The 208 Pb( 48 Ca,xn) 256-x No, 208 Pb( 50 Ti,xn) 258-x Rf, 208 Pb( 51 V,xn) 259-x Db, 209 Bi( 50 Ti,xn) 259-x Db, and 209 Bi( 51 V,xn) 260-x Sg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics

  8. Neutron scattering from 208Pb at 30.4 and 40.0 MeV and isospin dependence of the nucleon optical potential

    Science.gov (United States)

    Devito, R. P.; Khoa, Dao T.; Austin, Sam M.; Berg, U. E. P.; Loc, Bui Minh

    2012-02-01

    Background: Analysis of data involving nuclei far from stability often requires the optical potential (OP) for neutron scattering. Because neutron data are seldom available, whereas proton scattering data are more abundant, it is useful to have estimates of the difference of the neutron and proton optical potentials. This information is contained in the isospin dependence of the nucleon OP. Here we attempt to provide it for the nucleon-208Pb system.Purpose: The goal of this paper is to obtain accurate n+208Pb scattering data and use it, together with existing p+208Pb and 208Pb(p,n)208BiIAS* data, to obtain an accurate estimate of the isospin dependence of the nucleon OP at energies in the 30-60-MeV range.Method: Cross sections for n+208Pb scattering were measured at 30.4 and 40.0 MeV, with a typical relative (normalization) accuracy of 2-4% (3%). An angular range of 15∘ to 130∘ was covered using the beam-swinger time-of-flight system at Michigan State University. These data were analyzed by a consistent optical-model study of the neutron data and of elastic p+208Pb scattering at 45 and 54 MeV. These results were combined with a coupled-channel analysis of the 208Pb(p,n) reaction at 45 MeV, exciting the 0+ isobaric analog state (IAS) in 208Bi.Results: The new data and analysis give an accurate estimate of the isospin impurity of the nucleon-208Pb OP at 30.4 MeV caused by the Coulomb correction to the proton OP. The corrections to the real proton OP given by the CH89 global systematics were found to be only a few percent, whereas for the imaginary potential it was greater than 20% at the nuclear surface. On the basis of the analysis of the measured elastic n+208Pb data at 40 MeV, a Coulomb correction of similar strength and shape was also predicted for the p+208Pb OP at energies around 54 MeV.Conclusions: Accurate neutron scattering data can be used in combination with proton scattering data and (p,n) charge exchange data leading to the IAS to obtain reliable

  9. Radiogenic Lead with Dominant Content of 208Pb: New Coolant and Neutron Moderator for Innovative Nuclear Facilities

    Directory of Open Access Journals (Sweden)

    A. N. Shmelev

    2011-01-01

    Full Text Available As a rule materials of small atomic weight (light and heavy water, graphite, and so on are used as neutron moderators and reflectors. A new very heavy atomic weight moderator is proposed—radiogenic lead consisting mainly of isotope 208Pb. It is characterized by extremely low neutron radiative capture cross-section (0.23 mbarn for thermal neutrons, i.e., less than that for graphite and deuterium and highest albedo of thermal neutrons. It is evaluated that the use of radiogenic lead makes it possible to slow down the chain fission reaction on prompt neutrons in a fast reactor. This can increase safety of the fast reactors and reduce as well requirements pertaining to the fuel fabrication technology. Radiogenic lead with high 208Pb content as a liquid-metal coolant of fast reactors helps to achieve a favorable (negative reactivity coefficient on coolant temperature. It is noteworthy that radiogenic lead with high 208Pb content may be extracted from thorium (as well as thorium-uranium ores without isotope separation. This has been confirmed experimentally by the investigations performed at San Paulo University, Brazil.

  10. Effect of excitation energy and angular momentum on the characteristics of 208Po and 210Po compound nucleus fission fragments

    International Nuclear Information System (INIS)

    Itkis, M.G.; Kalpakchieva, R.; Okolovich, V.N.; Penionzhkevich, Yu.Eh.; Tolstikov, V.N.

    1982-01-01

    To study characteristics of fissioning nucleus fragments, investigated were reactiiiiiiiiiiiiiiiH8Pt+ 12 C → 210 Po in the 12 C ion energy range of 86-110.5 MeV, of 192 Os+ 16 O → 208 Po in 90-131 MeV range, 204 Pb+ 3 He → 207 Po, 206 Pb+ 3 He → 209 Po, 207 Pb+ 3 He → 210 Po with 60 MeV 3 He ion energy. Using a correlation technique for measuring energies of two fragments mass and energy distributions of fission fragments of 208 Po and 210 Po compound nuclei produced in the reactions have been studied. Mass and energy distributions of fragments from fission of 208 Po and 210 Po in the reactions with ions 16 O, 12 C and 3 He were investigated in an ample energy range, using the correlational techniques for measurement of energies of two fragments. An increase in the total kinetic energy with rise of the angular momentum was observed, the fact indicating a weak coupling of one-particle and collective modes of motion in the fissile nucleus resulting in that the rolational energy is transfered mainly to translation energies of the fragments

  11. Study of shell evolution around the doubly magic $^{208}$Pb via a multinucleon transfer reaction with an unstable beam

    CERN Multimedia

    This proposal aims at the study of the neutron-rich region around the doubly-magic nucleus $^{208}$Pb populated via a multinucleon transfer reaction. An unstable $^{94}$Rb beam will be delivered by HIE-ISOLDE at 5.5 MeV$\\cdot$u onto a $^{208}$Pb 13.0 mg/cm$^{2}$ target. The $\\gamma$- rays will be recorded by the MINIBALL $\\gamma$-ray spectrometer. The aim of the experiment is twofold: \\\\ \\\\ i) firstly it will represent the proof of principle that multinucleon transfer reactions with neutron-rich unstable beams is efficient to populate neutron-rich heavy binary partners and represents a competitive method to cold fragmentation \\\\ ii) secondly we aim at populating medium- to high-spin states in $^{212;214}$Pb and $^{208;210}$Hg to elucidate the existence of the 16$^{+}$ isomer in the lead isotopes and at the same time to disentangle the puzzling case of a very low energy 3$^{-}$ state in $^{210}$Hg not described by any nuclear model. \\\\ \\\\ The experimental results will be compared with large-scale shell-model ...

  12. 208Pb(n,pxnγ) reactions for neutron energies up to 200 MeV

    International Nuclear Information System (INIS)

    Pavlik, A.; Vonach, H.

    1995-01-01

    The prompt gamma-radiation from the interaction of fast neutrons with enriched samples of 208 Pb was measured using the white neutron beam of the WNR facility at Los Alamos National Laboratory. The samples were positioned at about 40 m distance from the neutron production target. The spectra of the emitted gamma-rays were measured with a high-resolution HPGe detector. The incident neutron energy was determined by the time-of-flight method and the neutron fluence was measured with a 238 U fission chamber. In addition to the primary purpose of this experiment, the study of (n,xnγ) reactions leading to various lead isotopes, gamma transitions in the residual nuclei 207,205,203,201 Tl were analyzed. From these data gamma-production cross sections in the neutron energy range from the effective thresholds to 200 MeV were derived. The lines for the analysis had to be chosen carefully as the (n,pnxγ) cross sections are rather small and the interference with unresolved lead lines (even weak ones) would cause significant errors. The effect due to isomers with half-lives exceeding a few nanoseconds was taken into account and corrected for, if necessary. The measured cross sections were compared with the results of nuclear model calculations based on the exciton model for preequilibrium particle emission and the Hauser-Feshbach theory for compound nucleus decay. Unlike in the case of (n,xnγ) reactions the calculated results in general did not give a good description of the measured cross sections

  13. Evaluation report on SCTF Core-II test S2-08

    International Nuclear Information System (INIS)

    Ohnuki, Akira; Iwamura, Takamichi; Abe, Yutaka; Murao, Yoshio; Adachi, Hiromichi.

    1991-01-01

    The present report investigates the effects of the difference of the core inlet subcooling during reflood in a PWR-LOCA on the thermal-hydraulic behaviors including two-dimensional behaviors in the pressure vessel in the Slab Core Test Facility (SCTF) Core-II tests under gravity feed mode. The following test results are examined: Tests S2-02 (Reference test) and Test S2-08 (High subcooling test). The degree of the difference of the subcooling between the two tests was about 20 to 35 K in the LPCI period. The following conclusions were obtained from this study: (1) Higher the subcooling gave larger amount of water accumulation in the core and gave better core cooling. These tendencies were also recognized in comparisons under the same distance from the quench front. Since the same tendencies can be predicted in the analyses with REFLA code because of the lower steam generation rate below quench front in the high subcooling test, the differences in the tests are supposed to be caused by the same reason. (2) Higher the subcooling gave larger amount of water accumulation in upper plenum. The carry-over liquid mass into hot leg became smaller in the later period in the higher subcooling test. These differences for carry-over and de-entrainment characteristics can be explained by the differences of quench velocity and of steam mass flow rate generated in the core. (3) No significant influence of the different degree of the subcooling was observed on the two-dimensional thermal-hydraulic behaviors in the pressure vessel. Namely, radial differences of sectional void fraction, heat transfer coefficient and the pressure among bundles at the same elevation were almost the same amount for the two tests. Radial differences of liquid levels in the upper plenum was also almost the same amount for the two tests. (J.P.N.)

  14. Clinical and genetic characterization of pituitary gigantism: an international collaborative study in 208 patients.

    Science.gov (United States)

    Rostomyan, Liliya; Daly, Adrian F; Petrossians, Patrick; Nachev, Emil; Lila, Anurag R; Lecoq, Anne-Lise; Lecumberri, Beatriz; Trivellin, Giampaolo; Salvatori, Roberto; Moraitis, Andreas G; Holdaway, Ian; Kranenburg-van Klaveren, Dianne J; Chiara Zatelli, Maria; Palacios, Nuria; Nozieres, Cecile; Zacharin, Margaret; Ebeling, Tapani; Ojaniemi, Marja; Rozhinskaya, Liudmila; Verrua, Elisa; Jaffrain-Rea, Marie-Lise; Filipponi, Silvia; Gusakova, Daria; Pronin, Vyacheslav; Bertherat, Jerome; Belaya, Zhanna; Ilovayskaya, Irena; Sahnoun-Fathallah, Mona; Sievers, Caroline; Stalla, Gunter K; Castermans, Emilie; Caberg, Jean-Hubert; Sorkina, Ekaterina; Auriemma, Renata Simona; Mittal, Sachin; Kareva, Maria; Lysy, Philippe A; Emy, Philippe; De Menis, Ernesto; Choong, Catherine S; Mantovani, Giovanna; Bours, Vincent; De Herder, Wouter; Brue, Thierry; Barlier, Anne; Neggers, Sebastian J C M M; Zacharieva, Sabina; Chanson, Philippe; Shah, Nalini Samir; Stratakis, Constantine A; Naves, Luciana A; Beckers, Albert

    2015-10-01

    Despite being a classical growth disorder, pituitary gigantism has not been studied previously in a standardized way. We performed a retrospective, multicenter, international study to characterize a large series of pituitary gigantism patients. We included 208 patients (163 males; 78.4%) with growth hormone excess and a current/previous abnormal growth velocity for age or final height >2 s.d. above country normal means. The median onset of rapid growth was 13 years and occurred significantly earlier in females than in males; pituitary adenomas were diagnosed earlier in females than males (15.8 vs 21.5 years respectively). Adenomas were ≥10 mm (i.e., macroadenomas) in 84%, of which extrasellar extension occurred in 77% and invasion in 54%. GH/IGF1 control was achieved in 39% during long-term follow-up. Final height was greater in younger onset patients, with larger tumors and higher GH levels. Later disease control was associated with a greater difference from mid-parental height (r=0.23, P=0.02). AIP mutations occurred in 29%; microduplication at Xq26.3 - X-linked acrogigantism (X-LAG) - occurred in two familial isolated pituitary adenoma kindreds and in ten sporadic patients. Tumor size was not different in X-LAG, AIP mutated and genetically negative patient groups. AIP-mutated and X-LAG patients were significantly younger at onset and diagnosis, but disease control was worse in genetically negative cases. Pituitary gigantism patients are characterized by male predominance and large tumors that are difficult to control. Treatment delay increases final height and symptom burden. AIP mutations and X-LAG explain many cases, but no genetic etiology is seen in >50% of cases. © 2015 Society for Endocrinology.

  15. Electroproduction of charged pions from 1H, 2H, 40Ca and 208Pb

    International Nuclear Information System (INIS)

    Badalyan, N.N.; Badalyan, R.G.; Chubaryan, M.Ya.

    1994-01-01

    In deep inelastic scattering at squared four- momentum transfers Q 2 >> m c 2 , where the mass m Q of the additive quark is m c ≅ m Q ∼ 0,3 GeV, the virtual photon can transfer its energy to the quark during a time interval τ P ≅ ν/Q 2 . With respect to perturbative QCD, the cross section for this process is ∼ 1/Q 2 ; moreover, during the time interval τ F ≅ ν/m c 2 >> ν P , the point-like configuration must transform into a normal-sized hadron. Between the time interval τ P F , this point-like quark or quark-gluon configuration can interact with nuclear matter with only small cross section. Such a delayed hadronization mechanism will increase the yield of hadrons (in particular, π + -mesons) relative to the case when hadron production can take place at the virtual-photon quark interaction point. This hadronization process can be studied at energies available after the first energy upgrade at CEBAF; namely, at a beam energy of 6.00 GeV. We propose to measure in Hall A the inclusive electroproduction of π ± -mesons on 1 H and π + -mesons on 2 H, 40 Ca and 208 Pb utilizing the (e, e'π ± ) reaction for 1.0 ≤ Q 2 (GeV/c) 2 ≤2.5, at an invariant energy W > 1.92 GeV and at x B = 0.3. From a Q 2 -dependent analysis of the nuclear matter transparency, we can extract information about the space-time scale for the mechanism of quark hadronization. 65 refs., 21 figs., 6 tabs

  16. Isotopic and velocity distributions of {sub 83}Bi produced in charge-pickup reactions of {sup 208}{sub 82}PB at 1 A GeV

    Energy Technology Data Exchange (ETDEWEB)

    Kelic, A.; Schmidt, K.H.; Enqvist, T. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (DE)] [and others

    2004-07-01

    Isotopically resolved cross sections and velocity distributions have been measured in charge-pickup reactions of 1 A GeV {sup 208}Pb with proton, deuterium and titanium target. The total and partial charge-pickup cross sections in the reactions {sup 208}Pb + {sup 1}H and {sup 208}Pb + {sup 2}H are measured to be the same in the limits of the error bars. A weak increase in the total charge-pickup cross section is seen in the reaction of {sup 208}Pb with the titanium target. The measured velocity distributions show different contributions - quasi-elastic scattering and {delta}-resonance excitation - to the charge-pickup production. Data on total and partial charge-pickup cross sections from these three reactions are compared with other existing data and also with model calculations based on the coupling of different intra-nuclear cascade codes and an evaporation code. (orig.)

  17. Impact of miR-208 and its Target Gene Nemo-Like Kinase on the Protective Effect of Ginsenoside Rb1 in Hypoxia/Ischemia Injuried Cardiomyocytes

    Directory of Open Access Journals (Sweden)

    Xu Yan

    2016-09-01

    Full Text Available Background/Aims: Ginsenoside Rb1 (GS-Rb1 is one of the most important active pharmacological extracts of the Traditional Chinese Medicine ginseng, with extensive evidence of its cardioprotective properties. Mir-208 has been shown to act as a biomarker of acute myocardial infarction in vivo studies including man. However the impact of miR-208 on the protective effect of GS-Rb1 in hypoxia/ischemia injured cardiomyocytes remains unclear. The current study aims to investigate the target gene of miR-208 and the impact on the protective effect of GS-Rb1 in hypoxia/ischemia (H/I injuried cardiomyocytes. Materials and Methods: Primary cultures of neonatal rat cardiomyocytes (NRCMs was subjected to the H/I conditions with or without GS-Rb1. Cell viability was calculated by MTT assay and confirmed by flow cytometry analysis. Mir-208 was then detected by qRT-PCR. Luciferase reporter assay was carried out to detect the target gene of Mir-208. Then the NRCMs were transfected with miR-208 mimics and inhibitors to evaluate the impact on cardioprotective properties of Rb1. Results: The miR-208 expression level was clearly upregulated in the H/I treated NRCMs accompanied by the percentage of the apoptotic cells which could be reversed by GS-Rb1 pretreatment. The nemo-like kinase (NLK mRNA and protein expression levels were decreased in H/I group measured by RT-PCR and western blotting. Luciferase activity assay was then carried out to identify that NLK may be a direct target of mir-208. MTT assay showed that miR-208 inhibitor slightly decreased the protective effect of Rb1 on the H/I impaired NRCMs. However, results showed no statistical difference. Conclusions: These findings proved that NLK was a direct target of mir-208 and miR-208 act indirectly during Rb1 protecting H/I impaired NRCMs and further researches were needed to explore the relationship that microRNAs and other signal pathways in the protective effect of GS-Rb1 on the hypoxia/ischemia injuries in

  18. Minimization of an initial fast reactor uranium-plutonium load by using enriched lead-208 as a coolant

    Energy Technology Data Exchange (ETDEWEB)

    Khorasanov, G.L. [Institute for Physics and Power Engineering named after A.I. Leypunsky, 1 Bondarenko Square, Obninsk, Kaluga Region 249033 (Russian Federation)], E-mail: khorasan@ippe.ru; Korobeynikov, V.V.; Ivanov, A.P.; Blokhin, A.I. [Institute for Physics and Power Engineering named after A.I. Leypunsky, 1 Bondarenko Square, Obninsk, Kaluga Region 249033 (Russian Federation)

    2009-09-15

    Long-term scenarios of nuclear energy evolution over the world scale predict deployment of fast reactors (FRs) from 2020 to 2030 and achievement on 2050 the world installed capacity equal to 1500 GW{sub e} with essential increasing the FRs number. For several countries (i.e. Russia, Japan) whose policies are based on a sharp increase of nuclear production, at the stage near 2030-2040 when plutonium, Pu, from the PWR spent nuclear fuel is consumed, the Pu lack will stimulate minimization of its load in FRs. The period of Pu deficiency will be prolonged till the years when breeding gain (BG) equal to 0.2-0.3 in fast breeding reactors (FBRs) is obtained which corresponds to Pu inventory doubling time of 44-24 years. In this paper one of opportunities to minimize fuel loading is considered: it is related to using a low neutron capturing lead isotope, {sup 208}Pb, as a FR coolant. It is known, that natural lead, {sup nat}Pb, contains a stable lead isotope, {sup 208}Pb, having a small cross-section of neutron capture via (n, {gamma}) reaction. In the paper it is shown that the macroscopic cross-sections <{sigma}{sub n,{gamma}}> of radiation neutron capture by the lead isotope {sup 208}Pb averaged on the ADS core neutron spectra are by {approx}3.7-4.5 times less than the corresponding macroscopic cross-sections for a natural mix of lead isotopes {sup nat}Pb. This circumstance allows minimizing load of a lead fast reactor (LFR) core for achievement its criticality, as well as the load of an accelerator-driven system (ADS) subcritical core-for achievement of its small subcriticality. In using {sup 208}Pb instead of {sup nat}Pb in the ADS blanket, the multiplication factor of the subsritical core, K{sub eff}, could be increased from the initial value K{sub eff} = 0.953 up to the value of K{sub eff} = 0.970. To achieve this higher value of K{sub eff} in the same core cooled by {sup nat}Pb an additional amount of 20-30% of U-Pu fuel will be needed. The isotope {sup 208}Pb

  19. High-spin yrast states in the 206Po, 208Po, 209At and 210At nuclei

    International Nuclear Information System (INIS)

    Rahkonen, Vesa.

    1980-08-01

    High-spin yrast states in the 206 , 208 Po and 209 , 210 At nuclei have been studied with methods of in-beam γ-ray and conversion-electron spectroscopy and with the (α,3n), (α,4n), (p,2n) and ( 3 He,3n) reactions. Several new high-spin states have been identified up to angular momenta of 18-19 h/2π in these nuclei except in 206 Po where the highest spin was (13 - ). In the course of this work two new isomers with half-lives of 15+-3 ns and 4+-2 μs have been observed at 1689 and 4028 keV in 210 At, which have been interpreted as (10 - ) and 19 + states. The previously-known half-lives of 29+-2 and 680+-75 ns have been established for the three-proton states of Jsup(π)=21/2 - and 29/2 + at 1428 and 2429 keV in 209 At, respectively. A half-life of 1.0+-0.2 μs was measured for the 9 - isomer in 206 Po. Shell-model calculations based on the use of the empirical single- and two-particle interaction energies or of the experimental excitation energies belonging to the relevant one-, two- and three-particle states, have been carried out for these 4-6 particle nuclei. Most of the medium-spin yrast states in 206 Po, 208 Po and 209 At have been successfully described assuming the core for these nuclei being 204 Pb or 206 Pb rather than 208 Pb, and including an extra core polarization interaction described by the P 2 force. (author)

  20. (π±, π±' N) reactions on 12C and 208Pb near the giant resonance region

    International Nuclear Information System (INIS)

    Yoo, Sung Hoon.

    1990-05-01

    Angular distributions for the 12 C(π ± , π ± ' p) and 208 Pb(π ± , π ± ' p or n) reactions near the giant resonance region have been measured at T π = 180 MeV, and found different between π + and π - data. This observation is interpreted as evidence for different excitation mechanisms dominating the π - -nucleus and π + -nucleus interactions in the giant resonance region of these targets. A comparison with the single-nucleon knock-out distorted-wave impulse approximation calculations shows, even though these calculations underestimate (π ± , π ± ' N) data for both targets, the dominance of direct process for (π + , π + ' p) or (π - , π - ' n) in contrast to (π - , π - ' p) or (π + , π + ' n). In the (π + , π + ' p) reaction proton-proton hole states are excited directly and appear to have a large probability for direct decay with escape width, whereas in (π - , π - ' p) the preferentially excited neutron-neutron hole doorway states couple to resonance states and decay with spreading width. This interpretation led us to suggest that the ratio of cross-sections for inelastic scattering to the giant resonance region should be written in terms of an incoherent sum of cross-sections to neutron and proton doorway states. In a heavy nucleus such as 208 Pb, neutron and proton doorway states. In a heavy nucleus such as 208 Pb, neutron and proton doorway states contribute incoherently because the different decay processes do not populate the same final states of the residual nucleus

  1. Measurement of the Neutron Radius of 208Pb Through Parity Violation in Electron Scattering

    Energy Technology Data Exchange (ETDEWEB)

    Saenboonruang, Kiadtisak [Univ. of Virginia, Charlottesville, VA (United States)

    2013-05-01

    In contrast to the nuclear charge densities, which have been accurately measured with electron scattering, the knowledge of neutron densities still lack precision. Previous model-dependent hadron experiments suggest the difference between the neutron radius, Rn, of a heavy nucleus and the proton radius, Rp, to be in the order of several percent. To accurately obtain the difference, Rn-Rp, which is essentially a neutron skin, the Jefferson Lab Lead (208Pb) Radius Experiment (PREX) measured the parity-violating electroweak asymmetry in the elastic scattering of polarized electrons from 208Pb at an energy of 1.06 GeV and a scattering angle of 5° . Since Z0 boson couples mainly to neutrons, this asymmetry provides a clean measurement of Rn with respect to Rp. PREX was conducted at the Jefferson lab experimental Hall A, from March to June 2010. The experiment collected a final data sample of 2x 107 helicity-window quadruplets. The measured parity-violating electroweak asymmetry APV = 0.656 ± 0.060 (stat) ± 0.014 (syst) ppm corresponds to a difference between the radii of the neutron and proton distributions, Rn-Rp = 0.33+0.16-0.18 fm and provides the first electroweak observation of the neutron skin as expected in a heavy, neutron-rich nucleus. The value of the neutron radius of 208Pb has important implications for models of nuclear structure and their application in atomic physics and astrophysics such as atomic parity non-conservation (PNC) and neutron stars.

  2. Isotopic yields and kinetic energies of primary residues in 1 A GeV 208Pb + p reactions

    International Nuclear Information System (INIS)

    Enqvist, T.; Wlazlo, W.; Armbruster, P.

    2000-09-01

    The production of primary residual nuclei in the reaction 1 A GeV 208 Pb on proton has been studied by measuring isotopic distributions for all elements from titanium (Z=22) to lead (Z=82). Kinematical properties of the residues were also determined and used to disentangle the relevant reaction mechanisms, spallation (projectile fragmentation) and fission. The fragment separator FRS at GSI, Darmstadt, was used to separate and identify the reaction products. The measured production cross sections are highly relevant for the design of accelerator-driven subcritical reactors and for the planning of future radioactive-beam facilities. (orig.)

  3. Description of nucleon scattering on 208Pb by a fully Lane-consistent dispersive spherical optical model potential

    Science.gov (United States)

    Sun, W. L.; Wang, J.; Soukhovitskii, E. Sh.; Capote, R.; Quesada, J. M.

    2017-09-01

    A fully Lane-consistent dispersive spherical optical potential is proposed to describe nucleon scattering interaction with doubly magic nucleus 208Pb up to 200 MeV. The experimental neutron total cross sections, elastically scattered nucleon angular distributions and (p,n) data had been used to search the potential parameters. Good agreement between experiments and the calculations with this potential is observed. Meanwhile, the application of the determined optical potential with the same parameters to neighbouring near magic Pb-Bi isotopes is also examined to show the predictive power of this potential.

  4. Long range absorption in the scattering of 6He on 208Pb and 197Au at 27 MeV

    International Nuclear Information System (INIS)

    Kakuee, O.R.; Alvarez, M.A.G.; Andres, M.V.; Cherubini, S.; Davinson, T.; Di Pietro, A.; Galster, W.; Gomez-Camacho, J.; Laird, A.M.; Lamehi-Rachti, M.; Martel, I.; Moro, A.M.; Rahighi, J.; Sanchez-Benitez, A.M.; Shotter, A.C.; Smith, W.B.; Vervier, J.; Woods, P.J.

    2006-01-01

    Quasi-elastic scattering of 6 He at E lab =27 MeV from 197 Au has been measured in the angular range of 6 o -72 o in the laboratory system employing LEDA and LAMP detection systems. These data, along previously analysed data of 6 He+ 208 Pb at the same energy, are analysed using optical model calculations. The role of Coulomb dipole polarizability has been investigated. Large imaginary diffuseness parameters are required to fit the data. This result is an evidence for long range absorption mechanisms in 6 He induced reactions

  5. Study of the elastic scattering of {sup 6}He on {sup 208}Pb at energies around the Coulomb barrier

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez-Benitez, A.M. [Departamento de Fisica Aplicada, Universidad de Huelva, E-21071 Huelva (Spain); Centre de Recherches du Cyclotron, Universite Catholique de Louvain, B-1348 Louvain-la-Neuve (Belgium); Escrig, D. [Instituto de Estructura de la Materia, CSIC, E-28006 Madrid (Spain); Alvarez, M.A.G.; Andres, M.V. [Departamento de Fisica Atomica, Molecular y Nuclear, Universidad de Sevilla, E-41080 Sevilla (Spain); Angulo, C. [Centre de Recherches du Cyclotron, Universite Catholique de Louvain, B-1348 Louvain-la-Neuve (Belgium); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, E-28006 Madrid (Spain); Cabrera, J. [Centre de Recherches du Cyclotron, Universite Catholique de Louvain, B-1348 Louvain-la-Neuve (Belgium); Cherubini, S. [INFN Laboratori Nazionali del Sud, I-95123 Catania (Italy); Demaret, P. [Centre de Recherches du Cyclotron, Universite Catholique de Louvain, B-1348 Louvain-la-Neuve (Belgium); Espino, J.M. [Dept. de Fisica Atomica, Molecular y Nuclear, Universidad de Sevilla, E-41080 Sevilla (Spain); Figuera, P. [INFN Laboratori Nazionali del Sud, I-95123 Catania (Italy); Freer, M. [School of Physics and Astronomy, University of Birmingham, B15 2TT Birmingham (United Kingdom); Garcia-Ramos, J.E. [Departamento de Fisica Aplicada, Universidad de Huelva, E-21071 Huelva (Spain); Gomez-Camacho, J. [Dept. de Fisica Atomica, Molecular y Nuclear, Universidad de Sevilla, E-41080 Sevilla (Spain); Gulino, M. [INFN Laboratori Nazionali del Sud, I-95123 Catania (Italy); Kakuee, O.R. [Van der Graaff Laboratory, Nuclear Research Centre, AEOI, PO Box 14155-1339, Tehran (Iran, Islamic Republic of); Martel, I. [Dept. de Fisica Aplicada, Universidad de Huelva, E-21071 Huelva (Spain)], E-mail: imartel@uhu.es; Metelko, C. [School of Physics and Astronomy, University of Birmingham, B15 2TT Birmingham (United Kingdom); Moro, A.M. [Dept. de Fisica Atomica, Molecular y Nuclear, Universidad de Sevilla, E-41080 Sevilla (Spain)] (and others)

    2008-04-15

    The elastic scattering of {sup 6}He on {sup 208}Pb has been measured at laboratory energies of 14, 16, 18 and 22 MeV. These data were analyzed using phenomenological Woods-Saxon form factors and optical model calculations. A semiclassical polarization potential was used to study the effect of the Coulomb dipole polarizability. Evidence for long range absorption, partially arising from Coulomb dipole polarizability, is reported. The energy variation of the optical potential was found to be consistent with the dispersion relations which connect the real and imaginary parts of the potential.

  6. Multipole decomposition analysis of the 27Al, 90Zr, 208Pb(p, n) reactions at 295 MeV

    International Nuclear Information System (INIS)

    Wakasa, T.; Greenfield, M.B.; Koori, N.; Okihana, A.; Hatanaka, K.

    1996-01-01

    Differential cross sections at θ lab between 0 and 15 and the polarization transfer D NN at zero degrees for the 27 Al, 90 Zr, 208 Pb(p,n) reactions are measured at a bombarding energy of 295 MeV. A multipole decomposition (MD) technique is applied to extract L=0, L=1, and L≥2 contributions to the cross sections. The summed Gamow-Teller strength B(GT) is compared with shell-model calculations for the 27 Al(p,n) and 90 Zr(p,n) reactions. The usefulness of the polarization transfer observable in the MD analysis is discussed. (orig.)

  7. Production of heavy evaporation residues in the reactions induced by an extracted 48Ca beam on a 208Pb target

    International Nuclear Information System (INIS)

    Eremin, A.V.; Chepigin, V.I.; Itkis, M.G.

    1998-01-01

    The production cross sections of the isotopes 253-255 No were measured for the heavy ion complete fusion reaction 48 Ca + 208 Pb using the electrostatic recoil separator VASSILISSA. The obtained excitation functions for the reaction products formed after the evaporation of 1-3 neutrons from the compound nucleus are discussed and compared with the data obtained earlier and with the results of the statistical model calculations. The background conditions at the extraction of the correlated events of the reaction product decay are also considered from the point of view of future experiments on the superheavy element synthesis in the complete fusion reactions induced by 48 Ca projectiles

  8. Excitation of giant monopole resonance in {sup 208}Pb and {sup 116}Sn using inelastic deuteron scattering

    Energy Technology Data Exchange (ETDEWEB)

    Patel, D.; Garg, U. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Itoh, M. [Cyclotron and Radioisotope Center, Tohoku University, Sendai 980-8578 (Japan); Akimune, H. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Berg, G.P.A. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Fujiwara, M. [Research Center for Nuclear Physics, Osaka University, Osaka 567-0047 (Japan); Harakeh, M.N. [Kernfysisch Versneller Instituut, University of Groningen, 9747 AA Groningen (Netherlands); GANIL, CEA/DSM-CNRS/IN2P3, 14076 Caen (France); Iwamoto, C. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Kawabata, T. [Division of Physics and Astronomy, Kyoto University, Kyoto 606-8502 (Japan); Kawase, K. [Japan Atomic Energy Agency, Kyoto 619-0215 (Japan); Matta, J.T. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Murakami, T. [Division of Physics and Astronomy, Kyoto University, Kyoto 606-8502 (Japan); Okamoto, A. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Sako, T. [Japan Atomic Energy Agency, Kyoto 619-0215 (Japan); Schlax, K.W. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Takahashi, F. [Research Center for Nuclear Physics, Osaka University, Osaka 567-0047 (Japan); White, M. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Yosoi, M. [Research Center for Nuclear Physics, Osaka University, Osaka 567-0047 (Japan)

    2014-07-30

    The excitation of the isoscalar giant monopole resonance (ISGMR) in {sup 208}Pb and {sup 116}Sn has been investigated using small-angle (including 0°) inelastic scattering of 100 MeV/u deuteron and multipole-decomposition analysis (MDA). The extracted strength distributions agree well with those from inelastic scattering of 100 MeV/u α particles. These measurements establish deuteron inelastic scattering at E{sub d}∼100 MeV/u as a suitable probe for extraction of the ISGMR strength with MDA, making feasible the investigation of this resonance in radioactive isotopes in inverse kinematics.

  9. Cross-sections of spallation residues produced in 1A GeV 208Pb on proton reactions

    International Nuclear Information System (INIS)

    Wlazlo, W.; Uniwersytet Jagiellonski, Cracow; Enqvist, T.; Armbruster, P.

    2000-02-01

    Spallation residues produced in 1 GeV per nucleon 208 Pb on proton reactions have been studied using the fragment separator facility at GSI. Isotopic production cross-sections of elements from 61 Pm to 82 Pb have been measured down to 0.1 mb with a high accuracy. The recoil kinetic energies of the produced fragments were also determined. The obtained cross-sections agree with most of the few existing gamma-spectroscopy data. Data are compared with different intranuclear-cascade and evaporation-fission models. Drastic deviations were found for a standard code used in technical applications. (orig.)

  10. Relation of intrathecal oligoclonal band production to inflammatory mediator and immunotherapy response in 208 children with OMS.

    Science.gov (United States)

    Pranzatelli, Michael R; McGee, Nathan R; Tate, Elizabeth D

    2018-04-12

    In 208 children with opsoclonus-myoclonus syndrome (OMS), CSF IgG oligoclonal bands (OCB) and 22 immunomarkers in CSF and 21 in serum/blood were measured. In 36 untreated OMS, 58% were OCB(+), whereas 55% of treated OMS were OCB(-). OCB positivity or negativity did not alter concentrations or frequencies of immunomarkers. The phenotypes of OCB(+) and OCB(-) patients were not distinctive. CSF B cells were expanded in untreated OMS regardless of OCB positivity. These data reveal a much higher frequency of OCB positivity in untreated OMS than previously realized and a disconnect between intrathecal OCB and inflammatory mediator production. Copyright © 2018. Published by Elsevier B.V.

  11. Toward lifetime and g factor measurements of short-lived states in the vicinity of 208Pb

    International Nuclear Information System (INIS)

    Ralet, D; Georgiev, G; Stuchbery, A E; Clément, E; Lemasson, A; Michelagnoli, C; Rejmund, M; France, G de; Atanasova, L; Balabanski, D L; Bocchi, G; Carroll, R; Dewald, A; Fransen, C; Müller-Gatermann, C; Dudouet, J; Fornal, B; Franchoo, S; Goasduff, A; Gadea, A

    2017-01-01

    The multi-nucleon transfer reaction mechanism was used to produce and study nuclei in the vicinity of 208 Pb. This mass region is a test case for the nuclear shell model. The mass identification of the fragments was performed with the large acceptance magnetic spectrometer VAMOS++ coupled to the AGATA γ -tracking array. This experiment aimed to determine both lifetimes and gyromagnetic ratios of excited states with the Cologne plunger device. The analysis indicates promising results with the possibility to determine several new lifetimes in this region. (paper)

  12. Flow visualizations, velocity measurements, and surface convection measurements in simulated 20.8-cm Nova box amplifier cavities

    International Nuclear Information System (INIS)

    Julien, J.L.; Molishever, E.L.

    1983-01-01

    Reported are fluid mechanics experiments performed in models of the 20.8-cm Nova amplifier lamp and disk cavities. Lamp cavity nitrogen flows are shown, by both flow visualization and velocity measurements, to be acceptably uniform and parallel to the flashlamps. In contrast, the nitrogen flows in the disk cavity are shown to be disordered. Even though disk cavity flows are disordered, the simplest of three proposed nitrogen introduction systems for the disk cavity was found to be acceptable based on convection measurements made at the surfaces of simulated laser disks

  13. Study of the γ decay of high-lying states in 208Pb via inelastic scattering of 17O ions

    Directory of Open Access Journals (Sweden)

    Crespi F.C.L.

    2014-03-01

    Full Text Available A measurement of the high-lying states in 208Pb has been made using 17O beams at 20 MeV/u. The gamma decay following inelastic excitation was measured with the detector system AGATA Demonstrator based on segmented HPGe detectors, coupled to an array of large volume LaBr3:Ce scintillators and to an array of Si detectors. Preliminary results in comparison with (γ,γ’ data, for states in the 5-8 MeV energy interval, are presented.

  14. Interactions of {sub 82}Pb{sup 208} nuclei with energy 158 GeV per nucleon with photoemulsion nuclei; Vzaimodejstviya yader {sub 82}Pb{sup 208} s ehnergiej 158 Gev na nuklon s yadrami fotoehmul'sii

    Energy Technology Data Exchange (ETDEWEB)

    Adamovich, M I; Andreeva, N P; Bubnov, V I; Gajtinov, A Sh; Kanygina, Eh K; Musaeva, A K; Sejtimbetov, A M; Skorobagatova, V I; Filippova, L N; Chasnikov, I Ya [Fiziko-tekhnicheskij Inst. Ministerstava Nauki i Vysscego Obrazovaniya Respubliki Kazakhstan, Almaty (Kazakhstan)

    1999-07-01

    In this report there are experimental data on {sub 82}Pb{sup 208} nuclei (158 GeV) interaction with photoemulsion nuclei. The said data are compared to the similar ones for {sub 79}Au{sup 197} nuclei with less energy (10,7 A GeV). Stack of nuclear emulsion was irradiated with the beam of nuclei {sub 82}Pb{sup 208} at SPS of CERN. Events search was done along the primary nucleus trace. Pb nucleus average path length happened to be {lambda}=(3,8{+-}0,1) cm, this virtually coincides with the one calculated by Brandt and Peters formula (3,9 cm). Secondary particles were identified into s (storm), g (knock-on protons) and b- particles (target nucleus fragments), as well as into nucleus-bullet fragments with different charges (Z=1,2,{>=}3). This allowed obtaining event distribution by multiplicity of these particles (n{sub s}, n{sub g}, n{sub b}) and fragments (n{sub z=1,2,{>=}}{sub 3}), calculation of average values by multiplicity (see table), finding correlation of characteristics. >From the table it's clear that when the energy increases increases 2,5 times where as insignificantly decreases and doesn't change.

  15. Interactions of 82Pb208 nuclei with energy 158 GeV per nucleon with photoemulsion nuclei

    International Nuclear Information System (INIS)

    Adamovich, M.I.; Andreeva, N.P.; Bubnov, V.I.; Gajtinov, A.Sh.; Kanygina, Eh.K.; Musaeva, A.K.; Sejtimbetov, A.M.; Skorobagatova, V.I.; Filippova, L.N.; Chasnikov, I.Ya.

    1999-01-01

    In this report there are experimental data on 82 Pb 208 nuclei (158 GeV) interaction with photoemulsion nuclei. The said data are compared to the similar ones for 79 Au 197 nuclei with less energy (10,7 A GeV). Stack of nuclear emulsion was irradiated with the beam of nuclei 82 Pb 208 at SPS of CERN. Events search was done along the primary nucleus trace. Pb nucleus average path length happened to be λ=(3,8±0,1) cm, this virtually coincides with the one calculated by Brandt and Peters formula (3,9 cm). Secondary particles were identified into s (storm), g (knock-on protons) and b- particles (target nucleus fragments), as well as into nucleus-bullet fragments with different charges (Z=1,2,≥3). This allowed obtaining event distribution by multiplicity of these particles (n s , n g , n b ) and fragments (n z=1,2,≥3 ), calculation of average values by multiplicity (see table), finding correlation of characteristics. >From the table it's clear that when the energy increases s > increases 2,5 times where as g > insignificantly decreases and b > doesn't change

  16. Study of multi nucleon transfer in "9","1"1Li + "2"0"8Pb reactions

    International Nuclear Information System (INIS)

    Vinodkumar, A.M.

    2014-01-01

    One of the most active areas of research with radioactive beams is the study of the fusion of weakly bound nuclei, such as the halo nuclei. The central issue is whether the fusion cross section will be enhanced due to the large nuclear size of the halo nucleus or whether fusion-limiting breakup of the weakly bound valence nucleons will lead to a decreased fusion cross section. The fusion of "9","1"1Li with "2"0"8Pb were reported. These measurements were carried out at TRIUMF, Canada. These measurements suggests at above barrier energies, fusion hindrance is taking place in the case of "1"1Li projectile. However, sub barrier fusion measurement need a lower energy measurement. These measurements also suggest need for further measurement of transfer and breakup channels in these reactions. So we suggest a measurement of multi nucleon transfer in the case of "9Li + "2"0"8Pb. Also, these measurement will be able to produce the same nuclei as suggested in the ISOLDE experiment by, where "2"1"2","2"1"4Pb and "2"0"8","2"1"0Hg nuclei for studying the spectroscopy of these nuclei. (author)

  17. 207,208Pb(n,xnγ) reactions for neutron energies from 3 to 200 MeV

    International Nuclear Information System (INIS)

    Vonach, H.; Pavlik, A.; Chadwick, M.B.; Haight, R.C.; Nelson, R.O.; Wender, S.A.; Young, P.G.

    1994-01-01

    High-resolution γ-ray spectra from the interaction of neutrons in the energy range from 3 to 200 MeV with 207,208 Pb were measured with the white neutron source at the weapons neutron research (WNR) facility at Los Alamos National Laboratory. From these data, excitation functions for prominent γ transitions in 200,202,204,206,207,208 Pb were derived from threshold to 200 MeV incident neutron energy. These γ-production cross sections reflect the excitation cross sections for the respective residual nuclei. The results are compared with the predictions of nuclear reaction calculations based on the exciton model for precompound emission, the Hauser-Feshbach theory for compound nucleus decay, and coupled channels calculations to account for direct excitation of collective levels. Good agreement was obtained over the entire energy range covered in the experiment with reasonable model parameters. The results of this work clearly demonstrate that multiple preequilibrium emission has to be taken into account above about 40 MeV, and that the level density model of Ignatyuk, which accounts for the gradual disappearance of shell effects with increasing excitation energy, should be used instead of the Gilbert-Cameron and backshifted Fermi-gas models if excitation energies exceed about 30 MeV. No indication for a reduction of the nuclear moment of inertia below the rigid body value was found

  18. Chronic pancreatitis associated with the p.G208A variant of PRSS1 gene in a European patient.

    Science.gov (United States)

    Hegyi, Eszter; Cierna, Iveta; Vavrova, Ludmila; Ilencikova, Denisa; Konecny, Michal; Kovacs, Laszlo

    2014-01-10

    The major etiologic factor of chronic pancreatitis in adults is excessive alcohol consumption, whereas among children structural anomalies, systemic and metabolic disorders, and genetic factors are prevalent. Mutations in the cationic trypsinogen gene (PRSS1) cause hereditary pancreatitis, while mutations in serine protease inhibitor Kazal type 1 (SPINK1), cystic fibrosis transmembrane conductance regulator (CFTR) and chymotrypsin C (CTRC) genes have been shown to associate with chronic pancreatitis as independent risk factors. We present a case of 13-year-old boy with idiopathic chronic pancreatitis. Given the unexplained attacks of pancreatitis since early childhood and despite the negative family history, molecular-genetic analysis of four pancreatitis susceptibility genes (PRSS1, SPINK1, CTRC and CFTR) was performed. The boy was found to carry the c.623G>C (p.G208A) mutation of the PRSS1 gene and the c.180C>T (p.G60G) mutation of the CTRC gene, both in heterozygous state. These mutations are considered as contributing risk factors for chronic pancreatitis. In children with idiopathic chronic pancreatitis genetic causes should be considered, even in absence of positive family history. To the best of our knowledge, this is the first description of a European patient with chronic pancreatitis associated with the p.G208A mutation of PRSS1 gene. This mutation was previously reported only in Asian subjects and is thought to be a unique genetic cause of pancreatitis in Asia.

  19. Electric dipole response of {sup 208}Pb from proton inelastic scattering: Constraints on neutron skin thickness and symmetry energy

    Energy Technology Data Exchange (ETDEWEB)

    Tamii, A. [Research Center for Nuclear Physics, Ibaraki (Japan); Neumann-Cosel, P. von; Poltoratska, I. [Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany)

    2014-02-15

    The electric dipole (E1) response of {sup 208}Pb has been precisely determined by measuring Coulomb excitation induced by proton scattering at very forward angles. The electric dipole polarizability, defined as inverse energy-weighted sum rule of the E1 strength, has been extracted as α{sub D} = 20.1 ± 0.6 fm{sup 3}. The data can be used to constrain the neutron skin thickness of {sup 208}Pb to Δr{sub np} = 0.165 ± (0.009){sub expt} ± (0.013){sub theor} ± (0.021){sub est} fm, where the subscript ''expt'' refers to the experimental uncertainty, ''theor'' to the theoretical confidence band and ''est'' to the uncertainty associated with the estimation of the symmetry energy at the saturation density. In addition, a constraint band has been extracted in the plane of the symmetry energy (J and its slope parameter L) at the saturation density. (orig.)

  20. Data on gene and protein expression changes induced by apabetalone (RVX-208 in ex vivo treated human whole blood and primary hepatocytes

    Directory of Open Access Journals (Sweden)

    Sylwia Wasiak

    2016-09-01

    Full Text Available Apabetalone (RVX-208 inhibits the interaction between epigenetic regulators known as bromodomain and extraterminal (BET proteins and acetyl-lysine marks on histone tails. Data presented here supports the manuscript published in Atherosclerosis “RVX-208, a BET-inhibitor for Treating Atherosclerotic Cardiovascular Disease, Raises ApoA-I/HDL and Represses Pathways that Contribute to Cardiovascular Disease” (Gilham et al., 2016 [1]. It shows that RVX-208 and a comparator BET inhibitor (BETi JQ1 increase mRNA expression and production of apolipoprotein A-I (ApoA-I, the main protein component of high density lipoproteins, in primary human and African green monkey hepatocytes. In addition, reported here are gene expression changes from a microarray-based analysis of human whole blood and of primary human hepatocytes treated with RVX-208. Keywords: Bromodomain, BET proteins, BET inhibitor, RVX-208, JQ1, Vascular inflammation, ApoA-I, Apolipoprotein A-I, African green monkey, Primary human hepatocytes, Gene expression, Microarrays

  1. Analysis of oligomeric transition of silkworm small heat shock protein sHSP20.8 using high hydrostatic pressure native PAGE

    Science.gov (United States)

    Fujisawa, Tetsuro; Ueda, Toshifumi; Kameyama, Keiichi; Aso, Yoichi; Ishiguro, Ryo

    2013-06-01

    The small heat shock proteins (sHSPs) solubilize thermo-denatured proteins without adenosine triphosphate energy consumption to facilitate protein refolding. sHSP20.8 is one of the silkworm (Bombyx mori) sHSPs having only one cystein in the N-terminal domain: Cys43. We report a simple measurement of oligomeric transition of sHSP20.8 using high hydrostatic pressure native polyacrylamide gel electrophoresis (high hydrostatic pressure (HP) native polyacrylamide gel electrophoresis (PAGE)). At ambient pressure under oxydative condition, the native PAGE of thermal transition of sHSP20.8 oligomer displayed a cooperative association. In contrast, HP native PAGE clearly demonstrated that sHSP20.8 dissociated at 80 MPa and 25°C, and the resultant molecular species gradually reassociated with time under that condition. In addition, the reassociation process was suppressed in the presence of the reductant. These results are consistent with the idea that sHSP20.8 oligomer temporally dissociates at the first thermo-sensing step and reassociates with the oxidation of Cys43.

  2. Excitation of giant resonances in 20Ne + 90Zr and 208Pb inelastic scattering at 40 MeV/u1

    International Nuclear Information System (INIS)

    Suomijaervi, T.; Beaumel, D.; Blumenfeld, Y.; Chomaz, P.; Frascaria, N.; Garron, J.P.; Jacmart, J.C.; Roynette, J.C.; Kraus, L.; Link, I.

    1988-01-01

    The giant resonance region in the inelastic spectra from the reactions 20 Ne + 90 Zr and 20 Ne + 208 Pb at 40 MeV/nucleon has been studied with a good energy and angular resolutions. The strength distributions of the different multipolarities contributing to the cross section were obtained by a resonance shape independent analysis. In the case of 208 Pb the GDR strength was found to be strongly shifted towards lower excitation energies which can be explained by the exponentially decreasing Coulomb excitation probability. Furthermore, indications for a high multipolarity component in the resonance structure were found in both reactions

  3. Optimization of the growth conditions for amylase production by bacillus licheniformis 208 isolated from local hotsprings of karachi

    International Nuclear Information System (INIS)

    Asad, W.; Saleem, F.; Ajaz, M.; Rasool, S.A.

    2014-01-01

    Studies on the optimum conditions for the production of extracellular amylase were carried out with a newly isolated strain of Bacillus 208 from the hotsprings in Karachi. The optimum temperature, initial medium pH and incubation period for amylase production were 50 degree C, 7.0 and 24 hrs respectively. Furthermore, cells when grown in the complex media showed high amylase production compared to the minimal medium. Effect of different carbon sources revealed that soluble starch (1%) increased the amylase yield significantly. Peptone (as nitrogen source) gave higher yield as compared to other nitrogen sources tested. Under optimized conditions, the organism entered the stationary phase after 12 hrs and amylase production was observed to be maximum at 24th hrs of cultivation. Enzyme production regulation is influenced by catabolite repression. Reduction in enzyme production was observed in the presence of EDTA while addition of tween 20 and CaCl/sub 2/ helped to enhance the enzyme production. (author)

  4. Extending and refining the mass surface around $^{208}$Pb by high-precision Penning-trap mass spectrometry with ISOLTRAP

    CERN Multimedia

    Herfurth, F; Stora, T; Blaum, K; Beck, D; Kowalska, M; Schwarz, S; Stanja, J; Herlert, A J; Yamaguchi, T

    We propose high-precision mass spectrometry of nuclides around the doubly magic $^{208}$Pb. On the neutron-rich side, we aim to extend the knowledge of Fr, At, Hg, and Au masses to study the robustness of the N = 126 shell closure and to provide mass data necessary for modeling the rapid-neutron-capture process. On the proton-rich side, we aim at high-resolution mass spectrometry of selected Au, At, and Fr isotopes to verify the predicted existence of very low-lying isomeric states. The proposal will make use of newly-available laser-ionization schemes for Au and At. Finally, the recently implemented multi-reflection time-of-flight mass separator for auxiliary isobaric purification now allows measurements which were not feasible before.

  5. Analysis of the intermediate stage in the heavy ion interactions of 208Pb+197Au and 197Au+197Au

    International Nuclear Information System (INIS)

    Nasir, Tabassum; Khan, E.U.; Baluch, J.J.; Qureshi, I.E.; Sajid, M.; Shahzad, M.I.

    2008-01-01

    Two different projectiles 208 Pb and 197 Au at the same energy (11.67MeV/u) have been bombarded on 197 Au target to study heavy ion interactions using mica as a passive detector. In this paper we present results on the study of energy damping and time scale of the existence of di-nuclear composite system in the intermediate reaction step. The plots of Q-values as well as reaction cross sections in various angular bins of scattering angles suggest that K.E. damping was complete and dynamic equilibrium was established between the first and second reaction steps. The time scale of this duration was also determined

  6. Complete electric dipole response in 120Sn and 208Pb and implications for neutron skin and symmetry energy

    International Nuclear Information System (INIS)

    Von Neumann-Cosel, Peter

    2015-01-01

    Polarized proton scattering at energies of a few 100 MeV and very forward angles including 0° has been established as a new tool to extract the complete E1 strength distribution in nuclei for excitation energies between about 5 and 20 MeV. A case study of 208 Pb demonstrates excellent agreement with other electromagnetic probes. From the information on the B(E1) strength one can derive the electric dipole dipole polarizability, which is strongly correlated to the neutron skin and to parameters of the symmetry energy. Recently, we have extracted the polarizability of 120 Sn with a comparable precision. The combination of both results further constrains the symmetry energy parameters and presents a challenge for mean-field models, since relativistic and many Skyrme parameterizations cannot reproduce both experimental results simultaneously. (paper)

  7. Inelastic scattering of high transfer moment electrons to the first excited state (Jsup(π)=3-) of 208Pb

    International Nuclear Information System (INIS)

    Goutte, Dominique.

    1979-10-01

    A determination was made of an angular distribution of the inelastic scattering cross-sections of electrons by the first excited state (Jsup(π)=3 - , E*=2.615 MeV) of 208 Pb. The statistical accuracy of previous data was improved between 2 and 2.7 fm -1 and the area of transfer of moment was extended up to qsub(max)=3.4 fm -1 . Cross-sections up to 10 -37 cm 2 /sr were determined whereas the limit reached before was 7x10 -35 cm 2 /sr. In order to determine the transition charge density, it was put into parametric form by a Fourier-Bessel development using 12 coefficients and an 11 fm cut-off radius. The model error inherent in this method is reduced to an insignificant contribution by the sufficiently high transfer of moment. The experimental transition charge density was compared with the theoretical predictions [fr

  8. Complete Electric Dipole Response in 120Sn and 208Pb and Implications for Neutron Skin and Symmetry Energy

    Directory of Open Access Journals (Sweden)

    von Neumann-Cosel Peter

    2015-01-01

    Full Text Available Polarized proton scattering at energies of a few 100 MeV and extreme forward angles including 0° has been established as a new tool to extract the complete E1 response in nuclei up to excitation energies of about 20 MeV. A case study of 208Pb demonstrates excellent agreement with other electromagnetic probes. From the information on the B(E1 strength one can derive the electric dipole dipole polarizability, which is strongly correlated to the neutron skin and to parameters of the symmetry energy. Recently, we have extracted the polarizability of 120Sn with a comparable precision. The combination of both results further constrains the symmetry energy parameters and presents a challenge for mean-field models, since the relativistic and many Skyrme parameterizations cannot reproduce both experimental results simultaneously.

  9. Predictors of unsuccessful outcome in cemented femoral revisions using bone impaction grafting; Cox regression analysis of 208 cases.

    Science.gov (United States)

    Te Stroet, Martijn A J; Rijnen, Wim H C; Gardeniers, Jean W M; Schreurs, B Willem; Hannink, Gerjon

    2016-09-29

    Despite improvements in the technique of femoral impaction bone grafting, reconstruction failures still can occur. Therefore, the aim of our study was to determine risk factors for the endpoint re-revision for any reason. We used prospectively collected demographic, clinical and surgical data of all 202 patients who underwent 208 femoral revisions using the X-change Femoral Revision System (Stryker-Howmedica), fresh-frozen morcellised allograft and a cemented polished Exeter stem in our department from 1991 to 2007. Univariable and multivariable Cox regression analyses were performed to identify potential factors associated with re-revision. The mean follow-up was 10.6 (5-21) years. The cumulative re-revision rate was 6.3% (13/208). After univariable selection, sex, age, body mass index (BMI), American Association of Anesthesiologists (ASA) classification, type of removed femoral component, and mesh used for reconstruction were included in multivariable regression analysis.In the multivariable analysis, BMI was the only factor that was significantly associated with the risk of re-revision after bone impaction grafting (BMI ≥30 vs. BMI <30, HR = 6.54 [95% CI 1.89-22.65]; p = 0.003). BMI was the only factor associated with the risk of re-revision for any reason. Besides BMI also other factors, such as Endoklinik score and the type of removed femoral component, can provide guidance in the process of preclinical decision making. With the knowledge obtained from this study, preoperative patient selection, informed consent, and treatment protocols can be better adjusted to the individual patient who needs to undergo a femoral revision with impaction bone grafting.

  10. Role of shell corrections in doubly magic "2"0"8Pb radioactivity within quantum mechanical fragmentation theory

    International Nuclear Information System (INIS)

    Mandeep Kaur; Singh, BirBikram; Sukhmanpreet Kaur

    2017-01-01

    The liquid drop energy (V_L_D_M) along with shell corrections (δU) plays an important role to give the proper understanding of binding energies of atomic nuclei. It is relevant mention here that to study the excited state decay of nuclear systems Gupta and collaborators developed dynamical cluster decay model (DCM) by refitting the binding energies at T=0, to get temperature dependent binding energies with shell corrections included, for the same. Also, in literature different types of temperature dependent binding energies formulas are available. In DCM, the temperature dependent binding energies have been included as given by Davidson et al. In the process, shell corrections, δU were also calculated along with VLDM to reproduce the available experimental binding energies at T=0. It is relevant to mention here that the nuclear shell structure plays main role in the process of cluster radioactivity (CR) as very well explored by the quantum mechanical fragmentation theory (QMFT)-based preformed cluster decay model (PCM), which is the special case of DCM at T=0. Within PCM, Gupta and collaborators also studied the role of deformations or orientations in the decay of number of radioactive nuclei in trans-lead region, specifically, which lead to doubly magic "2"0"8Pb daughter nucleus through emission of clusters i.e. "1"4C, "1"8","2"0O, "2"2Ne, "2"3F, "2"4","2"6 Ne, "2"8","3"0Mg and "3"2","3"4Si, along with many other CR decays. As mentioned earlier, the nuclear shell structure plays an important role in the decay of radioactive nuclei to doubly magic "2"0"8Pb through cluster

  11. The nuclear magnetic moment of 208Bi and its relevance for a test of bound-state strong-field QED

    Science.gov (United States)

    Schmidt, S.; Billowes, J.; Bissell, M. L.; Blaum, K.; Garcia Ruiz, R. F.; Heylen, H.; Malbrunot-Ettenauer, S.; Neyens, G.; Nörtershäuser, W.; Plunien, G.; Sailer, S.; Shabaev, V. M.; Skripnikov, L. V.; Tupitsyn, I. I.; Volotka, A. V.; Yang, X. F.

    2018-04-01

    The hyperfine structure splitting in the 6p3 3/2 4S → 6p2 7 s 1/2 4P transition at 307 nm in atomic 208Bi was measured with collinear laser spectroscopy at ISOLDE, CERN. The hyperfine A and B factors of both states were determined with an order of magnitude improved accuracy. Based on these measurements, theoretical input for the hyperfine structure anomaly, and results from hyperfine measurements on hydrogen-like and lithium-like 209Bi80+,82+, the nuclear magnetic moment of 208Bi has been determined to μ (208Bi) = + 4.570 (10)μN. Using this value, the transition energy of the ground-state hyperfine splitting in hydrogen-like and lithium-like 208Bi80+,82+ and their specific difference of -67.491(5)(148) meV are predicted. This provides a means for an experimental confirmation of the cancellation of nuclear structure effects in the specific difference in order to exclude such contributions as the cause of the hyperfine puzzle, the recently reported 7-σ discrepancy between experiment and bound-state strong-field QED calculations of the specific difference in the hyperfine structure splitting of 209Bi80+,82+.

  12. 41 CFR 301-71.208 - Within how many calendar days after submission of a proper travel claim must we notify the...

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false Within how many calendar days after submission of a proper travel claim must we notify the employee of any errors in the claim... REQUIREMENTS Travel Claims for Reimbursement § 301-71.208 Within how many calendar days after submission of a...

  13. VECTOR AND TENSOR ANALYZING POWERS IN THE PB-208(D)OVER-RIGHT-ARROW,T)PB-207 REACTION AT 200 AND 360 MEV

    NARCIS (Netherlands)

    VANDEWIELE, J; LANGEVINJOLIOT, H; GUILLOT, J; ROSIER, LH; WILLIS, A; MORLET, M; DUHAMELCHRETIEN, G; GERLIC, E; TOMASIGUSTAFSSON, E; BLASI, N; MICHELETTI, S; VANDERWERF, SY

    Cross sections and vector and tensor analyzing powers for the main levels in Pb-207 have been measured via the Pb-208(d over arrow pointing right, t)Pb-207 reaction at 200 and 360 MeV incident energies. A(y) and A(yy) spin observables allow a clear identification of the valence levels, especially at

  14. 8 CFR 208.10 - Failure to appear at an interview before an asylum officer or failure to follow requirements for...

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Failure to appear at an interview before an... WITHHOLDING OF REMOVAL Asylum and Withholding of Removal § 208.10 Failure to appear at an interview before an... scheduled interview without prior authorization may result in dismissal of the application or waiver of the...

  15. Reaction cross sections for protons on {sup 12}C, {sup 40}Ca, {sup 90}Zr and {sup 208}Pb at energies between 80 and 180 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Auce, A.; Ingemarsson, A.; Johansson, R. [and others

    2005-04-01

    Results of reaction cross section measurements on {sup 12}C, {sup 40}Ca, {sup 90}Zr and {sup 208}Pb at incident proton energies between 80 and 180 MeV and for {sup 58}Ni at 81 MeV are presented. The experimental procedure is described and the results are compared with earlier measurements and predictions using macroscopic and microscopic models.

  16. Reaction cross sections for protons on 12C, 40Ca, 90Zr and 208Pb at energies between 80 and 180 MeV

    International Nuclear Information System (INIS)

    Auce, A.; Ingemarsson, A.; Johansson, R.

    2005-04-01

    Results of reaction cross section measurements on 12 C, 40 Ca, 90 Zr and 208 Pb at incident proton energies between 80 and 180 MeV and for 58 Ni at 81 MeV are presented. The experimental procedure is described and the results are compared with earlier measurements and predictions using macroscopic and microscopic models

  17. 40 CFR 600.208-12 - Calculation of FTP-based and HFET-based fuel economy and carbon-related exhaust emission values...

    Science.gov (United States)

    2010-07-01

    ...-based fuel economy and carbon-related exhaust emission values for a model type. 600.208-12 Section 600... ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later...-based and HFET-based fuel economy and carbon-related exhaust emission values for a model type. (a) Fuel...

  18. 30 CFR 204.208 - May a State decide that it will or will not allow one or both of the relief options under this...

    Science.gov (United States)

    2010-07-01

    ... MARGINAL PROPERTIES Accounting and Auditing Relief § 204.208 May a State decide that it will or will not allow one or both of the relief options under this subpart? (a) A State may decide in advance that it... 30 Mineral Resources 2 2010-07-01 2010-07-01 false May a State decide that it will or will not...

  19. Measurement of isotopic cross sections of the fission fragments produced in 500 AMeV 208Pb + p reaction

    International Nuclear Information System (INIS)

    Fernandez-Dominguez, B.

    2003-03-01

    The aim of this work is the study of the fission fragments produced in the spallation reaction 208 Pb + p at 500 AMeV. The fission fragments from Z=23 up to Z=59 have been detected and identified by using the inverse kinematics technique with the high-resolution spectrometer FRS. The production cross sections and the recoil velocities of 430 nuclei have been measured. The measured data have been compared with previous data. The isotopic distributions show a high precision. However, the absolute value of the fission cross section is higher than expected. From the experimental data the characteristics of the average fissioning system have been reconstructed (Z fis , A fis , E* fis ). In addition, the number of post-fission neutrons emitted from the fission fragments, v post , has been determined by using a new method. The experimental data have been compared to the two-steps models describing the spallation reaction. The impact of the model parameters on the observables has been analysed and the reasons Leading to the observed differences between the codes are also presented. This analyse shows a good agreement with the INCL4+ABLA code. (author)

  20. Interaction of 84 MeV/u 12C with 208Pb target investigated with CR-39 plastic track detector

    International Nuclear Information System (INIS)

    Grabez, B.

    1984-01-01

    The interaction of the 84 MeV/u 12 C ions with 208 Pb target was investigated using CR-39 plastic track detector. The first part of the work was dedicated to the examination of the methodology of the recently presented CR-39 detector and its calibration. Measurements have been done on tracks of various ions in the broad atomic number region from Z = 2 to Z = 92. The possibility of the identification of low energy fragments produced in nuclear interactions by measurements on the finished tracks was studied. Our results show that very good charge resolution can be achieved through determination of the mean etch rate ratio and the range of low energy ions. In the second part of the work it was shown that the main reaction channels in the interaction of 84 MeV/u C with Pb target are spallation, fission and fragmentation. The contribution of the multifragmentation is less than 1% of the total reaction cross section. From our results follows that the most probable reaction channels after collision with small impact parameter are fragmentation and deep spallation. The spallation and fission come after more peripheral collisions. (orig./HSI)

  1. 208-240 M.Y. old jadeite-glaucophane schists in the Kurosegawa tectonic zone near Kochi city, Shikoku

    International Nuclear Information System (INIS)

    Maruyama, Shigenori; Ueda, Yoshio; Banno, Shohei.

    1978-01-01

    A new member of the Kurosegawa tectonic zone was found in the serpentinite near Kochi city. They are high P and low T schists derived from basalt and chert. Three metamorphic events can be deciphered in the high-pressure schists, based upon the texture and mineral paragenesis: first, low P metamorphism at intermediate- to high-grade, second, high P and low T metamorphism of the jadeite-glaucophane facies and the third, retrograde crystallization of the second stage high P schists within the stability field of lawsonit + pumpellyite + glaucophane. Further, the formation of analcime replacing jadeite took place. The second and third metamorphism can be distinguished on pyroxene mineralogy that jadeite + quartz was stable in the second, but albite + quartz + aegirinejadeite in the third stage of metamorphism. Not all of the high P and low T schists had suffered low P metamorphism before they were metamorphosed by the high P one. Some basaltic rocks directly changed to high P and low T schists. Two muscovites in the schists give K-Ar ages of 208 - 240 m.y., and a relic igneous biotite, being partly replaced by chlorite, gives 225 m.y. of K-Ar age. These values are different not only from those of the Sanbagawa schists, but also from the other members of the Kurosegawa zone. (author)

  2. Neutron densities and the single particle structure of several even-even nuclei from 40Ca to 208Pb

    International Nuclear Information System (INIS)

    Ray, L.; Hodgson, P.E.

    1979-01-01

    Previously developed techniques which sum the squares of proton single particle wave functions to obtain nuclear charge densities are applied to the study of neutron distributions in /sup 40,48/Ca, /sup 58,64/Ni, /sup 116,124/Sn, and 208 Pb by comparing to those neutron densities deduced from 800 MeV proton elastic scattering data. The proton and neutron single particle wave functions are derived from a one-body, nonlocal Woods-Saxon binding potential whose parameters are adjusted to give the experimental single particle energies. Empirical spectroscopic factors determine the appropriate occupation probabilities for the single particle levels near the Fermi surface. Proper attention is given to nonorthogonality problems and to the removal of the spurious center-of-mass motion. These semiphenomenological neutron densities are compared to the predictions of the density matrix expansion variant of Hartree-Fock theory and to densities which are empirically deduced from recent 800 MeV polarized proton elastic scattering data. These ''experimental'' neutron distributions are obtained from approximate second order Kerman, McManus, and Thaler optical potential analyses using essentially ''model independent'' neutron densities. Qualitatively good agreement is obtained between the semiphenomenological neutron densities computed here, the density matrix expansion predictions, and the empirical results

  3. Mass and kinetic-energy distributions of fragments formed in the heavy-ion-induced fission of 208Po

    International Nuclear Information System (INIS)

    Cuninghame, J.G.; Goodall, J.A.B.

    1980-01-01

    Fission fragments following the decay of a 208 Po compound nucleus have been observed by using radiochemical and particle-counting techniques. The (α+ 204 Pb), ( 12 C+ 196 Pt) and ( 16 O+ 192 Os) reactions were studied at two or three bombarding energies, covering overlapping ranges of excitation energies. - Radiochemical separations of As, Br, Y, Nb, Tc, Ag, Sb and I isotopes were made from catcher foils sandwiching isotopic targets, and their isotopic yield distributions determined. The distributions are used to estimate the average number of neutrons associated with each fission event, including neutrons emitted before and after fission. - Prompt coincidence measurements of fragments are used to derive the overall mass and kinetic-energy distributions of primary fragments, taking into account the effects of pre- and post-fission neutron emission. The mass distributions are well fitted by the statistical theory, at a temperature corresponding to an excitation about 10 MeV above that at the saddle point. No evidence is found for an increase of kinetic-energy with increasing angular momentum of the compound nucleus. (author)

  4. Breakup and fusion cross sections of the 6Li nucleus with targets of mass A = 58, 144 and 208

    Science.gov (United States)

    Mukeru, B.; Rampho, G. J.; Lekala, M. L.

    2018-04-01

    We use the continuum discretized coupled channels method to investigate the effects of continuum-continuum coupling on the breakup and fusion cross sections of the weakly bound 6Li nucleus with the 58Ni, 144Sm and 208Pb nuclear targets. The cross sections were analyzed at incident energies E cm below, close to and above the Coulomb barrier V B. We found that for the medium and heavy targets, the breakup cross sections are enhanced at energies below the Coulomb barrier (E cm/V B ≤ 0.8) owing to these couplings. For the lighter target, relatively small enhancement of the breakup cross sections appear at energies well below the barrier (E cm/V B ≤ 0.6). At energies E cm/V B > 0.8 for medium and heavy targets, and E cm/V B > 0.6 for the light target, the continuum-continuum couplings substantially suppress the breakup cross sections. On the other hand, the fusion cross sections are enhanced at energies E cm/V B fusion cross sections. We also compared the breakup and fusion cross sections, and found that below the barrier, the breakup cross sections are more dominant regardless of whether continuum-continuum couplings are included.

  5. Study of fission reactions induced by 4,6He and 7Li beams on 209Bi and 208Pb targets

    Directory of Open Access Journals (Sweden)

    Lukyanov S.M.

    2013-12-01

    Full Text Available Study of fission reactions induced by 4,6He and 7Li beams on 209Bi and 208Pb targets, leading to the production of 210,212A compound nuclei, was performed. It was shown that the fission excitation functions for the three reactions 4,6He + 209Bi and 7Li + 208Pb had similar behavior within the experimental error for a broad range of energy. More likely, halo structure of 6He is not reflected on the fission reaction mechanism. Otherwise, a large value of the fusion cross section was observed so far, as it could be expected in the case of weakly bound character of 6He projectile.

  6. Analysis of light particles correlation selected by neutron calorimetry in the reaction 208 Pb+93 Nb at 29 MeV/u

    International Nuclear Information System (INIS)

    Ghisalberti, C.

    1994-01-01

    This work deals with the analysis of light particles correlation selected by neutrons calorimetry in the reaction : 208 Pb+ 93 Nb at 29 MeV/u. In the first part are described the interest of correlation functions, the proton-proton correlation function study, the classical model developed for describing the correlations of two light particles emitted by a nucleus in thermal equilibrium, the quantum model and some notions about exclusive sources and measures. The second part is a description of the experience : 208 Pb+ 93 Nb at 29 MeV/u. The analysis of experimental data and of experimental correlation functions are given respectively in the third and the fourth parts. (O.L.). 38 refs., 82 figs., 11 tabs

  7. Consistent dispersive optical-model analyses for n+209Bi and n+208Pb from -20 to +80 MeV

    International Nuclear Information System (INIS)

    Weisel, G.J.; Tornow, W.; Howell, C.R.

    1993-01-01

    Complementary databases were constructed from published and some new measurements of σ(θ), Ay(θ) and σ T for n+ 208 Pb and n+ 209 Bi covering the energy range 1.0 to 80 MeV. A dispersive optical-model analysis was performed for both scattering systems while constraining many of the parameters to be identical. A good representation of the data is obtained with conventional geometry and spin-orbit parameters. The 208 Pb model predicts quite well measured energies of single-particle and single-hole bound states. Occupation probabilities are calculated. A fully constrained model is presented in which the only differences between the two systems are the Fermi energy and the usual isospin term. This latter model represents all the data well

  8. Study of the reaction 22Ne(131 MeV) + 208Pb with a PIAVE-ALPI test beam and the PRISMA-CLARA set-up

    International Nuclear Information System (INIS)

    Mason, P.; Marginean, N.; Stefanini, A.M.

    2005-01-01

    An opportunity to study the system 22 Ne+ 208 Pb in the proximity of the Coulomb barrier with the PRISMACLARA apparatus was given by a test of the PIAVE-ALPI accelerator in mid-December 2005. The 22 Ne projectiles, having the kinetic energy of 131 MeV, collided with a 208 Pb target 300 μg/cm 2 thick. (The beam was run for ∼20 hours with a current of ∼6 particle-nA). The reaction products, mainly originated by scattering or transfer processes, were detected by the PRISMA spectrometer (positioned in the proximity of the grazing angle, ∼70 degrees), coupled to the CLARA array of germanium detectors

  9. Investigation of transversal nuclear excitation in 208Pb at excitation energies between 6 MeV and 8 MeV using inelastic electron scattering

    International Nuclear Information System (INIS)

    Frey, R.W.

    1978-01-01

    Using high resolution inelastic electron scattering magnitic dipole and quadrupole excitations in 208 Pb were investigated in the energy range between 6 MeV and 8 MeV. The electron energy was 50 MeV and 63.5 MeV. With a mean absolute energy resolution of 33 kev. 44 excited states were found in the above energy range. The measured angular distributions were compared with DWBA-calculations using random phase approximated wave functions. (FKS)

  10. Complete genome sequence of Acinetobacter baumannii XH386 (ST208, a multi-drug resistant bacteria isolated from pediatric hospital in China

    Directory of Open Access Journals (Sweden)

    Youhong Fang

    2016-03-01

    Full Text Available Acinetobacter baumannii is an important bacterium that emerged as a significant nosocomial pathogen worldwide. The rise of A. baumannii was due to its multi-drug resistance (MDR, while it was difficult to treat multi-drug resistant A. baumannii with antibiotics, especially in pediatric patients for the therapeutic options with antibiotics were quite limited in pediatric patients. A. baumannii ST208 was identified as predominant sequence type of carbapenem resistant A. baumannii in the United States and China. As we knew, there was no complete genome sequence reproted for A. baumannii ST208, although several whole genome shotgun sequences had been reported. Here, we sequenced the 4087-kilobase (kb chromosome and 112-kb plasmid of A. baumannii XH386 (ST208, which was isolated from a pediatric hospital in China. The genome of A. baumannii XH386 contained 3968 protein-coding genes and 94 RNA-only encoding genes. Genomic analysis and Minimum inhibitory concentration assay showed that A. baumannii XH386 was multi-drug resistant strain, which showed resistance to most of antibiotics, except for tigecycline. The data may be accessed via the GenBank accession number CP010779 and CP010780. Keywords: Acinetobacter baumannii, Multi-drug resistance, Paediatric

  11. EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Ai ds (CEF); Scientific Opinion on Flavouring Group Evaluation 208 (FGE.208): Consideration of genotoxicity data on representatives for 10 alicyclic aldehydes with the α , β - unsaturation in ring / side - chain

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of one flavouring substance from subgroup 2.2 of FGE.19 in the Flavouring Group Evaluation 208. The Flavour Industry has provided a...

  12. Refining the Early and Middle Eocene Geomagnetic Polarity Time Scale: new results from ODP Leg 208 (Walvis Ridge)

    Science.gov (United States)

    Westerhold, T.; Roehl, U.; Frederichs, T.; Bohaty, S. M.; Florindo, F.; Zachos, J. C.; Raffi, I.; Agnini, C.

    2015-12-01

    Astronomical calibration of the Geomagnetic Polarity Time Scale (GPTS) for the Eocene (34-56 Ma) has advanced tremendously in recent years. Combining a cyclostratigraphic approach based on the recognition of the stable 405-kyr eccentricity cycle of Earth's orbit with high-resolution bio- and magnetostratigraphy from deep-sea sedimentary records (ODP Legs 171B, 189 and 207; IODP Exp. 320/321) resulted in a new calibration of the middle-to-late Eocene GPTS spanning Chrons C12r to C19n (30.9-41.3 Ma). A fully astronomically calibrated GPTS for the Eocene was established recently by integrating cyclo-bio-magnetostratigraphy from ODP Sites 702 and 1263 records spanning the middle Eocene with Site 1258 records covering the early Eocene. Comparison of this deep sea-derived GPTS with GTS2012 and GPTS calibration points from terrestrial successions show overall consistent results, but there are still major offsets for the duration of Chrons C20r, C22r and C23n.2n. Because of the relatively large uncertainty of the calibration point, a radioisotopic dated ash layer in DSDP 516F, at C21n.75 (46.24±0.5 Ma) the duration of C20r in GPTS2012 (2.292 myr) is uncertain. Offsets in durations of C22r and C23n.2n between GPTS2012 and the new astronomical GPTS (~400-kyr longer C22r; ~400-kyr shorter C23n.2n) could be due to uncertainties in the interpretation of Site 1258 magnetostratigraphic data. Here we present new results toward establishing a more accurate and complete bio-, magneto- and chemostratigraphy for South Atlantic Leg 208 sites encompassing magnetochrons C13 to C24 (33 to 56 Ma). Our study aims to integrate paleomagnetic records from multiple drilled sites with physical property data, stable isotope data and XRF core scanning data to construct an astronomically calibrated framework for refining GPTS age estimates. This effort will complete the Early-to-Middle Eocene GPTS and allow evaluation of the relative position of calcareous nannofossil events to magnetostratigraphy.

  13. In vitro biosynthesis, isolation, and identification of predominant metabolites of 2-(4-(2-hydroxyethoxy)-3,5-dimethylphenyl)-5,7-dimethoxyquinazolin-4(3H)-one (RVX-208).

    Science.gov (United States)

    Khmelnitsky, Yuri L; Mozhaev, Vadim V; Cotterill, Ian C; Michels, Peter C; Boudjabi, Sihem; Khlebnikov, Vladimir; Madhava Reddy, M; Wagner, Gregory S; Hansen, Henrik C

    2013-06-01

    The structures of the two predominant metabolites (M4 and M5) of RVX-208, observed both in in vitro human and animal liver microsomal incubations, as well as in plasma from animal in vivo studies, were determined. A panel of biocatalytic systems was tested to identify biocatalysts suitable for milligram scale production of metabolite M4 from RVX-208. Rabbit liver S9 fraction was selected as the most suitable system, primarily based on pragmatic metrics such as catalyst cost and estimated yield of M4 (∼55%). Glucuronidation of RVX-208 catalyzed by rabbit liver S9 fraction was optimized to produce M4 in amounts sufficient for structural characterization. Structural studies using LC/MS/MS analysis and (1)H NMR spectroscopy showed the formation of a glycosidic bond between the primary hydroxyl group of RVX-208 and glucuronic acid. NMR results suggested that the glycosidic bond has the β-anomeric configuration. A synthetic sample of M4 confirmed the proposed structure. Metabolite M5, hypothesized to be the carboxylate of RVX-208, was prepared using human liver microsomes, purified by HPLC, and characterized by LC/MS/MS and (1)H NMR. The structure was confirmed by comparison to a synthetic sample. Both samples confirmed M5 as a product of oxidation of primary hydroxyl group of RVX-208 to carboxylic acid. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  14. Long range absorption in the scattering of {sup 6}He on {sup 208}Pb and {sup 197}Au at 27 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Kakuee, O.R. [Van De Graaf Laboratory, Nuclear Research Centre, AEOI, P.O. Box 14155-1339, Tehran (Iran, Islamic Republic of)]|[Departamento de Fisica Atomica, Molecular y Nuclear, Apartado 1065, Universidad de Sevilla, E-41080 Sevilla (Spain); Alvarez, M.A.G. [Departamento de Fisica Atomica, Molecular y Nuclear, Apartado 1065, Universidad de Sevilla, E-41080 Sevilla (Spain); Andres, M.V. [Departamento de Fisica Atomica, Molecular y Nuclear, Apartado 1065, Universidad de Sevilla, E-41080 Sevilla (Spain); Cherubini, S. [Department de Physique Nucleaire, Universite Catholique, Louvain-la-Neuve (Belgium)]|[Institut fuer Experimentalphysik III, Ruhr-Universitaet Bochum (Germany); Davinson, T.; Di Pietro, A.; Laird, A.M.; Shotter, A.C.; Smith, W.B.; Woods, P.J. [Department of Physics and Astronomy, Edinburgh University, EH9 3JZ (United Kingdom); Galster, W. [Department de Physique Nucleaire, Universite Catholique, Louvain-la-Neuve (Belgium); Gomez-Camacho, J. [Departamento de Fisica Atomica, Molecular y Nuclear, Apartado 1065, Universidad de Sevilla, E-41080 Sevilla (Spain)]. E-mail: gomez@us.es; Lamehi-Rachti, M. [Van De Graaf Laboratory, Nuclear Research Centre, AEOI, P.O. Box 14155-1339, Tehran (Iran, Islamic Republic of); Martel, I. [Departamento de Fisica Aplicada, Universidad de Huelva, E-21819 Huelva (Spain); Moro, A.M. [Departamento de Fisica Atomica, Molecular y Nuclear, Apartado 1065, Universidad de Sevilla, E-41080 Sevilla (Spain); Rahighi, J. [Van De Graaf Laboratory, Nuclear Research Centre, AEOI, P.O. Box 14155-1339, Tehran (Iran, Islamic Republic of)]|[Department of Physics and Astronomy, Edinburgh University, EH9 3JZ (United Kingdom); Sanchez-Benitez, A.M. [Departamento de Fisica Aplicada, Universidad de Huelva, E-21819 Huelva (Spain); Vervier, J. [Department de Physique Nucleaire, Universite Catholique, Louvain-la-Neuve (Belgium)

    2006-02-06

    Quasi-elastic scattering of {sup 6}He at E{sub lab}=27 MeV from {sup 197}Au has been measured in the angular range of 6{sup o}-72{sup o} in the laboratory system employing LEDA and LAMP detection systems. These data, along previously analysed data of {sup 6}He+{sup 208}Pb at the same energy, are analysed using optical model calculations. The role of Coulomb dipole polarizability has been investigated. Large imaginary diffuseness parameters are required to fit the data. This result is an evidence for long range absorption mechanisms in {sup 6}He induced reactions.

  15. Draft genome sequence of four coccolithoviruses: Emiliania huxleyi virus EhV-88, EhV-201, EhV-207, and EhV-208.

    Science.gov (United States)

    Nissimov, Jozef I; Worthy, Charlotte A; Rooks, Paul; Napier, Johnathan A; Kimmance, Susan A; Henn, Matthew R; Ogata, Hiroyuki; Allen, Michael J

    2012-03-01

    The Coccolithoviridae are a group of viruses which infect the marine coccolithophorid microalga Emiliania huxleyi. The Emiliania huxleyi viruses (known as EhVs) described herein have 160- to 180-nm diameter icosahedral structures, have genomes of approximately 400 kbp, and consist of more than 450 predicted coding sequences (CDSs). Here, we describe the genomic features of four newly sequenced coccolithoviruses (EhV-88, EhV-201, EhV-207, and EhV-208) together with their draft genome sequences and their annotations, highlighting the homology and heterogeneity of these genomes to the EhV-86 model reference genome.

  16. High-resolution inelastic electron scattering on 208Pb at 50 and 63.5 MeV and fragmentation of the magnetic quadrupole strength

    International Nuclear Information System (INIS)

    Knuepfer, W.; Frey, R.; Richter, A.; Schwierczinski, A.; Spamer, E.; Titze, O.

    1977-12-01

    High-resolution inelastic electron scattering (FWHM approximately equal to 33 keV) with 50 MeV and 63.5 MeV electrons on 208 Pb has been used to study magnetic excitations between Esub(x) = 6 MeV and 8 MeV. Angular distributions were analyzed in terms of the DWBA with RPA wave functions. Eight Isup(π) = 2- states carrying a total strength ΣB(M2) = 8500 μ 2 sub(K) fm 2 have been found. The strong fragmentation is in qualitative agreement with theoretical predictions. (orig.) [de

  17. Testing the mutually enhanced magicity effect in nuclear incompressibility via the giant monopole resonance in the {sup 204,206,208}Pb isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Patel, D. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Garg, U., E-mail: garg@nd.edu [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Fujiwara, M. [Research Center for Nuclear Physics, Osaka University, Osaka 567-0047 (Japan); Adachi, T. [Kernfysisch Versneller Instituut, University of Groningen, 9747 AA Groningen (Netherlands); Akimune, H. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Berg, G.P.A. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Harakeh, M.N. [Kernfysisch Versneller Instituut, University of Groningen, 9747 AA Groningen (Netherlands); GANIL, CEA/DSM-CNRS/IN2P3, 14076 Cean (France); Itoh, M. [Cyclotron and Radioisotope Center, Tohoku University, Sendai 980-8578 (Japan); Iwamoto, C. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Long, A.; Matta, J.T. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Murakami, T. [Division of Physics and Astronomy, Kyoto University, Kyoto 606-8502 (Japan); Okamoto, A. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Sault, K. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Talwar, R. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Uchida, M. [Department of Physics, Tokyo Institute of Technology, Tokyo 152-8850 (Japan); and others

    2013-10-07

    Using inelastic α-scattering at extremely forward angles, including 0°, the strength distributions of the isoscalar giant monopole resonance (ISGMR) have been measured in the {sup 204,206,208}Pb isotopes in order to examine the proposed mutually enhanced magicity (MEM) effect on the nuclear incompressibility. The MEM effect had been suggested as a likely explanation of the “softness” of nuclear incompressibility observed in the ISGMR measurements in the Sn and Cd isotopes. Our experimental results rule out any manifestation of the MEM effect in nuclear incompressibility and leave the question of the softness of the open-shell nuclei unresolved still.

  18. Completion Report for Wells ER-20-8 and ER-20-8#2 Corrective Action Units 101 and 102: Central and Western Pahute Mesa

    Energy Technology Data Exchange (ETDEWEB)

    NSTec Environmental Management

    2011-02-28

    Wells ER-20-8 and ER-20-8#2 were drilled for the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office in support of the Nevada Environmental Restoration Project at the Nevada National Security Site (formerly Nevada Test Site), Nye County, Nevada. The holes were drilled in July and August 2009, as part of the Pahute Mesa Phase II drilling program. The primary purpose of these wells was to provide detailed hydrogeologic information in the Tertiary volcanic section that will help address uncertainties within the Pahute Mesa–Oasis Valley hydrostratigraphic framework model. They may also be used as long-term monitoring wells.

  19. Evaluation of microRNAs − 208 and 133a/b as differential biomarkers of acute cardiac and skeletal muscle toxicity in rats

    Energy Technology Data Exchange (ETDEWEB)

    Calvano, Jacqueline, E-mail: Jacqueline.Calvano@bms.com [Drug Safety Evaluation, Bristol-Myers Squibb, 1 Squibb Drive, New Brunswick, NJ 08903 (United States); Achanzar, William; Murphy, Bethanne [Drug Safety Evaluation, Bristol-Myers Squibb, 1 Squibb Drive, New Brunswick, NJ 08903 (United States); DiPiero, Janet [Discovery Toxicology, Bristol-Myers Squibb, Route 206 and Province Line Road, Lawrenceville, NJ 08540 (United States); Hixson, Clifford; Parrula, Cecilia; Burr, Holly; Mangipudy, Raja; Tirmenstein, Mark [Drug Safety Evaluation, Bristol-Myers Squibb, 1 Squibb Drive, New Brunswick, NJ 08903 (United States)

    2016-12-01

    Conventional circulating biomarkers of cardiac and skeletal muscle (SKM) toxicity lack specificity and/or have a short half-life. MicroRNAs (miRNAs) are currently being assessed as biomarkers of tissue injury based on their long half-life in blood and selective expression in certain tissues. To assess the utility of miRNAs as biomarkers of cardiac and SKM injury, male Sprague–Dawley rats received a single dose of isoproterenol (ISO); metaproterenol (MET); allylamine (AAM); mitoxantrone (MIT); acetaminophen (APAP) or vehicle. Blood and tissues were collected from rats in each group at 4, 24 and 48 h. ISO, MET, and AAM induced cardiac and SKM lesions and APAP induced liver specific lesions. There was no evidence of tissue injury with MIT by histopathology. Serum levels of candidate miRNAs were compared to conventional serum biomarkers of SKM/cardiac toxicity. Increases in heart specific miR-208 only occurred in rats with cardiac lesions alone and were increased for a longer duration than cardiac troponin and FABP3 (cardiac biomarkers). ISO, MET and AAM induced increases in MyL3 and skeletal muscle troponin (sTnl) (SKM biomarkers). MIT induced large increases in sTnl indicative of SKM toxicity, but sTnl levels were also increased in APAP-treated rats that lacked SKM toxicity. Serum levels of miR-133a/b (enriched in cardiac and SKM) increased following ISO, MET, AAM and MIT treatments but were absent in APAP-treated rats. Our results suggest that miR-133a/b are sensitive and specific markers of SKM and cardiac toxicity and that miR-208 used in combination with miR-133a/b can be used to differentiate cardiac from SKM toxicity. - Highlights: • MiR-208 is specifically expressed in rat hearts. • MiR-133a/b are enriched in rat cardiac/skeletal muscle. • MiR-133a/b are sensitive and specific markers of muscle/cardiac toxicity. • MiR-208 can be used to differentiate cardiac toxicity from skeletal muscle toxicity.

  20. Spectroscopic study of 206,207,208Pb isotopes by high resolution analysis of 24.5 MeV proton scattering

    International Nuclear Information System (INIS)

    Vallois, G.

    1968-03-01

    206,207,208 pb have been studied by 24.5 MeV proton inelastic scattering with a resolution of 20 keV. The angular distributions of the differential cross-sections corresponding to the different excited levels have been measured in a large angular region and analysed with the DWBA.This work shows that it exists between 4 and 5 MeV of excitation energy some strongly excited levels corresponding to transfer momenta l = 2, 4, 6 and 8. The single particle-hole models do not explain these states; so it will probably be necessary to introduce some several particle - hole configurations. (author) [fr

  1. Analysis of light particles correlation selected by neutron calorimetry in the reaction {sup 208} Pb+{sup 93} Nb at 29 MeV/u; Analyse de correlation de particules legeres selectionnees par calorimetrie neutronique dans la reaction {sup 208} Pb+{sup 93} Nb a 29 MeV/u

    Energy Technology Data Exchange (ETDEWEB)

    Ghisalberti, C

    1994-11-10

    This work deals with the analysis of light particles correlation selected by neutrons calorimetry in the reaction : {sup 208} Pb+{sup 93} Nb at 29 MeV/u. In the first part are described the interest of correlation functions, the proton-proton correlation function study, the classical model developed for describing the correlations of two light particles emitted by a nucleus in thermal equilibrium, the quantum model and some notions about exclusive sources and measures. The second part is a description of the experience : {sup 208} Pb+{sup 93} Nb at 29 MeV/u. The analysis of experimental data and of experimental correlation functions are given respectively in the third and the fourth parts. (O.L.). 38 refs., 82 figs., 11 tabs.

  2. Pahute Mesa Well Development and Testing Analyses for Wells ER-20-8 and ER-20-4, Nevada National Security Site, Nye County, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Greg Ruskauff and Sam Marutzky

    2012-09-01

    Wells ER-20-4 and ER-20-8 were drilled during fiscal year (FY) 2009 and FY 2010 (NNSA/NSO, 2011a and b). The closest underground nuclear test detonations to the area of investigation are TYBO (U-20y), BELMONT (U-20as), MOLBO (U-20ag), BENHAM (U-20c), and HOYA (U-20 be) (Figure 1-1). The TYBO, MOLBO, and BENHAM detonations had working points located below the regional water table. The BELMONT and HOYA detonation working points were located just above the water table, and the cavity for these detonations are calculated to extend below the water table (Pawloski et al., 2002). The broad purpose of Wells ER-20-4 and ER-20-8 is to determine the extent of radionuclide-contaminated groundwater, the geologic formations, groundwater geochemistry as an indicator of age and origin, and the water-bearing properties and hydraulic conditions that influence radionuclide migration. Well development and testing is performed to determine the hydraulic properties at the well and between other wells, and to obtain groundwater samples at the well that are representative of the formation at the well. The area location, wells, underground nuclear detonations, and other features are shown in Figure 1-1. Hydrostratigraphic cross sections A-A’, B-B’, C-C’, and D-D’ are shown in Figures 1-2 through 1-5, respectively.

  3. Developments of 207Pb, 208Pb and 209Bi target wheels in the synthesis of 107Ns, 108Hs and 109Mt

    International Nuclear Information System (INIS)

    Folger, H.; Hartmann, W.; Hessberger, F.P.; Hofmann, S.; Klemm, J.; Muenzenberg, G.; Ninov, V.; Schmidt, K.H.; Schoett, H.J.; Thalheimer, W.; Armbruster, P.

    1993-05-01

    The developments of 207 Pb, 208 Pb and 209 Bi target wheels and their applications in heavy-ion fusion reactions are reviewed. In both, fabrication and use, the centers of the evaporator or accelerator beams are focussed at wheel radii of 155 mm to specially shaped frames which generate very homogeneous target layers and very constant reaction and counting rates in the experiment. Target areas of up to ∼98% of a wheel's circumference of 974 mm can be provided. The preparation procedures for necessary C backings and protecting layers of C are described, and details are given for the developments of high-vacuum evaporations of 207 Pb, 208 Pb and 209 Bi with deposition yields of 35-55% from tantalum crucibles. The applications of the target wheels in heavy-ion fusion reactions with beams of 54 Cr and 58 Fe at energies near the Coulomb barrier and intensities of ∼10 12 particles/s are mentioned. The target parameters for the production runs of the new chemical elements 107 Ns, 108 Hs and 109 Mt are included. (orig.)

  4. In vitro screening of reversible and time-dependent inhibition on CYP3A by TM208 and TM209 in rat liver microsomes

    Directory of Open Access Journals (Sweden)

    Miaoran Ning

    2012-04-01

    Full Text Available TM208 and TM209, dithiocarbamate derivatives with potential anti-cancer effects, were evaluated in reversible and time-dependent cytochrome P450 (CYP 3A inhibition assays in rat liver microsomes using testosterone as probe substrate. Both compounds were found to be weak reversible inhibitors and moderate mechanism-based inhibitors of rat CYP3A. For reversible inhibition on rat CYP3A, the Ki values of competitive inhibition model were 12.10±1.75 and 13.94±1.31 μM, respectively. For time-dependent inhibition, the inactivation constants (Kl were 31.93±12.64 and 32.91±15.58 μM, respectively, and the maximum inactivation rates (kinact were 0.03497±0.0069 and 0.07259±0.0172 min−1 respectively. These findings would provide useful in vitro information for future in vivo DDI studies on TM208 or TM209.

  5. Ratio of ellipticities between 192 and 208 nm (R1 ): An effective electronic circular dichroism parameter for characterization of the helical components of proteins and peptides.

    Science.gov (United States)

    Banerjee, Raja; Sheet, Tridip

    2017-11-01

    Circular dichroism (CD) spectroscopy represents an important tool for characterization of the peptide and protein secondary structures that mainly arise from the conformational disposition of the peptide backbone in solution. In 1991 Manning and Woody proposed that, in addition to the signal intensity, the ratio between [θ]nπ* and [θ]ππ*ǁ ((R 2 ) ≅ [θ] 222 /[θ] 208 ), along with [θ]ππ*⊥ and [θ]ππ*ǁ ((R 1 ) ≅ [θ] 192 /[θ] 208 ), may be utilized towards identifying the peptide/protein conformation (especially 3 10 - and α-helices). However, till date the use of the ratiometric ellipticity component for helical structure analysis of peptides and proteins has not been reported. We studied a series of temperature dependent CD spectra of a thermally stable, model helical peptide and its related analogs in water as a function of added 2,2,2-trifluoroethanol (TFE) in order to explore their landscape of helicity. For the first time, we have experimentally shown here that the R 1 parameter can characterize better the individual helices, while the other parameter R 2 and the signal intensity do not always converge. We emphasize the use of the R 1 ratio of ellipticities for helical characterization because of the common origin of these two bands (exciton splitting of the amide π→ π* transition in a helical polypeptide). This approach may become worthwhile and timely with the increasing accessibility of CD synchrotron sources. © 2017 Wiley Periodicals, Inc.

  6. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    International Nuclear Information System (INIS)

    Ragavan, Anpalaki J.

    2006-01-01

    Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).

  7. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    International Nuclear Information System (INIS)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina

    2017-01-01

    The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  8. The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water

    International Nuclear Information System (INIS)

    Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi

    1990-01-01

    227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface

  9. A Radium-223 microgenerator from cyclotron-produced trace Actinium-227

    International Nuclear Information System (INIS)

    Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.

    2017-01-01

    The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.

  10. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

    2017-11-13

    The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  11. New method for large scale production of medically applicable Actinium-225 and Radium-223

    International Nuclear Information System (INIS)

    Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.

    2014-01-01

    Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)

  12. Urea Cycle Defects: Early-Onset Disease Associated with A208T Mutation in OTC Gene-Expanding the Clinical Phenotype.

    Science.gov (United States)

    Sánchez, Ana Isabel; Rincón, Alejandra; García, Mary; Suárez-Obando, Fernando

    2017-01-01

    Ornithine transcarbamylase deficiency (OMIM: 311250) is the most common disorder of urea cycle disorders, accounting for nearly 50% of all cases. We report a case of a two-month- old male patient, who attends our medical genetics consultation because of low citrulline levels and elevated glutamine to citrulline ratio detected by expanded newborn screening with tandem mass spectrometry. He is an asymptomatic male with a normal physical examination and appropriate neurodevelopmental milestones. The patient has a family history of one older brother who died at 18 months old from severe and sudden hyperammonemia and a maternal aunt who suddenly died at two years old. He had high plasma ammonium concentration and a confirmed OTC mutation (p.A208T). Usually, this mutation causes OTC deficiency of late onset in adult males. However, this report raises awareness about mutations previously described as a late-onset causing disease, which can cause severe hyperammonemia and high risk of dying at an early age.

  13. Mapping the boundaries of the seniority regime and collective motion: Coulomb excitation studies of N = 122 isotones $^{206}$Po and $^{208}$Rn

    CERN Multimedia

    Butler, P; Voulot, D; Rahkila, P J; Darby, I G; Grahn, T; Bree, N C F; Julin, R J; Diriken, J V J; Jenkins, D G; Kroell, T; Huyse, M L

    In regions near magic nuclei, seniority can be regarded as a good quantum number. In the N = 122 isotones above the Z = 82 shell closure relative high-$\\textit{j}\\,$ single-particle proton orbitals dominate the structure and thus levels up to $\\textit{I}$ = 2$\\textit{j}$ - 1 could, in principle, be understood within the seniority scheme. While B(E2) values usually increase within the band with increasing $\\textit{I}$, the seniority scheme can lead to a contrasting result. The present proposal addresses this phenomenon through the measurements of previously unknown B(E2; 0$^{+}\\rightarrow$ 2$^{+}$) values in $^{206}$Po and $^{208}$Rn. The proposed Coulomb excitation measurements of radioactive beams will be carried out at the REX-ISOLDE facility using the MINIBALL $\\gamma$-ray spectrometer.

  14. Calculations and Evaluations of Cross Sections for n + 204,206,207,208,natPb Reactions in the En ≤ 250 MeV Energy Range

    International Nuclear Information System (INIS)

    Han Yinlu; Shen Qingbiao; Zhang Zhengjun; Cai Chonghai

    2005-01-01

    The quality and reliability of the computational simulation of a macroscopic nuclear device are directly related to the quality of the underlying basic nuclear data. To meet these needs, according to advanced nuclear models that account for details of nuclear structure and the quantum nature of nuclear reaction and the experimental data of total, nonelastic, and elastic scattering cross sections, and elastic scattering angular distributions of Pb and its isotopes, all cross sections of neutron-induced reaction, angular distributions, energy spectra, especially the double-differential cross sections for neutron, proton, deuteron, triton, helium, and alpha emissions are calculated and analyzed for n + 204,206,207,208,nat Pb at incident neutron energies below 20 MeV by using the UNF nuclear model code. At neutron incident energies 20 n ≤ 250 MeV, MEND codes are used. Theoretical calculations are compared with existing experimental data and other evaluated data from ENDF/B-VI and JENDL-3

  15. Measurement of hadron and lepton-pair production in $e^{+}e^{-}$ collisions at $\\sqrt{s} = 192 - 208 GeV$ at LEP

    CERN Document Server

    Achard, P.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Anderhub, H.; Andreev, Valery P.; Anselmo, F.; Arefiev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, G.; Baksay, L.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Biasini, M.; Biglietti, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bottai, S.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.; Casaus, J.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Chamizo, M.; Chang, Y.H.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; de la Cruz, B.; Cucciarelli, S.; de Asmundis, R.; Deglon, P.; Debreczeni, J.; Degre, A.; Dehmelt, K.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; Dionisi, C.; Dittmar, M.; Doria, A.; Dova, M.T.; Duchesneau, D.; Duda, M.; Echenard, B.; Eline, A.; El Hage, A.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Extermann, P.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisher, W.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gentile, S.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hirschfelder, J.; Hofer, H.; Hohlmann, M.; Holzner, G.; Hou, S.R.; Jin, B.N.; Jindal, P.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, J.K.; Kirkby, J.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Le Goff, J.M.; Leiste, R.; Levtchenko, M.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Luci, C.; Luminari, L.; Lustermann, W.; Ma, W.G.; Malgeri, L.; Malinin, A.; Mana, C.; Mans, J.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Muanza, G.S.; Muijs, A.J.M.; Musy, M.; Nagy, S.; Natale, S.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Nisati, A.; Novak, T.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Pal, I.; Palomares, C.; Paolucci, P.; Paramatti, R.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Piccolo, D.; Pierella, F.; Pieri, M.; Pioppi, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Pothier, J.; Prokofiev, D.; Rahal-Callot, G.; Rahaman, Mohammad Azizur; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Razis, P.; Rembeczki, S.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Roe, B.P.; Romero, L.; Rosca, A.; Rosemann, C.; Rosenbleck, C.; Rosier-Lees, S.; Roth, Stefan; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Sakharov, A.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Schafer, C.; Schegelsky, V.; Schopper, H.; Schotanus, D.J.; Sciacca, C.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Son, D.; Souga, C.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Tang, X.W.; Tarjan, P.; Tauscher, L.; Taylor, L.; Tellili, B.; Teyssier, D.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Ulbricht, J.; Valente, E.; Van de Walle, R.T.; Vasquez, R.; Vesztergombi, G.; Vetlitsky, I.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobiev, I.; Vorobyov, A.A.; Wadhwa, M.; Wang, Q.; Wang, X.L.; Wang, Z.M.; Weber, M.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Yeh, S.C.; Zalite, An.; Zalite, Yu.; Zhang, Z.P.; Zhao, J.; Zhu, G.Y.; Zhu, R.Y.; Zhuang, H.L.; Zichichi, A.; Zimmermann, B.; Zoller, M.

    2006-01-01

    Hadron production and lepton-pair production in e+e- collisions are studied with data collected with the L3 detector at LEP at centre-of-mass energies sqrt{s}=192-208GeV. Using a total integrated luminosity of 453/pb, 36057 hadronic events and 12863 lepton-pair events are selected. The cross sections for hadron production and lepton-pair production are measured for the full sample and for events where no high-energy initial-state-radiation photon is emitted prior to the collisions. Lepton-pair events are further investigated and forward-backward asymmetries are measured. Finally, the differential cross sections for electron-positron pair-production is determined as a function of the scattering angle. An overall good agreement is found with Standard Model predictions.

  16. Stretched configuration of states as inferred from γ-ray angular distributions in {sup 40}Ar + {sup 208}Pb neutron transfer reactions

    Energy Technology Data Exchange (ETDEWEB)

    Colovic, P.; Szilner, S.; Mijatovic, T.; Jelavic Malenica, D.; Soic, N. [Ruder Boskovic Institute, Zagreb (Croatia); Corradi, L.; Fioretto, E.; Stefanini, A.M.; Valiente-Dobon, J.J. [Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Legnaro, Legnaro (Italy); Pollarolo, G. [Dipartimento di Fisica Teorica, Universita di Torino (Italy); Istituto Nazionale di Fisica Nucleare, Torino (Italy); Goasduff, A. [Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Legnaro, Legnaro (Italy); Dipartimento di Fisica, Universita di Padova (Italy); Istituto Nazionale di Fisica Nucleare, Padova (Italy); Montanari, D. [Dipartimento di Fisica, Universita di Padova (Italy); Istituto Nazionale di Fisica Nucleare, Padova (Italy); Universite de Strasbourg, Institut Pluridisciplinaire Hubert Curien, CNRS-IN2P3, Strasbourg (France); Chapman, R.; Smith, J.F. [University of the West of Scotland, School of Engineering and Computing, Paisley (United Kingdom); Gadea, A. [Instituto de Fisica Corpuscular, CSIC-Universitat de Valencia, Valencia (Spain); Haas, F. [Universite de Strasbourg, Institut Pluridisciplinaire Hubert Curien, CNRS-IN2P3, Strasbourg (France); Marginean, N.; Ur, C.A. [Horia Hulubei National Institute of Physics and Nuclear Engineering and ELI-NP, Bucharest (Romania); Mengoni, D.; Montagnoli, G.; Scarlassara, F. [Dipartimento di Fisica, Universita di Padova (Italy); Istituto Nazionale di Fisica Nucleare, Padova (Italy); Milin, M. [University of Zagreb, Department of Physics, Faculty of Science, Zagreb (Croatia)

    2017-08-15

    Angular distributions of γ-rays for selected transitions in {sup 40,41,42}Ar isotopes have been studied with the PRISMA magnetic spectrometer coupled to the CLARA γ array. These transitions were populated in Ar isotopes reached via neutron transfer in the {sup 40}Ar + {sup 208}Pb reaction. By comparison with the shape of the experimental angular distribution of the known E2 transitions we established more firmly the spin and parity of excited states. In particular, in {sup 41}Ar for the (11/2{sup -}) state through the (11/2{sup -}) → 7/2{sup -} transition whose structure was discussed in terms of a phonon-fermion coupled state. The comparison with the expected fully aligned spin indicated that a high level of spin alignment has been reached. (orig.)

  17. Heavy ion coulomb excitation and gamma decay studies of the one and two phonon giant dipole resonances in 208Pb and 209Bi

    International Nuclear Information System (INIS)

    Mueller, P.E.; Beene, J.R.; Bertrand, F.E.; Halbert, M.L.; Olive, D.H.; Varner, R.L.; Sherrill, B.; Thoennessen, M.; Lautridou, P.; Lefevre, F.; Marques, M.; Matulewicz, T.; Mittig, W.; Ostendorf, R.; Roussel-Chomaz, P.; Schutz, Y.; Pol, J. van; Wilschut, H.W.; Diaz, J.; Ferrero, J.L.; Marin, A.

    1994-01-01

    Projectile - phonon coincidences were measured for the scattering of an 80 MeV/nucleon 64 Zn beam from 208 Pb and 209 Bi targets at the GANIL heavy ion accelerator facility. Projectile-like particles between 0.5 and 4.5 relative to the incident beam direction were detected in the SPEG energy loss spectrometer where their momentum, charge, and mass were determined. Photons were detected in the BaF 2 scintillation detector array TAPS. Light charged particles produced in the reaction were detected in the KVI Forward Wall. The analysis of the data acquired in this experiment is focused on three different phenomena: (1) the two phonon giant dipole resonance, (2) time dependence of the decay of the one phonon giant dipole resonance, and (3) giant resonance strength in projectile nuclei. (orig.)

  18. Study of deep inelastic collisions in the heavy-ion interaction of (14.0MeV/u){sup 208}Pb+{sup 238}U

    Energy Technology Data Exchange (ETDEWEB)

    Baluch, J J [Department of Physics, Gomal University, D. I. Khan (Pakistan); Khan, E U [Physics Research Division, Pakistan Institute of Nuclear Science and Technology, Islamabad (Pakistan); Tahseen, R [Department of Physics, Gomal University, D. I. Khan (Pakistan); Qureshi, I E [Physics Research Division, Pakistan Institute of Nuclear Science and Technology, Islamabad (Pakistan); Nasir, Tabassum [Department of Physics, Gomal University, D. I. Khan (Pakistan); Hassan, Najam ul [Department of Physics, Gomal University, D. I. Khan (Pakistan)

    2006-02-15

    Using mica as a passive detector and employing the 2{pi}-geometry technique (14.0MeV/u) {sup 208}Pb+{sup 238}U heavy-ion nuclear interaction has been studied. The particle tracks were converted into their actual lengths and polar angles through simple geometry. The elastic binary events so bifurcated were used to deduce the coefficients to analyze the three prong events. The relative velocities of the correlated fission fragments were calculated at the second stage of the reaction in order to construct the intermediate stage of the reaction, and hence, determine the pre-fission masses integrated over all angles and energies. The angular distribution of fission fragments within the reaction plane provided the information about the speed of the reaction and proximity effect.

  19. Study of deep inelastic collisions in the heavy-ion interaction of (14.0MeV/u)208Pb+238U

    International Nuclear Information System (INIS)

    Baluch, J.J.; Khan, E.U.; Tahseen, R.; Qureshi, I.E.; Nasir, Tabassum; Hassan, Najam ul

    2006-01-01

    Using mica as a passive detector and employing the 2π-geometry technique (14.0MeV/u) 208 Pb+ 238 U heavy-ion nuclear interaction has been studied. The particle tracks were converted into their actual lengths and polar angles through simple geometry. The elastic binary events so bifurcated were used to deduce the coefficients to analyze the three prong events. The relative velocities of the correlated fission fragments were calculated at the second stage of the reaction in order to construct the intermediate stage of the reaction, and hence, determine the pre-fission masses integrated over all angles and energies. The angular distribution of fission fragments within the reaction plane provided the information about the speed of the reaction and proximity effect

  20. Analysis of the intermediate stage in the heavy ion interactions of {sup 208}Pb+{sup 197}Au and {sup 197}Au+{sup 197}Au

    Energy Technology Data Exchange (ETDEWEB)

    Nasir, Tabassum [Department of Physics, Gomal University D.I. Khan (Pakistan); Khan, E.U. [Department of Physics, CIIT, Islamabad (Pakistan)], E-mail: ehsan@comsats.edu.pk; Baluch, J J [Department of Environmental Sciences, CIIT, Abbottabad (Pakistan); Qureshi, I E [Pakistan Atomic Energy Commission, P.O. Box 1114, Islamabad (Pakistan); Sajid, M; Shahzad, M I [Physics Division, PINSTECH, P.O. Nilore, Islamabad (Pakistan)

    2008-08-15

    Two different projectiles {sup 208}Pb and {sup 197}Au at the same energy (11.67MeV/u) have been bombarded on {sup 197}Au target to study heavy ion interactions using mica as a passive detector. In this paper we present results on the study of energy damping and time scale of the existence of di-nuclear composite system in the intermediate reaction step. The plots of Q-values as well as reaction cross sections in various angular bins of scattering angles suggest that K.E. damping was complete and dynamic equilibrium was established between the first and second reaction steps. The time scale of this duration was also determined.

  1. Production of n-rich Nuclei along the Closed Shell N=126 in the collision 136Xe + 208Pb @E lab =870 MeV

    Science.gov (United States)

    Quero, D.; Vardaci, E.; Kozulin, E. M.; Zagrebaev, V. A.; Corradi, L.; Pulcini, A.; La Rana, G.; Itkis, I. M.; Knyazheva, G. N.; Novikov, K.; Harca, I.; Fioretto, E.; Stefanini, A. M.; Montanari, D.; Montagnoli, G.; Scarlassara, F.; Szilner, S.; Mijatović, T.; Trzaska, W. H.

    2018-05-01

    Multi-nucleon transfer reactions are nowadays the only known mean to produce neutron-rich nuclei in the Terra Incognita. The closed-shell region N=126 is crucial for both studying shell-quenching in exotic nuclei and the r-process, being its last “waiting-point”. The choice of suitable reactions is challenging and a favorable case is 136Xe+208Pb, near the Coulomb barrier, because their neutron shell-closures play a stabilizing role, favoring the proton-transfer from lead to xenon. TOF-TOF data were analyzed to reconstruct the mass-energy distribution of the primary fragments. Preliminary results of an experiment held at Laboratori Nazionali di Legnaro with PRISMA, aimed at A and Z identification of the products, will be shown.

  2. Measurement of hadron and lepton-pair production in e+e- collisions at √(s)=192-208 GeV at LEP

    International Nuclear Information System (INIS)

    Achard, P.; Adriani, O.; Aguilar-Benitez, M.

    2006-01-01

    Hadron production and lepton-pair production in e + e - collisions are studied with data collected with the L3 detector at LEP at centre-of-mass energies √(s)=192-208 GeV. Using a total integrated luminosity of 453 pb -1 , 36057 hadronic events and 12863 lepton-pair events are selected. The cross sections for hadron production and lepton-pair production are measured for the full sample and for events where no high-energy initial-state-radiation photon is emitted prior to the collisions. Lepton-pair events are further investigated and forward-backward asymmetries are measured. Finally, the differential cross sections for electron-positron pair-production is determined as a function of the scattering angle. An overall good agreement is found with Standard Model predictions. (orig.)

  3. Calculation of proton and neutron emission spectra from proton reactions with 90Zr and 208Pb to 160 MeV with the GNASH code

    International Nuclear Information System (INIS)

    Young, P.G.; Chadwick, M.B.

    1994-01-01

    A number of modifications have been made to the reaction theory code GNASH in order the accuracy of calculations at incident particle energies up to 200 MeV. Direct reaction a level density models appropriate for higher energy calculations are now used in the code, and most importantly, improved preequilibrium models have been incorporated into the code system. The code has been used to calculate proton-induced reactions on 90 Zr and 208 Pb for the International Code and Model Intercomparison for Intermediate Energy Reactions organized by the NEA. Calculations were performed with GNASH at incident proton energies of 25, 45, 80, and 160 mev using both the exciton model and Feshbach-Kerman-Koonin theory for the preequilibrium component. The models and procedures used in the GNASH calculations with the exciton model are described here. The results are compared to experimental data and to results from the GNASH calculations with Feshbach-Kerman-Koonin preequilibrium theory

  4. Characteristics of latent damage trails due to high energy 208Pb and 238U ions in CR-39 and muscovite mica

    International Nuclear Information System (INIS)

    Chohan, A.S.; Akhtar, S.M.

    1988-01-01

    Experiments have been performed to study the characteristics of latent damage trails produced by (a) 17.14 MeV/nucleon- 208 Pb ions in mica and CR-39 track detectors and (b) 13.7 MeV/nucleon- 238 U in CR-39 track detectors. The parameters studied include (a) V t , average etching velocity along the track, (b) thermal stability of the latent damage trails, (c) the total etchable ranges, and (d) V g the general etching velocity of CR-39 track detectors previously annealed at different temperatures. It has been observed that the latent damage trails in CR-39 are greatly affected at temperatures around 200 0 C in CR-39 track detectors. The general etching velocity of a CR-39 detector has been found to increase with increasing annealing temperatures. (author)

  5. Spectroscopic study of {sup 206,207,208}Pb isotopes by high resolution analysis of 24.5 MeV proton scattering; Etude spectroscopique des isotopes 206, 207 et 208 du plomb par analyse a haute resolution de la diffusion de protons de 24,5 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Vallois, G [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1968-03-01

    {sup 206,207,208}pb have been studied by 24.5 MeV proton inelastic scattering with a resolution of 20 keV. The angular distributions of the differential cross-sections corresponding to the different excited levels have been measured in a large angular region and analysed with the DWBA.This work shows that it exists between 4 and 5 MeV of excitation energy some strongly excited levels corresponding to transfer momenta l = 2, 4, 6 and 8. The single particle-hole models do not explain these states; so it will probably be necessary to introduce some several particle - hole configurations. (author) [French] Les isotopes 206, 207 et 208 du plomb ont ete etudies par diffusion inelastique de protons de 24,5 MeV avec une resolution de 20 keV. Les distributions angulaires des sections efficaces differentielles correspondant aux differents niveaux excites ont ete mesurees sur un large domaine angulaire et analysees a l'aide de la DWBA. Ce travail met en evidence l'existence, entre 4 et 5 MeV d'excitation, de niveaux fortement excites correspondant a des moments de transfert de 2, 4, 6 et 8. Les modeles a simple particule-trou ne rendant pas compte de ces niveaux, il faudra sans doute recourir a des configurations a plusieurs particules-trous pour les expliquer. (auteur)

  6. Understanding the two neutron transfer reaction mechanism in {sup 206}Pb({sup 18}O,{sup 16}O){sup 208}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Parmar, A.; Sonika [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India); Roy, B.J., E-mail: bjroy@barc.gov.in [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India); Jha, V.; Pal, U.K. [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India); Sinha, T. [High Energy Nuclear and Particle Physics Division, Saha Institute of Nuclear Physics, Kolkata - 700 064 (India); Pandit, S.K.; Parkar, V.V.; Ramachandran, K.; Mahata, K.; Santra, S.; Mohanty, A.K. [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India)

    2015-08-15

    The absolute cross sections for elastic scattering and two-neutron transfer reaction for {sup 18}O + {sup 206}Pb system have been measured at an incident energy near the Coulomb barrier. Detailed coupled reaction channel calculations have been carried out for description of the measured angular distributions for the elastic scattering and transfer reactions simultaneously. The two-neutron transfer reaction {sup 206}Pb({sup 18}O, {sup 16}O){sup 208}Pb in the g.s. → g.s. transition is analyzed in (i) extreme cluster model assuming a di-neutron transfer, (ii) two-step successive transfer, and (iii) microscopic approach (independent coordinate scheme) of simultaneous transfer of two neutrons. The relative importance of one step simultaneous transfer versus two-step successive transfer has been studied. Present analysis suggests dominance of cluster transfer of a di-neutron. The contribution from the two-step sequential processes is less significant, however, the combined “two-step plus simultaneous (microscopic)” calculations give a reasonably good agreement with the measurement. The possibility of multi-step route via projectile and target excitations and contribution from such indirect transfer paths to the present two-neutron transfer cross section has been investigated.

  7. Correlations between the alpha particles and ejectiles in the 208 MeV 14N on 93Nb reaction at three different ejectile angles

    International Nuclear Information System (INIS)

    Fukuda, T.; Ishihara, M.; Tanaka, M.; Ogata, H.; Miura, I.; Inoue, M.; Shimoda, T.; Katori, K.; Nakayama, S.

    1983-01-01

    The in plane correlations between alpha particles and various ejectiles were investigated in the reaction of 208 MeV 14 N on 93 Nb at theta/sub HI/ = +22 0 , +50 0 , and +80 0 . There were three sources of coincident alpha particles: (i) the sequential alpha decay of the excited ejectiles, (ii) the equilibrium alpha emission from the targetlike fragments, and (iii) the nonequilibrium process. Process (i) contributed mainly to the cross sections with the angular range of theta/sub α/ close to theta/sub HI/. Process (ii) contributed to the lowest part of the alpha energy spectra irrespectively of theta/sub HI/ and theta/sub α/. The remaining part was ascribed to process (iii). For this process the differential coincidence cross section of the lower energy part of the alpha particles was approximately factorized as d 4 sigma/dΩ/sub HI/dΩ/sub α/dE/sub HI/dE/sub α/ = K (d 2 sigma/dΩ/sub HI/dE/sub HI/)/sub singles/ (d 2 sigma/dΩ/sub α/dE/sub α/)/sub singles/ with Kapprox.0.4/b, whereas the higher energy part of the alpha particles emitted at the forward angles had a tendency to coincide weakly with the ejectiles emitted at the backward angles (theta/sub HI/ = +50 0 and +80 0 ) as compared to the lower energy part of the alpha particles

  8. Unified description of the neutron-/sup 208/Pb mean field between -20 and +165 MeV from the dispersion relation constraint

    International Nuclear Information System (INIS)

    Johnson, C.H.; Horen, D.J.; Mahaux, C.

    1987-01-01

    The real part of the central neutron-/sup 208/Pb mean field is the sum of a Hartree-Fock component plus a dispersive component. In keeping with theoretical expectations, the Hartree-Fock field is assumed to have a Woods-Saxon shape whose depth decreases exponentially with increasing energy and whose radius and diffuseness are independent of energy. The dispersive component is determined from the imaginary part of the optical-model potential by making use of the dispersion relation which connects these two quantities. The imaginary part is written as the sum of a volume and a surface-peaked contribution. The dispersion relation then implies that the real dispersive contribution is also the sum of volume and surface-peaked components. The parameters of the complex mean field are determined by fitting the available differential and polarization cross sections in the energy domain [4, 40 MeV] and the total cross sections in the domain [1,120 MeV]; these data are contained in previous published or unpublished reports, but new measurements of the total cross sections are presented from 1 to 25 MeV. Good fits to these cross sections, and also to unpublished total cross sections for energies up to 165 MeV, are obtained despite the fact that the number of adjusted parameters is quite small because of our use of the constraint implied by the dispersion relation

  9. Urea Cycle Defects: Early-Onset Disease Associated with A208T Mutation in OTC Gene—Expanding the Clinical Phenotype

    Directory of Open Access Journals (Sweden)

    Ana Isabel Sánchez

    2017-01-01

    Full Text Available Ornithine transcarbamylase deficiency (OMIM: 311250 is the most common disorder of urea cycle disorders, accounting for nearly 50% of all cases. We report a case of a two-month- old male patient, who attends our medical genetics consultation because of low citrulline levels and elevated glutamine to citrulline ratio detected by expanded newborn screening with tandem mass spectrometry. He is an asymptomatic male with a normal physical examination and appropriate neurodevelopmental milestones. The patient has a family history of one older brother who died at 18 months old from severe and sudden hyperammonemia and a maternal aunt who suddenly died at two years old. He had high plasma ammonium concentration and a confirmed OTC mutation (p.A208T. Usually, this mutation causes OTC deficiency of late onset in adult males. However, this report raises awareness about mutations previously described as a late-onset causing disease, which can cause severe hyperammonemia and high risk of dying at an early age.

  10. Recovery of radiogenic lead-208 from a residue of thorium and rare earths obtained during the operation of a thorium nitrate purification pilot plant

    International Nuclear Information System (INIS)

    Seneda, Jose Antonio

    2006-01-01

    Brazil has a long tradition in thorium technology, from mineral dressing (monazite) to the nuclear grade thorium compounds. The estimate reserves are 1200,000. ton of ThO 2 . As a consequence from the work of thorium purification pilot plant at Instituto de Pesquisas Energeticas e Nucleares-CNEN/SP, about 25 ton of a sludge containing thorium and rare earths was accumulated. It comes as a raffinate and washing solutions from thorium solvent extraction. This sludge, a crude hydroxide named RETOTER contains thorium, rare earths and minor impurities including the radiogenic lead-208, with abundance 88.34 %. This work discusses the results of the studies and main parameters for its recovery by anionic ion exchange technique in the hydrochloric system. The isotope abundance of this lead was analyzed by high resolution mass spectrometer (ICPMS) and thermoionic mass spectrometer (TIMS) and the data was used to calculate the thermal neutron capture cross section. The value of s ? o = 14.6 +/- 0.7 mb was found, quite different from the s ? o = 174.2 +/- 7.0 mb measure cross section for the natural lead. Preliminary study for the thorium and rare earths separation and recovery was discussed as well. (author)

  11. Recovery of radiogenic lead-208 from a residue of thorium and rare earths obtained during the operation of a thorium purification pilot plant

    International Nuclear Information System (INIS)

    Seneda, Jose Antonio

    2006-01-01

    Brazil has a long tradition in thorium technology, from mineral dressing (monazite) to the nuclear grade thorium compounds. The estimate reserves are 1200,000. ton of ThO 2 . As a consequence from the work of thorium purification pilot plant at Instituto de Pesquisas Energeticas e Nucleares-CNEN/IPEN-SP, about 25 ton of a sludge containing thorium and rare earths was accumulated. It comes as a raffinate and washing solutions from thorium solvent extraction. This sludge, a crude hydroxide named RETOTER contains thorium, rare earths and minor impurities including the radiogenic lead-208, with abundance 88.34 %. This work discusses the results of the studies and main parameters for its recovery by anionic ion exchange technique in the hydrochloric system. The isotope abundance of this lead was analyzed by high resolution mass spectrometer (ICPMS) and thermoionic mass spectrometer (TIMS) and the data was used to calculate the thermal neutron capture cross section. The value of σγ 0 = 14.6±0.7 mb was found, quite different from the σγ 0 = 174.2 ± 7.0 mb measure cross section for the natural lead. Preliminary study for the thorium and rare earths separation and recovery was discussed as well. (author)

  12. Comparison of reactions for the production of 258,257Db: 208Pb(51V,xn) and 209Bi(50Ti,xn)

    Energy Technology Data Exchange (ETDEWEB)

    Gates, Jacklyn M.; Nelson, Sarah L.; Gregorich, Kenneth E.; Dragojevic, Irena; Dullmann, Christoph E.; Ellison, Paul A.; Folden III, Charles M.; Garcia, Mitch A.; Stavsetra, Liv; Sudowe, Ralf; Hoffman, Darleane C.; Nitsche, Heino

    2008-09-29

    Excitation functions for the 1n and 2n exit channels of the 208Pb(51V,xn)259-xDb reaction were measured. A maximum cross section of the 1n exit channel of 2070+1100/-760 pb was measured at an excitation energy of 16.0 +- 1.8 MeV. For the 2n exit channel, a maximum cross section of 1660+450/-370 pb was measured at 22.0 +- 1.8 MeV excitation energy. The 1n excitation function for the 209Bi(50Ti,n)258Db reaction was remeasured, resulting in a cross section of 5480+1750/-1370 pb at an excitation energy of 16.0 +- 1.6 MeV, in agreement with previous values [F. P. Hebberger, et al., Eur. Phys. J. A 12, 57 (2001)]. Differences in cross section maxima are discussed in terms of the fusion probability below the barrier.

  13. Evaluation of the Addition liquor with high ammonia and Carbon Dioxide contentin the still 208 of the “Comandante Che Guevara” industry (ECG

    Directory of Open Access Journals (Sweden)

    María Elena Magaña-Haynes

    2015-12-01

    Full Text Available Adding fresh liquor through the 5th ring in still 208 of distilling liquor product (liquor obtained as a result of ammonium carbonate leaching of lateritic ore in the “Comandante Che Guevara” industry, were evaluated with the objective of reducing the dissolved nickel content of the effluent there from, as well as to improve the characteristics of the nickel carbonate which is delivered to the calcinations process. For the development of the survey, the same methodology used in 2001 for the test was applied. The results showed that by adding fresh liquor, it is possible to reduce the dissolved nickel content at the exit of the distillation column, so that the need for precipitation is minimized, thereby reducing the consumption of reagents and the and the cost for their acquisition. It was possible to corroborate the relationship between the content of NH3 at the discharge and the nickel dissolved therein appreciating that to achieve these results it is necessary to maintain the ammonia in the discharge between 1,0-1,8 g/L. The carbonate obtained in the column where liquor is added with high CO2 and NH3 reached high values of this last element in its composition and to the extent that increased sulphur content decreased. It was also seen an increase in the size of the coarse carbonates particles, which will influence in a decrease of energy consumption.

  14. Multi-step processes in the (d, t) and (d, 3He) reactions on 116Sn and 208Pb targets at Ed = 200 MeV

    International Nuclear Information System (INIS)

    Langevin-Joliot, H.; Van de Wiele, J.; Guillot, J.; Koning, A.J.

    2000-01-01

    The role of multi-step processes in the reactions 116 Sn(d,t), 208 Pb(d,t) and 116 Sn(d, 3 He), previously studied at E d = 200 MeV at forward angles and for relatively low energy transfers, has been investigated. We have performed for the first time multi-step calculations taking into account systematically collective excitations in the second and higher order step inelastic transitions. A calculation code based on the Feshbach, Kerman and Koonin model has been modified to handle explicitly these collective excitations, most important in the forward angle domain. One step double differential pick-up cross sections were built from finite range distorted wave results spread in energy using known or estimated hole state characteristics. It is shown that two-step cross sections calculated using the above method compare rather well with those deduced via coupled channel calculations for the same collective excitations. The multi-step calculations performed up to 6 steps reproduce reasonably well the 115 Sn, 207 Pb and 115 In experimental spectra measured up to E x ∼- 40 MeV and 15 deg. The relative contributions of steps of increasing order to pick-up cross sections at E d = 200 MeV and 150 MeV are discussed. (authors)

  15. Association between TSH-Receptor Autoimmunity, Hyperthyroidism, Goitre, and Orbitopathy in 208 Patients Included in the Remission Induction and Sustenance in Graves’ Disease Study

    Directory of Open Access Journals (Sweden)

    Peter Laurberg

    2014-01-01

    Full Text Available Background. Graves’ disease may have a number of clinical manifestations with varying degrees of activity that may not always run in parallel. Objectives. To study associations between serum levels of TSH-receptor autoantibodies and the three main manifestations of Graves’ disease (hyperthyroidism, goiter, and presence of orbitopathy at the time of diagnosis of hyperthyroidism. Methods. We describe a cohort of 208 patients with newly diagnosed Graves’ hyperthyroidism. Patients were enrolled in a multiphase study of antithyroid drug therapy of Graves’ hyperthyroidism, entitled “Remission Induction and Sustenance in Graves’ Disease (RISG.” Patients were systematically tested for degree of biochemical hyperthyroidism, enlarged thyroid volume by ultrasonography, and the presence of orbitopathy. Results. Positive correlations were found between the levels of TSH-receptor autoantibodies in serum and the three manifestations of Graves’ disease: severeness of hyperthyroidism, presence of enlarged thyroid, and presence of orbitopathy, as well as between the different types of manifestations. Only around half of patients had enlarged thyroid gland at the time of diagnosis of hyperthyroidism, whereas 25–30% had orbitopathy. Conclusions. A positive but rather weak correlation was found between TSH-receptor antibodies in serum and the major clinical manifestation of Graves’ disease. Only half of the patients had an enlarged thyroid gland at the time of diagnosis.

  16. (p,t) reaction on /sup 12/C, /sup 54/Fe and /sup 208/Pb at 80 MeV. [80 MeV, angular distributions, zerio-range DWBA

    Energy Technology Data Exchange (ETDEWEB)

    Shepard, J R; Anderson, R E; Kraushaar, J J; Ristinen, R A [Colorado Univ., Boulder (USA). Nuclear Physics Lab.; Comfort, J R [Pittsburgh Univ., PA (USA). Dept. of Physics; King, N S.P. [Los Alamos Scientific Lab., NM (USA); Bacher, A; Jacobs, W W [Indiana Univ., Bloomington (USA). Dept. of Physics

    1979-06-11

    Angular distributions have been measured for the low-lying levels of the residual nuclei for the /sup 12/C, /sup 54/Fe and /sup 208/Pb(p,t) reactions at E/sub p/ = 80 MeV. The shapes of these angular distributions are generally well reproduced by the zero-range distorted-wave Born approximation (DWBA). Enhancement factors extracted from the data show that the DWBA predicts relative strengths consistent with those observed at lower bombarding energies. However, the overall empirical DWBA normalization at E/sub p/ = 80 MeV is observed to be 1/12(1/4) of that required at 40 MeV for /sup 208/Pb(/sup 54/Fe).

  17. Measurement of gamma-ray production cross sections in 27Al(n,xnγ) and 208Pb(n,pxnγ) reactions for neutron energies up to 400 MeV

    International Nuclear Information System (INIS)

    Pavlik, A.; Vonach, H.; Hitzenberger-Schauer, H.; Chadwick, M.B.; Nelson, R.O.; Haight, R.C.; Wender, S.A.; Young, P.G.

    1999-01-01

    The prompt γ-radiation from the interaction of fast neutrons with samples of Al and enriched 208 Pb was measured using the white neutron beam of the LANSCE/WNR facility at the Los Alamos National Laboratory. From the aluminum γ-ray spectra excitation functions for prominent γ-ray transitions in various residual nuclei (in the range from F to Al) were determined for neutron energies up to 400 MeV. In addition to the primary purpose of the 208 Pb experiment, the study of (n,xnγ) reactions leading to various lead isotopes. γ-ray transitions in residual Tl nuclei were analyzed and cross sections were derived in the neutron energy range from the effective threshold to 200 MeV. In the neutron energy range up to 200 MeV all experimental results were compared with nuclear model calculations using the code GNASH. (author)

  18. Study of elastic pion scattering from /sup 9/Be, /sup 28/Si, /sup 58/Ni, and /sup 208/Pb at 162 MeV. [Total and differential cross sections, scattering yields, scattering amplitudes

    Energy Technology Data Exchange (ETDEWEB)

    Devereux, M.J.

    1979-05-01

    Elastic pion scattering from /sup 9/Be, /sup 28/Si, /sup 58/Ni, and /sup 208/Pb at 162 MeV is analyzed and compared with an optical model theory which incorporates a pion--nucleon range. Excellent fits to the data are obtained in all but one case. The fitted values of the pion--nucleon range, as well as other fitted values are listed. 108 references.

  19. Analyzing power measurements for 209Bi(n,n) at 6 and 9 MeV and consistent dispersive optical-model analyses for n+209Bi and n+208Pb from -20 to +80 MeV

    International Nuclear Information System (INIS)

    Weisel, G.J.; Tornow, W.; Howell, C.R.; Felsher, P.D.; AlOhali, M.; Roberts, M.L.; Das, R.K.; Walter, R.L.; Mertens, G.

    1996-01-01

    High-accuracy measurements of A y (θ) data for elastic scattering for n+ 209 Bi have been performed at 6 and 9 MeV. The data are incorporated into a large database of σ(θ), A y (θ), and σ T for n+ 209 Bi covering the energy range 1.0 endash 80 MeV. A complementary database is constructed for n+ 208 Pb and a dispersive optical-model analysis is performed for both scattering systems while constraining many of the parameters to be identical for both systems. A good representation of both databases is obtained with conventional geometry and spin-orbit parameters. The 208 Pb model predicts quite well the measured energies of valence single-particle and single-hole bound states. Occupation probabilities and spectroscopic factors for the same bound states are also calculated. Finally, a fully constrained model is presented in which the only differences between the n+ 208 Pb and the n+ 209 Bi systems are the Fermi energy and the isospin dependence in the real volume potential. copyright 1996 The American Physical Society

  20. A precise 232Th-208Pb chronology of fine-grained monazite: Age of the Bayan Obo REE-Fe-Nb ore deposit, China

    Science.gov (United States)

    Wang, Jingyuan; Tatsumoto, M.; Li, X.; Premo, W.R.; Chao, E.C.T.

    1994-01-01

    We have obtained precise Th-Pb internal isochron ages on monazite and bastnaesite for the world's largest known rare earth elements (REE)-Fe-Nb ore deposit, the Bayan Obo of Inner Mongolia, China. The monazite samples, collected from the carbonate-hosted ore zone, contain extremely small amounts of uranium (less than 10 ppm) but up to 0.7% ThO2. Previous estimates of the age of mineralization ranged from 1.8 to 0.255 Ga. Magnetic fractions of monazite and bastnaesite samples (<60-??m size) showed large ranges in 232Th 204Pb values (900-400,000) and provided precise Th-Pb internal isochron ages for paragenetic monazite mineralization ranging from 555 to 398 Ma within a few percent error (0.8% for two samples). These results are the first indication that REE mineralization within the giant Bayan Obo ore deposit occurred over a long period of time. The initial lead isotopic compositions (low 206Pb 204Pb and high 208Pb 204Pb) and large negative ??{lunate}Nd values for Bayan Obo ore minerals indicate that the main source(s) for the ores was the lower crust which was depleted in uranium, but enriched in thorium and light rare earth elements for a long period of time. Zircon from a quartz monzonite, located 50 km south of the ore complex and thought to be related to Caledonian subduction, gave an age of 451 Ma, within the range of monazite ages. Textural relations together with the mineral ages favor an epigenetic rather than a syngenetic origin for the orebodies. REE mineralization started around 555 Ma (disseminated monazite in the West, the Main, and south of the East Orebody), but the main mineralization (banded ores) was related to the Caledonian subduction event ca. 474-400 Ma. ?? 1994.

  1. Commissioning of the STAR test section for experimental simulation of loss of coolant accident using the EC-208 instrumented fuel assembly of the IEA-R1 reactor

    Energy Technology Data Exchange (ETDEWEB)

    Maprelian, Eduardo; Torres, Walmir M.; Prado, Adelk C.; Umbehaun, Pedro E.; Franca, Renato L.; Santos, Samuel C.; Macedo, Luiz A.; Sabundjian, Gaiane, E-mail: emaprel@ipen.br, E-mail: wmtorres@ipen.br, E-mail: acprado@ipen.br, E-mail: umbehaun@ipen.br, E-mail: rlfranca@ipen.br, E-mail: samuelcs@ipen.br, E-mail: lamacedo@ipen.br, E-mail: gdjian@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SO (Brazil)

    2015-07-01

    The three basic safety functions of Research Reactors (RR) are the safe shutdown of the reactor, the proper cooling of the decay heat of the fuel elements and the confinement of radioactive materials. Compared to Nuclear Power Reactors, RR power release is small, yet its three safety functions must be met to ensure the integrity of the reactor. During a loss of coolant accident (LOCA) in pool type RR, partial or complete loss of pool water may occur, with consequent partial or complete uncovering of the fuel assemblies. In such an accident, the decay heat removal safety function must not be compromised. The Test Section for Experimental Simulation of Loss of Coolant Accident (STAR) is in commissioning phase. This test section will provide experimental data on partial and total uncovering of the EC-208 instrumented fuel assembly (IFA) irradiated in the IEA-R1. Experimental results will be useful in validation of computer codes for RR safety analysis, particularly on heat removal efficiency aspects (safety function) in accident conditions. STAR comprises a base on which is installed the IFA, the cylindrical stainless steel hull, the compressed air system for the test section emptying and refilling, and the instrumentation for temperature and level measurements. The commissioning tests or pre-operational check, consist of several preliminary tests to verify experimental procedures, the difficulties during assembling of STAR in the pool, the difficulties in control the emptying and refilling velocities, as well as, the repeatability capacity, tests of equipment, valves and systems and tests of instrumentation and data acquisition system. Safety, accuracy and easiness of operation will be checked. (author)

  2. What characterises women who eat potatoes? A cross-sectional study among 74,208 women in the Norwegian Women and Cancer cohort

    Directory of Open Access Journals (Sweden)

    Lene A. Åsli

    2015-02-01

    Full Text Available Background: Studies of potato consumption have shown that age, region, socioeconomic status, and household structure are important determinants. Objective: This study aims to map which factors influence potato consumption among women in the Norwegian Women and Cancer (NOWAC study. Design: A cross-sectional study using a postal questionnaire among 74,208 NOWAC participants aged 41–70. Results: Results showed that 56% of the women ate at least two potatoes a day. A north–south gradient in potato consumption was observed in logistic regression models (OR: 3.41, 95% CI: 3.19–3.64 for the north compared to the capital. Women in households with children had lower odds of high potato consumption than women living only with a partner, and women who lived alone had the lowest odds of all (OR: 0.39, 95% CI: 0.37–0.41. Smokers had higher odds of high potato consumption, while diabetics had lower odds. The odds of high potato consumption were greater among older women, and among those with lower income and education. In a sub-cohort, women who were dieting had lower odds of high potato consumption. Consumption of different foods varied in the low versus the high potato consumption group, with largest effect for fish and pasta/rice. The groups had similar nutrient densities. Conclusions: In addition to lifestyle and socioeconomic factors, health-related factors like smoking and diabetes were found to influence potato consumption. The high potato consumption group had an especially high consumption of fish and a low consumption of pasta/rice, though the nutrient density in the groups was similar.

  3. Study of the giant multipole resonances, especially the isoscalar giant E2 resonance in 208Pb by inelastic electron scattering with medium and high energy resolution

    International Nuclear Information System (INIS)

    Kuehner, E.G.F.

    1982-01-01

    In the nucleus 208 Pb giant multipole resonances were looked for by inelastic electron scattering up to excitation energies of Esub(x) = 35 MeV. Twelve spectra were taken up at incident energies of Esub(o) = 45-65 MeV under scattering angles from upsilon = 93 0 to 165 0 . The cross sections extracted from this were analyzed by means of DWBA calculations using RPA amplitudes from a model with separable residual interaction. Basing on this analysis for the first time it could be shown that the maximum in the electron scattering cross section at Esub(x) approx.= 14 MeV can be consistently described as a superposition of the Jsup(π) = 1 - , ΔT = 1 with a Jsup(π) = 0 + , ΔT = 0 giant resonance. Furthermore the spectra under backward scattering angles indicate the existence of a magnetic excitation at Esub(x) approx.= 15 MeV which is interpreted as Jsup(π) = 3 + giant resonance. Besides under forwards angles a further weak excitation appears at Esub(x) approx.= 14.6 MeV which is very well compatible with Jsup(π) = 2 + . At Esub(x) = 17.5 MeV a Jsup(π) = 3 - resonance was found which recently is also observed in (α,α') scattering experiments and therefore gets a ΔT = 0 assignment. A further resonance at Esub(x) approx.= 21 MeV has also Jsup(π) = 3 - character but has partly to be assigned to a Jsup(π) = 1 - , ΔT = 0 excitation. At Esub(x) = 23.8 MeV a Jsup(π) = 2 + excitation was found which gels because of model predictions a ΔT = 1 assignment. (orig./HSI) [de

  4. Study of the giant multipole resonances especially of the isoscalar giant E2 resonance in 208Pb by medium and high energy resolution inelastic electron scattering

    International Nuclear Information System (INIS)

    Kuehner, G.

    1982-01-01

    In the nucleus 208 Pb giant multipole resonances up to excitation energies of Esub(x) = 35 MeV were looked for by medium resolution inelastic electron scattering. Twelve spectra were taken up at incident energies of E 0 = 45-65 MeV under scattering angles from upsilon = 93 0 to 165 0 . The cross sections extracted from this were analyzed by means of DWBA calculations using RPA amplitudes from a model with separable residual interaction. On the base of this analysis for the first time it could be shown that the maximum in the electron scattering cross section at Esub(x) approx.= 14 MeV can be consistently described as superposition of the Jsup(π) = 1 - , ΔT = 1 with a Jsup(π) = 0 + , ΔT = 0 giant resonance. Furthermore the spectra under backward scattering angles indicate the existence of a magnetic excitation at Esub(x) approx.= 15 MeV which is interpreted as Jsup(π) = 3 + giant resonance. Besides under forward angles a further weak excitation at Esub(x) approx.= 14.6 MeV appears which is very well compatible with Jsup(π) = 2 + . At Esub(x) = 17.5 MeV a Jsup(π) = 3 - resonance was found which recently is observed also in (α, α') experiments and therefore gets a ΔT = 0 assignment. A further resonance at Esub(x) approx.= 21 MeV has also a Jsup(π) = 3 - character but has to be partly assigned to a Jsup(π) = 1 - , ΔT = 0 excitation. At Esub(x) = 23.8 MeV a Jsup(π) = 2 + excitation was found which gets because of model predictions a ΔT = 1 assignment. (orig./HSI) [de

  5. Recovery of radiogenic lead-208 from a residue of thorium and rare earths obtained during the operation of a thorium purification pilot plant; Separacao e recuperacao de chumbo-208 dos residuos de torio terras raras gerados na unidade piloto de purificacao de nitrato de torio

    Energy Technology Data Exchange (ETDEWEB)

    Seneda, Jose Antonio

    2006-07-01

    Brazil has a long tradition in thorium technology, from mineral dressing (monazite) to the nuclear grade thorium compounds. The estimate reserves are 1200,000. ton of ThO{sub 2}. As a consequence from the work of thorium purification pilot plant at Instituto de Pesquisas Energeticas e Nucleares-CNEN/IPEN-SP, about 25 ton of a sludge containing thorium and rare earths was accumulated. It comes as a raffinate and washing solutions from thorium solvent extraction. This sludge, a crude hydroxide named RETOTER contains thorium, rare earths and minor impurities including the radiogenic lead-208, with abundance 88.34 %. This work discusses the results of the studies and main parameters for its recovery by anionic ion exchange technique in the hydrochloric system. The isotope abundance of this lead was analyzed by high resolution mass spectrometer (ICPMS) and thermoionic mass spectrometer (TIMS) and the data was used to calculate the thermal neutron capture cross section. The value of {sigma}{gamma}{sup 0} = 14.6{+-}0.7 mb was found, quite different from the {sigma}{gamma}{sup 0} = 174.2 {+-} 7.0 mb measure cross section for the natural lead. Preliminary study for the thorium and rare earths separation and recovery was discussed as well. (author)

  6. Measurement of isotopic cross sections of the fission fragments produced in 500 AMeV {sup 208}Pb + p reaction; Etude de la production des fragments de fission issus de la reaction {sup 208}Pb + p a 500 AMeV

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez-Dominguez, B

    2003-03-01

    The aim of this work is the study of the fission fragments produced in the spallation reaction {sup 208}Pb + p at 500 AMeV. The fission fragments from Z=23 up to Z=59 have been detected and identified by using the inverse kinematics technique with the high-resolution spectrometer FRS. The production cross sections and the recoil velocities of 430 nuclei have been measured. The measured data have been compared with previous data. The isotopic distributions show a high precision. However, the absolute value of the fission cross section is higher than expected. From the experimental data the characteristics of the average fissioning system have been reconstructed (Z{sub fis}, A{sub fis}, E*{sub fis}). In addition, the number of post-fission neutrons emitted from the fission fragments, v{sub post}, has been determined by using a new method. The experimental data have been compared to the two-steps models describing the spallation reaction. The impact of the model parameters on the observables has been analysed and the reasons Leading to the observed differences between the codes are also presented. This analyse shows a good agreement with the INCL4+ABLA code. (author)

  7. /sup 13/C(p vector,d)/sup 12/C and /sup 208/Pb(p vector,d)/sup 207/Pb reactions at 123 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Kraushaar, J J; Shepard, J R [Colorado Univ., Boulder (USA). Nuclear Physics Lab.; Miller, D W; Jacobs, W W; Jones, W P; Devins, D W [Indiana Univ., Bloomington (USA). Dept. of Physics

    1983-02-01

    Cross-section and analyzing power angular distributions have been measured for /sup 13/C(p vector,d) and /sup 208/Pb(p vector, d) at 123 MeV to the strong low-lying residual states in both final nuclei. The data have been compared with the results of both zero- and exact-finite-range distorted wave calculations and some serious discrepancies were noted for the analyzing powers. For the case of the /sup 13/C calculations, marked improvement in the description of the data was achieved with the use of a damping factor in the nuclear interior.

  8. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  9. Study of tracking detector of NEMO3 experiment - simulation of the measurement of the ultra low {sup 208}Tl radioactivity in the source foils used as neutrinoless double beta decay emitters in NEMO3 experiment; Etude du detecteur de traces de l'experience NEMO3. Simulation de la mesure de l'ultra-faible radioactivite en {sup 208}Tl des sources de l'experience NEMO3 candidates a la double desintegration {beta} sans emission de neutrino

    Energy Technology Data Exchange (ETDEWEB)

    Errahmane, K

    2001-04-01

    The purpose of NEMO3 experiment is the research of the neutrinoless double beta decay. This low energy process can sign the massive and Majorana nature of neutrino. This experiment, with a very low radioactive background and containing 10 kg of enriched isotopes, studies mainly {sup 100}Mo. Installed at the Frejus underground laboratory, NEMO3 is a cylindrical detector, which consists in very thin central source foils, in a tracking detector made up of vertical drift cells operating in Geiger mode, in a calorimeter and in a suitable shielding. This thesis is divided in two different parts. The first part is a full study of the features of the tracking detector. With a prototype composed of 9 drift cells, we characterised the longitudinal and transverse reconstruction of position of the ionisation created by a LASER. With the first 3 modules under operation, we used radioactive external neutron sources to measure the transverse resolution of ionisation position in a drift cell for high energy electrons. To study the vertex reconstruction on the source foil, sources of {sup 207}Bi, which produced conversion electrons, were used inside the 3 modules. The second part of this thesis, we show, with simulations, that we can measure, with NEMO3 detector itself, the ultra low level of contamination in {sup 208}Tl of the source foil, which comes from the natural radioactive chain of thorium. Using electron-photons channels, we can obtain the {sup 208}Tl activity in the sources. With an analysis on the energy and on the time of flight of particles, NEMO3 is able to reach a sensitivity of 20{mu}Bq/kg after only 2 months of measurement. This sensitivity is the maximum {sup 208}Tl activity, which we accepted for the sources in the NEMO3 proposal. (author)

  10. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)

    2011-02-07

    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  11. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    International Nuclear Information System (INIS)

    Marx, Sebastian Markus

    2014-01-01

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  12. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    International Nuclear Information System (INIS)

    Koyama, Mutsuo

    1989-01-01

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  13. E0 and E2 decay of low-lying 0+ states in the even-even nuclei 206Pb, 208Po, 112-120 Sn and 112114Cd

    International Nuclear Information System (INIS)

    Julin, Rauno.

    1979-04-01

    Several new methods of in-beam conversion-electron and γ-ray spectrometry, applicable in the determination of E0 and E2 decay properties of low-lying 0 + states in even-mass nuclei, have been developed. The main attention has been paid to direct lifetime-measurement and coincidence methods based on the use of the natural pulsing of a cyclotron beam. With the aid of these methods, the similarity of the absolute decay rates of the two-neutron-hole 0 + 2 states in the N = 124 nuclei 206 Pb and 208 Po has been shown. A systematic investigation of the de-excitation of the 0 + 2 and 0 + 3 states in 112 , 11 4 , 116 , 118 , 120 Sn has been carried out. Twelve E0 transitions connecting the 0 + states have been observed, including very strong low-energy E0 transitions between the excited 0 + states, and several absolute transition probabilities have been determined. Furthermore, the new techniques have been applied successfully in determining the absolute E0 and E2 transition rates from the 0 + 2 and 0 + 3 states in 112 Cd and 114 Cd. The use of isotope-shift data in the calculation of the monopole strengths in 206 Pb and 208 Po is discussed. The results on even Sn and Cd nuclei are discussed within the framework of the coexistence of different shapes and of configuration mixing. (author)

  14. Structure and Dielectric Properties of (Sr0.2Ca0.488Nd0.208) TiO3-Li3NbO4 Ceramic Composites

    Science.gov (United States)

    Xia, C. C.; Chen, G. H.

    2017-12-01

    The new ceramic composites of (1-x) Li3NbO4-x (Sr0.2Ca0.488Nd0.208)TiO3 were prepared by the conventional solid state reaction method. The sintering behavior, phase composition, microstructure and microwave dielectric properties of the ceramics were investigated specially. The SEM and XRD results show that (1-x) Li3NbO4-x (Sr0.2Ca0.488Nd0.208) TiO3 (0.35≤x≤0.5) composites were composed of two phase, i.e. perovskite and Li3NbO4. With the increase of x, the ɛr increases from 27.1 to 38.7, Q×f decreases from 55000 GHz to 16770 GHz, and the τ f increases from -49 ppm/°C to 226.7 ppm/°C. The optimized dielectric properties with ɛr∼31.4, Q×f~16770GHz and τf~-8.1ppm/°C could be obtained as x=0.4 sintered at 1100°C for 4h. The as-prepared ceramic is expected to be used in resonators, filters, and other microwave devices.

  15. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    Energy Technology Data Exchange (ETDEWEB)

    Patin, Joshua Barnes [Univ. of California, Berkeley, CA (United States)

    2002-01-01

    The study of the reactions between heavy ions and 208Pb, 209Bi, 238U, and 248Cm Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the 238U(18O,xn)256-xFm, 238U(22Ne,xn)260-xNo, and 248Cm(15N,xn)263-xLr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The 48Pb(238Ca,xn)256-xNo, 208Pb(50Ti,xn)258-xRf, 208Pb(51V,xn)259-xDb, 50Bi(238Ti,xn)259-xDb, and 209Bi(51V,xn)260-xSg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics.

  16. Study of the /sup 58/Ni, /sup 90/Zr and /sup 208/Pb(p,d) reactions at 121 MeV. [DWBA, angular distributions, spectroscopic factors, finite range calculations

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, R E; Kraushaar, J J; Shepard, J R [Colorado Univ., Boulder (USA). Nuclear Physics Lab.; Comfort, J R [Indiana Univ., Bloomington (USA). Dept. of Physics

    1978-01-01

    The (p,d) reaction has been studied on /sup 58/Ni, /sup 90/Zr and /sup 208/Pb at 121 MeV in order to test the applicability of the usual DWBA methods to higher energy data. The calculations describe the angular distribution for the strongly excited low-lying states reasonably well when adiabatic-deuteron optical potentials are used. Some discrepancies in shape persist, however, and some values of the spectroscopic factors differ from lower energy data in spite of many variations in the calculations. By use of exact finite-range calculations a value of D/sup 2//sub 0/ = 1.23 x 10/sup 4/ MeV/sup 2/.fm/sup 3/ was found for use at 121 MeV. Deuteron D-state contributions were negligible at forward angles and two-step contributions do not appear more significant than for data at lower energy.

  17. Elastic scattering of protons by 16O, 40Ca and 208Pb at 200, 500 and 800 MeV: 2, Effects of vacuum polarization and Pauli blocking corrections

    International Nuclear Information System (INIS)

    Ottenstein, N.; Wallace, S.J.; Tjon, J.A.

    1987-11-01

    Dirac impulse approximation predictions for cross sections and spin observables in elastic proton scattering by 40 Ca and 208 Pb at energies of 200, 500 and 800 MeV are presented. The analysis is based on complete sets of Lorentz invariant NN amplitudes determined from a meson exchange model of the nuclear force. Effects of relativistic nuclear densities are explored including estimates of the vacuum polarization corrections based on quantum hadrodynamics. Effects of Pauli blocking are considered using the approximations of Murdock and Horowitz. A good description of the experimental data is obtained over a broad energy range and over a wide variation of nuclear size based on the generalized impulse approximation. Vacuum polarization corrections are found to enhance the agreement between theory and experiment. 18 refs., 8 figs

  18. Inherited thrombophilia in women with poor aPL-related obstetric history: prevalence and outcomes. Survey of 208 cases from the European Registry on Obstetric Antiphospholipid Syndrome cohort.

    Science.gov (United States)

    Alijotas-Reig, Jaume; Ferrer-Oliveras, Raquel; Esteve-Valverde, Enrique; Ruffatti, Amelia; Tincani, Angela; Lefkou, Elmina; Bertero, Maria Tiziana; Espinosa, Gerard; Coloma, Emmanuel; de Carolis, Sara; Rovere-Querini, Patrizia; Canti, Valentina; Picardo, Elisa; Fredi, Micaela; Mekinian, Arsene

    2016-08-01

    To analyse the prevalence and effects of inherited thrombophilic disorders (ITD) on maternal-foetal outcomes in cases of antiphospholipid antibody related to obstetric complications. Women with obstetric complaints who tested positive for aPL and with inherited thrombophilia were prospectively and retrospectively included. ITD data were available in 208 of 338: 147 had obstetric antiphospholipid syndrome (OAPS) and 61 aPL-related obstetric morbidity (OMAPS). 24.1% had ITD. Laboratory categories I and IIa were more related to OAPS-ITD and IIb and IIc to OMAPS-ITD. No significant differences in obstetric complaints were observed. Regarding ITD carriers, treatment rates were higher in OAPS than in OMAPS for LMWH and LDA plus LMWH (P=.002). Cases with aPL-related OAPS/OMAPS showed no differences in maternal-foetal outcomes regardless of the presence of one ITD. Maternal thrombotic risk was low, with ITD-positive cases included. Registry data concur with Sydney criteria, whereby aPL-ITD-positive patients are classified as having antiphospholipid syndrome. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  19. Multi-step processes in the (d, t) and (d, {sup 3}He) reactions on {sup 116}Sn and {sup 208}Pb targets at E{sub d} = 200 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Langevin-Joliot, H.; Van de Wiele, J.; Guillot, J. [Institut de Physique Nucleaire, IN2P3/CNRS, 91 - Orsay (France); Koning, A.J. [Nuclear Research and Consultancy Group NRG, NL (Netherlands)

    2000-07-01

    The role of multi-step processes in the reactions {sup 116}Sn(d,t), {sup 208}Pb(d,t) and {sup 116}Sn(d,{sup 3}He), previously studied at E{sub d} = 200 MeV at forward angles and for relatively low energy transfers, has been investigated. We have performed for the first time multi-step calculations taking into account systematically collective excitations in the second and higher order step inelastic transitions. A calculation code based on the Feshbach, Kerman and Koonin model has been modified to handle explicitly these collective excitations, most important in the forward angle domain. One step double differential pick-up cross sections were built from finite range distorted wave results spread in energy using known or estimated hole state characteristics. It is shown that two-step cross sections calculated using the above method compare rather well with those deduced via coupled channel calculations for the same collective excitations. The multi-step calculations performed up to 6 steps reproduce reasonably well the {sup 115}Sn, {sup 207}Pb and {sup 115}In experimental spectra measured up to E{sub x}{approx}- 40 MeV and 15 deg. The relative contributions of steps of increasing order to pick-up cross sections at E{sub d} = 200 MeV and 150 MeV are discussed. (authors)

  20. An aerial radiological survey of the Sandia National Laboratories and surrounding area

    International Nuclear Information System (INIS)

    Riedhauser, S.R.

    1994-06-01

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

  1. Deeply bound π- states in 207Pb formed in the 208Pb(d,3He) reaction. II. Deduced binding energies and widths and the pion-nucleus interaction

    Science.gov (United States)

    Itahashi, K.; Oyama, K.; Hayano, R. S.; Gilg, H.; Gillitzer, A.; Knülle, M.; Münch, M.; Schott, W.; Kienle, P.; Geissel, H.; Iwasa, N.; Münzenberg, G.; Hirenzaki, S.; Toki, H.; Yamazaki, T.

    2000-08-01

    We find a remarkable agreement of the excitation energy spectrum of the 208Pb(d,3He) reaction measured at Td=600 MeV near the π- production threshold with its theoretical prediction. Their comparison leads us to assign the distinct narrow peak observed at about 5 MeV below the threshold to the formation of bound pionic states π-⊗207Pb of the quasisubstitutional configurations (2p)π-(3p3/2,3p1/2)-1n. A small bump observed on the tail of the peak is assigned to the pionic 1s state. The binding energies (Bnl) and the widths (Γnl) of the pionic orbitals are deduced to be B2p=5.13+/-0.02 (stat)+/-0.12 (syst) MeV and Γ2p=0.43+/-0.06 (stat)+/-0.06 (syst) MeV by decomposing the experimental spectrum into the pionic 1s and 2p components. While B2p and Γ2p are determined with small ambiguity, B1s and Γ1s are strongly correlated with each other, and are affected by the relative 1s/2p cross section ratio assumed, since the 1s component is observed only as an unresolved bump. Thus, we have to allow large uncertainties 6.6 MeV

  2. 14 CFR 1274.208 - Intellectual property.

    Science.gov (United States)

    2010-01-01

    ... recipient in the performance of the agreement will be made public. (3) Data can be generated from different...” includes any invention, discovery, improvement, or innovation. Title to an invention made under a...) Non-profit organization or small business. In the event the recipient enters into a subcontract (or...

  3. Publications | Page 208 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity ... Any -, Central Asia, Europe, Far East Asia, Middle East, North and Central ... to health by the Canadian community of practice in ecosystem approaches to health ... Eco-bio-social research on dengue in Asia : a multicountry study on ...

  4. 48 CFR 208.7002 - Assignment authority.

    Science.gov (United States)

    2010-10-01

    ... Defense (Logistics); (3) Outside the contiguous United States, by the Unified Commanders; and (4) For..., even though based on an oral communication, constitutes a one-time agreement. (ii) Consider repetitive...

  5. Publications | Page 208 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of ... Knowledge and Good Principles across eHealth in Africa (open access) ... as a means for regulating behaviour, controlling crime and disorder and.

  6. 50 CFR 223.208 - Corals.

    Science.gov (United States)

    2010-10-01

    ... and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... Guard (USCG), Authorized representatives of States or Indian Tribes. ″Oil Pollution Act″33 U.S.C. 2702... or facility solely under their control. ″Superfund Act″ (CERCLA)42 U.S.C. 9604 Administrator of the...

  7. 48 CFR 1552.208-70 - Printing.

    Science.gov (United States)

    2010-10-01

    ...” (or “camera-ready copy”) is a final document suitable for printing/duplication. “Desktop Publishing... from desktop publishing is being sent to a typesetting device (i.e., Linotronic) with camera copy being... preparing related illustrative material to a final document (camera-ready copy) using desktop publishing. (2...

  8. 22 CFR 208.905 - Affiliate.

    Science.gov (United States)

    2010-04-01

    .... The ways we use to determine control include, but are not limited to— (a) Interlocking management or ownership; (b) Identity of interests among family members; (c) Shared facilities and equipment; (d) Common use of employees; or (e) A business entity which has been organized following the exclusion of a...

  9. 208-IJBCS-Article-Dr Bulus Adzu

    African Journals Online (AJOL)

    RHUMSIKI

    obtained from the Animal Facility Centre,. NIPRD, Abuja, Nigeria were used. They were housed in standard polypropylene cages with saw dust as beddings, and have access to food and water ad libitum. The animals were used in accordance with the ethical norms of NIH. Guide for the Care and Use of Laboratory. Animals ...

  10. PART OF KEFFI SHEET 208 NE

    African Journals Online (AJOL)

    Michael Horsfall

    The samples were taken to UNICAM Solar 32 Data. Station V7.03 ... after which it was conveyed to Centre for Energy. Research ... Physical Parameters: Hydrogen Ion Concentration .... deterioration in the quality of water by production of slims ...

  11. 19 CFR 208.3 - Petitions.

    Science.gov (United States)

    2010-04-01

    ... demonstrates to the satisfaction of the Commission a proper interest in filing a petition. (b) Contents of... States, showing any conversion factors used (for example, most woven fabrics are reported in square... fabric or yarn to the customer identified in the order, and any other information that the interested...

  12. 44 CFR 208.43 - Rehabilitation.

    Science.gov (United States)

    2010-10-01

    ... vehicles. (3) Food and beverages. DHS will reimburse expenditures for food and beverages for Activated Task... Activation. Reimbursement of food and beverage costs for Activated Support Specialists will be limited to... locations at which they were actively supporting the Activation. Food and beverage reimbursement will be...

  13. 37 CFR 2.208 - Deposit accounts.

    Science.gov (United States)

    2010-07-01

    ... copies of records, or services offered by the Office, deposit accounts may be established in the Office... upon receipt of the statement to cover the value of items or services charged to the account and thus... services requested must always be on deposit. Charges to accounts with insufficient funds will not be...

  14. 5 CFR 430.208 - Rating performance.

    Science.gov (United States)

    2010-01-01

    ... only on the evaluation of actual job performance for the designated appraisal period. (2) An agency... limited to, assigning additional retention service credit under § 351.504 of this chapter. (5) Under the provisions of § 351.504(e) of this chapter, the number of years of additional retention service credit...

  15. 44 CFR 208.7 - Enforcement.

    Science.gov (United States)

    2010-10-01

    ... Agency, Participating Agency, Affiliated Personnel or other System Member materially fails to comply with a term of a Cooperative Agreement, Memorandum of Agreement, System directive or other Program... Sponsoring Agency, Participating Agency, Affiliated Personnel or other System Member from being subject to...

  16. 5 CFR 330.208 - Qualification requirements.

    Science.gov (United States)

    2010-01-01

    ... perform the duties and responsibilities of the position. (c) The sex of an individual may not be... qualified for a position if he or she: (1) Meets OPM-established or approved qualification standards and requirements for the position, including any minimum educational requirements, and any selection placement...

  17. 12 CFR 208.83 - Prohibited practices.

    Science.gov (United States)

    2010-01-01

    ... STATE BANKING INSTITUTIONS IN THE FEDERAL RESERVE SYSTEM (REGULATION H) Consumer Protection in Sales of... practice that would lead a consumer to believe that an extension of credit, in violation of section 106(b... agreement by the consumer not to obtain, or a prohibition on the consumer from obtaining, an insurance...

  18. 24 CFR 880.208 - Financing.

    Science.gov (United States)

    2010-04-01

    ... DEVELOPMENT (SECTION 8 HOUSING ASSISTANCE PROGRAMS, SECTION 202 DIRECT LOAN PROGRAM, SECTION 202 SUPPORTIVE...) SECTION 8 HOUSING ASSISTANCE PAYMENTS PROGRAM FOR NEW CONSTRUCTION Definitions and Other Requirements... of the Department of Agriculture compatible with the Section 8 program; and (4) Financing by tax...

  19. 24 CFR 881.208 - Financing.

    Science.gov (United States)

    2010-04-01

    ... DEVELOPMENT (SECTION 8 HOUSING ASSISTANCE PROGRAMS, SECTION 202 DIRECT LOAN PROGRAM, SECTION 202 SUPPORTIVE...) SECTION 8 HOUSING ASSISTANCE PAYMENTS PROGRAM FOR SUBSTANTIAL REHABILITATION Definitions and Other... insurance programs under the National Housing Act; and (3) Financing by tax-exmpt bonds or other obligations...

  20. 24 CFR 208.104 - Applicability.

    Science.gov (United States)

    2010-04-01

    ... Projects (24 CFR part 884); Loans for Housing for the Elderly or Handicapped (24 CFR part 885) and section...(d)(3) Below Market Interest Rate Housing for Low and Moderate Income Mortgage Insurance program (24...); (3) The section 221(d)(3) Below Market Interest Rate Housing for Low and Moderate Income Mortgage...

  1. Gender | Page 208 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC's mission is to support developing-country scientists in conducting applied, community-based research on ... Improve resource management, improve human health ... A new perspective on the links between health and ecosystems.

  2. 28 CFR 36.208 - Direct threat.

    Science.gov (United States)

    2010-07-01

    ... risk to the health or safety of others that cannot be eliminated by a modification of policies, practices, or procedures, or by the provision of auxiliary aids or services. (c) In determining whether an... individualized assessment, based on reasonable judgment that relies on current medical knowledge or on the best...

  3. 8 CFR 208.1 - General.

    Science.gov (United States)

    2010-01-01

    ... International Affairs shall ensure that asylum officers receive special training in international human rights... concerning the persecution of persons in other countries on account of race, religion, nationality... information on human rights conditions. [64 FR 8487, Feb. 19, 1999, as amended at 74 FR 55736, Oct. 28, 2009] ...

  4. 5 CFR 551.208 - Learned professionals.

    Science.gov (United States)

    2010-01-01

    ... chemistry. However, the learned professional exemption is not applicable to occupations that customarily may... engineers, and performs work using knowledge acquired through on-the-job and classroom training rather than... will not qualify as exempt professionals. (f) Engineering. Engineers generally meet the duties...

  5. Statistical analysis of the mesospheric inversion layers over two symmetrical tropical sites: Réunion (20.8° S, 55.5° E) and Mauna Loa (19.5° N, 155.6° W)

    Science.gov (United States)

    Bègue, Nelson; Mbatha, Nkanyiso; Bencherif, Hassan; Tato Loua, René; Sivakumar, Venkataraman; Leblanc, Thierry

    2017-11-01

    In this investigation a statistical analysis of the characteristics of mesospheric inversion layers (MILs) over tropical regions is presented. This study involves the analysis of 16 years of lidar observations recorded at Réunion (20.8° S, 55.5° E) and 21 years of lidar observations recorded at Mauna Loa (19.5° N, 155.6° W) together with SABER observations at these two locations. MILs appear in 10 and 9.3 % of the observed temperature profiles recorded by Rayleigh lidar at Réunion and Mauna Loa, respectively. The parameters defining MILs show a semi-annual cycle over the two selected sites with maxima occurring near the equinoxes and minima occurring during the solstices. Over both sites, the maximum mean amplitude is observed in April and October, and this corresponds to a value greater than 35 K. According to lidar observations, the maximum and minimum mean of the base height ranged from 79 to 80.5 km and from 76 to 77.5 km, respectively. The MILs at Réunion appear on average ˜ 1 km thinner and ˜ 1 km lower, with an amplitude of ˜ 2 K higher than Mauna Loa. Generally, the statistical results for these two tropical locations as presented in this investigation are in fairly good agreement with previous studies. When compared to lidar measurements, on average SABER observations show MILs with greater amplitude, thickness and base altitudes of 4 K, 0.75 and 1.1 km, respectively. Taking into account the temperature error by SABER in the mesosphere, it can therefore be concluded that the measurements obtained from lidar and SABER observations are in significant agreement. The frequency spectrum analysis based on the lidar profiles and the 60-day averaged profile from SABER confirms the presence of the semi-annual oscillation where the magnitude maximum is found to coincide with the height range of the temperature inversion zone. This connection between increases in the semi-annual component close to the inversion zone is in agreement with most previously

  6. Contribution to construction and setup of a detection system for the focal plan of the BBS spectrometer. Application to study of the neutron emission decay of the resonant states populated by the reaction (4He,3He) at 42 MeV/u in nuclei 208Pb and 209Pb

    International Nuclear Information System (INIS)

    Plankl-Chabib, Elke

    1999-01-01

    In order to realize an experimental program dedicated to nuclear structure studies we have conceived and constructed at IPN Orsay a detection system for the focal plane of the magnetic spectrometer BBS, installed at the cryogenic cyclotron AGOR of the laboratory KVI (The Netherlands). Two detection units, consisting each of two localization plans of the Cathode Strip Chamber (CSC) type, measure the position and angle of particle trajectory. This information is used for the determination of the reaction parameters at the target by a backtracking procedure. The identification of the reaction products is done by the measurement of their time-of-flight and energy loss. For light ions this task is assumed by plastic scintillators, and for heavy ions by a parallel plan detector (PPAC) and an ionization chamber. This detection system is well adapted to the requirements given by the detection of a large range of ions (protons to 36 Ar at energies of several tenths of MeV/nucleon) as well as the big acceptance, the small dispersion and the aberration of the BBS. The results of the test show the good performances of the detection system. In a first experiment the focal plane detection system was coupled to the neutron multidetector EVEN in order to study the decay of resonant high spin states at high excitation energies by the ( 4 He, 3 He) reaction on 207 Pb and 208 Pb targets. The transfer spectra, inclusive and in coincidence, of the nuclei 208 Pb and 209 Pb show a striking resemblance except for an excitation energy shift which is due to the hole in the last neutron shell of 207 Pb. The resonances at l 8 and l = 9 are clearly populated, in agreement with the predictions of the Bonaccorso-Brink model. A sizeable fraction of the decay of the l = 8 resonance is direct, but at excitation energies higher than 15 MeV (in 208 Pb) the decay is mostly statistical. (author)

  7. 49 CFR 571.208 - Standard No. 208; Occupant crash protection.

    Science.gov (United States)

    2010-10-01

    ... September 1, 1996. S4.1.5.1Frontal/angular automatic protection system. (a) Each passenger car manufactured... active and passive restraint systems. S3. Application. (a) This standard applies to passenger cars... cars. S4.1.1Passenger cars manufactured from January 1, 1972, to August 31, 1973. Each passenger car...

  8. Measurement of Ay(θ) for n+208Pb from 6 to 10 MeV and the neutron-nucleus interaction over the energy range from bound states at -17 MeV up to scattering at 40 MeV

    International Nuclear Information System (INIS)

    Roberts, M.L.; Felsher, P.D.; Weisel, G.J.; Chen, Z.; Howell, C.R.; Tornow, W.; Walter, R.L.; Horen, D.J.

    1991-01-01

    High-accuracy measurements of A y (θ) data for elastic scattering and inelastic scattering to the first excited state for n+ 208 Pb have been performed at 6, 7, 8, 9, and 10 MeV. In addition, σ(θ) was measured at 8 MeV. These data provide an important subset for the growing database for the n+ 208 Pb system from bound-state energies to energies above 40 MeV, the limit of the range of interest here. This database has been interpreted via several approaches. First, a conventional Woods-Saxon spherical optical was used to obtain three potential representations for the energy range from 4 to 40 MeV: ''best fits'' at each energy, constant-geometry global fit with linear energy dependences for the potential strengths for the range 4.0--40 MeV, and an extension of the latter model to allow a linear energy dependence on the radii and diffuseness. A preference for a complex spin-orbit interaction was observed in all cases. Second, the dispersion relation was introduced into the spherical optical model to obtain a more ''realistic'' representation. In our approach, the strength and shape of the real potential was modified by calculating the dispersion-relation contributions that originate from the presence of the surface and volume imaginary terms. Two potentials were developed, one based only on the scattering data (from 4.0 to 40 MeV) and another based additionally on single-particle and single-hole information down to a binding energy of 17 MeV. In addition, the σ(θ) and A y (θ) measurements were compared to earlier conventional and dispersion-relation models. One of the latter of these included an l dependence in the absorptive surface term, and we applied this model in the 6- to 10-MeV region to describe all the σ(θ) and the new A y (θ)

  9. Mild hydrothermal synthesis, crystal structure, spectroscopic and magnetic properties of the [MxIIM2.5-xIII(H2O)2(HPIIIO3)y(PVO4)2-yF] [M=Fe, x=2.08, y=1.58; M=Co, Ni, x=2.5, y=2] compounds

    International Nuclear Information System (INIS)

    Orive, Joseba; Mesa, Jose L.; Legarra, Estibaliz; Plazaola, Fernando; Arriortua, Maria I.; Rojo, Teofilo

    2009-01-01

    The [M x II M 2.5-x III (H 2 O) 2 (HP III O 3 ) y (P V O 4 ) 2-y F] [M=Fe (1), x=2.08, y=1.58; M=Co (2), x=2.5, y=2; Ni (3), x=2.5, y=2] compounds have been synthesized using mild hydrothermal conditions at 170 deg. C during five days. Single-crystals of (1) and (2), and polycrystalline sample of (3) were obtained. These isostructural compounds crystallize in the orthorhombic system, space group Aba2, with a=9.9598(2), b=18.8149(4) and c=8.5751(2) A for (1), a=9.9142(7), b=18.570(1) and c=8.4920(5) A for (2) and a=9.8038(2), b=18.2453(2) and c=8.4106(1) A for (3), with Z=8 in the three phases. An X-ray diffraction study reveals that the crystal structure is composed of a three-dimensional skeleton formed by [MO 5 F] and [MO 4 F 2 ] (M=Fe, Co and Ni) octahedra and [HPO 3 ] tetrahedra, partially substituted by [PO 4 ] tetrahedra in phase (1). The IR spectra show the vibrational modes of the water molecules and those of the (HPO 3 ) 2- tetrahedral oxoanions. The thermal study indicates that the limit of thermal stability of these phases is 195 deg. C for (1) and 315 deg. C for (2) and (3). The electronic absorption spectroscopy shows the characteristic bands of the Fe(II), Co(II) and Ni(II) high-spin cations in slightly distorted octahedral geometry. Magnetic measurements indicate the existence of global antiferromagnetic interactions between the metallic centers with a ferromagnetic transition in the three compounds at 28, 14 and 21 K for (1), (2) and (3), respectively. Compound (1) exhibits a hysteresis loop with remnant magnetization and coercive field values of 0.72 emu/mol and 880 Oe, respectively. - Abstract: Polyhedral view of the crystal structure of the [M x II M 2.5-x III (H 2 O) 2 (HP III O 3 ) y (P IV O 4 ) 2-y F] [M=Fe, x=2.08, y=1.58; M=Co, Ni, x=2.5, y=2] compounds showing the sheets along the [001] direction.

  10. Contribution to construction and setup of a detection system for the focal plan of the BBS spectrometer. Application to study of the neutron emission decay of the resonant states populated by the reaction ({sup 4}He,{sup 3}He) at 42 MeV/u in nuclei {sup 208}Pb and {sup 209}Pb; Contribution a la construction et a la mise au point d'un systeme de detection pour le plan focal du spectrometre BBS. Application a l'etude de la decroissance par emission de neutrons d'etats resonants peuples par la reaction ({sup 4}He,{sup 3}He) a 42 MeV/u dans les noyaux {sup 208}Pb et {sup 209}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Plankl-Chabib, Elke [Inst. de Physique Nucleaire, Paris-11 Univ., 91 - Orsay (France)

    1999-06-11

    In order to realizean experimental program dedicated to nuclear structure studies we have conceived and constructed at IPN Orsay a detection system for the focal plane of the magnetic spectrometer BBS, installed at the cryogenic cyclotron AGOR of the laboratory KVI (The Netherlands). Two detection units, consisting each of two localization plans of the Cathode Strip Chamber (CSC) type, measure the position and angle of particle trajectory. This information is used for the determination of the reaction parameters at the target by a backtracking procedure. The identification of the reaction products is done by the measurement of their time-of-flight and energy loss. For light ions this task is assumed by plastic scintillators, and for heavy ions by a parallel plan detector (PPAC) and an ionization chamber. This detection system is well adapted to the requirements given by the detection of a large range of ions (protons to {sup 36}Ar at energies of several tenths of MeV/nucleon) as well as the big acceptance, the small dispersion and the aberration of the BBS. The results of the test show the good performances of the detection system. In a first experiment the focal plane detection system was coupled to the neutron multidetector EVEN in order to study the decay of resonant high spin states at high excitation energies by the ({sup 4}He, {sup 3}He) reaction on {sup 207}Pb and {sup 208}Pb targets. The transfer spectra, inclusive and in coincidence, of the nuclei {sup 208}Pb and {sup 209}Pb show a striking resemblance except for an excitation energy shift which is due to the hole in the last neutron shell of {sup 207}Pb. The resonances at l 8 and l = 9 are clearly populated, in agreement with the predictions of the Bonaccorso-Brink model. A sizeable fraction of the decay of the l = 8 resonance is direct, but at excitation energies higher than 15 MeV (in {sup 208}Pb) the decay is mostly statistical.

  11. Production cross-sections of pions and kaons in proton-nucleus collisions around 1 GeV - Measurement of the production cross-sections of light charged particles in collisions between 62.9 GeV protons and "2"0"8Pb nuclei

    International Nuclear Information System (INIS)

    Guertin, A.

    2001-01-01

    A charged kaon includes a strange anti-quark that cannot be re-absorbed by matter which make kaons an interesting probe of nuclear matter. The first part of this work is dedicated to the production cross-sections of pions and kaons in proton-nucleus collision around 1 GeV. The molecular quantum dynamic model used for simulating proton-nucleus is presented and the total cross-sections of the reactions implemented in the model are described. Then, the impact of the neutron's spectral function on pion and kaon production is assessed in double differential cross-sections. The consequences of the correlations observed between nucleons are discussed. The simple phenomenological approach we have developed to take into account 2 nucleon correlations gives good results for the doubly differential production cross-section of pions and kaons whatever the target nucleus. The second part of this work is dedicated to the measurement of the production of light charged particles (p, d, t, "3He, α) and neutron production in collisions between 62,9 MeV protons with "2"0"8Pb nuclei. The experimental setting is installed on the S2 line of the CYCLONE cyclotron (Belgium), the detection system is composed of 7 triple telescopes (Si, Si and CsI(Tl)). The separation and identification of particles is made through 2 methods: the E-ΔE method based on the energy losses in the different detectors and the discrimination method based on the different shapes of the quick and slow signals of the CsI crystal. The extraction of the cross-section values is detailed. We have compared the values obtained with 3 theoretical models: the exciton model (GNASH code), the F.K.K. (Feshbach-Kerman-Koonin) theory (MINGUS code) and a more phenomenological model able to simulate hadron reactions on nuclei for a very broad range of energy (FLUKA code)

  12. 12 CFR 208.21 - Investments in premises and securities.

    Science.gov (United States)

    2010-01-01

    ... shall invest in bank premises, or in the stock, bonds, debentures, or other such obligations of any... perpetual preferred stock and related surplus plus common stock plus surplus, as those terms are defined in... stock and related surplus plus common stock plus surplus, as those terms are defined in the FFIEC...

  13. 12 CFR 208.44 - Capital restoration plans.

    Science.gov (United States)

    2010-01-01

    ... capital restoration plan shall not limit the liability of the company under any guarantee required or... condition or practice. No plan shall be accepted unless it includes any performance guarantee described in... Corporation. (i) Performance guarantee by companies that control a bank—(1) Limitation on Liability. (i...

  14. 24 CFR 3280.208 - Smoke alarm requirements.

    Science.gov (United States)

    2010-04-01

    ... basement and must install at the factory an electrical junction box for the installation of this smoke... when a home is equipped or designed for future installation of a roof-mounted evaporative cooler or... system must be mounted on an electrical outlet box and connected by a permanent wiring method to a...

  15. 12 CFR 208.62 - Suspicious activity reports.

    Science.gov (United States)

    2010-01-01

    ... transaction related to a money laundering activity or a violation of the Bank Secrecy Act. This section... or more that involve potential money laundering or violations of the Bank Secrecy Act. Any...

  16. All projects related to | Page 208 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Failed and fragile states are attracting global attention; however, they sit at one end of a spectrum of states struggling to instill order and authority. Topic: SOCIAL PROBLEMS, URBAN AREAS, LOW INCOME GROUPS, COMMUNITY DEVELOPMENT, RESEARCH NETWORKS, CRIME PREVENTION, POLICY MAKING.

  17. RCT: Module 2.08, Radiological Source Control, Course 8774

    Energy Technology Data Exchange (ETDEWEB)

    Hillmer, Kurt T. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-08-10

    radioactive source is material used for its emitted radiation. Sources are sealed or unsealed and are classified as accountable or exempt. Radioactive sources are used for response checks, functional checks, and the calibration of instruments and monitors to traceable standards. To ensure the safety and welfare of all personnel, it is important to maintain control of radioactive sources to minimize the potential for the spread of contamination, unnecessary exposure to personnel, loss or theft, and improper disposal. This course will prepare the student with the skills necessary for RCT qualification by passing quizzes, tests, and the RCT Comprehensive Phase 1, Unit 2 Examination (TEST 27566) and will provide in-the-field skills.

  18. 40 CFR 240.208-3 - Recommended procedures: Operations.

    Science.gov (United States)

    2010-07-01

    ... the quality of the bottom ash at least twice per shift and record in the operating log the estimated percentage of unburned combustibles. (b) If residue or fly ash is collected in a wet condition, it should be drained of free moisture. Transportation of residue and fly ash should be by means that prevent the loads...

  19. 44 CFR 208.12 - Maximum Pay Rate Table.

    Science.gov (United States)

    2010-10-01

    ...) Physicians. DHS uses the latest Special Salary Rate Table Number 0290 for Medical Officers (Clinical... Personnel, in which case the Maximum Pay Rate Table would not apply. (3) Compensation for Sponsoring Agency... organizations, e.g., HMOs or medical or engineering professional associations, under the revised definition of...

  20. 12 CFR 208.84 - What you must disclose.

    Science.gov (United States)

    2010-01-01

    ... screens, billboards, signs, posters and written advertisements and promotional materials, as appropriate...) Disclosures must be meaningful. (i) You must provide the disclosures required by paragraphs (a) and (b) of this section in a meaningful form. Examples of the types of methods that could call attention to the...

  1. 30 CFR 20.8 - Class 1 lamps.

    Science.gov (United States)

    2010-07-01

    ... parts including conductors, are adequately covered and protected by the sealed or locked compartments... upon satisfactory performance in service. (2) Corrosion of battery container. The material of which the container is made shall resist corrosion under conditions of normal use. [Sched. 10C, May 17, 1938, as...

  2. 24 CFR 570.208 - Criteria for national objectives.

    Science.gov (United States)

    2010-04-01

    ...- and moderate-income persons to be considered is the creation or retention of jobs, except as provided... or 92.254 are met. (4) Job creation or retention activities. An activity designed to create or retain... activity designed to provide job training and placement and/or other employment support services, including...

  3. Dicty_cDB: VSC208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence update 2000. 9.22 Translated Amino Acid sequence VGRTMVVHADQDDLGKGGKPDSLTTGAAGARLGCGVIGVSQ*isn*nktllnike...fklk*npvkykrstpfl ll Frame B: VGRTMVVHADQDDLGKGGKPDSLTTGAAGARLGCGVIGVSQ*isn*nktllnike

  4. 12 CFR 208.23 - Agricultural loan loss amortization.

    Science.gov (United States)

    2010-01-01

    ... loss resulted from fraud or criminal abuse on the part of the bank, the officers, directors, or... than December 31, 1998. (c) Accounting for amortization. Any bank that is permitted to amortize losses... modifications to the plan; (2) Maintain accounting records for each asset subject to loss deferral under the...

  5. 19 CFR 351.208 - Suspension of investigation.

    Science.gov (United States)

    2010-04-01

    ... foreign government agree to modify their behavior so as to eliminate dumping or subsidization or the... merchandise or a representative consumer organization, as described in section 777(h) of the Act, and United...

  6. 48 CFR 208.7400 - Scope of subpart.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE ACQUISITION PLANNING REQUIRED SOURCES OF SUPPLIES AND SERVICES Enterprise Software... commercial software and software maintenance, including software and software maintenance that is acquired— (a) As part of a system or system upgrade, where practicable; (b) Under a service contract; (c) Under...

  7. Electromagnetic Dissociation of Target Nuclei by $^{208}$Pb Projectiles

    CERN Multimedia

    Petridis, A; Wohn, F K

    2002-01-01

    % NA53 \\\\ \\\\ The purpose of this experiment is to study the process of electromagnetic dissociation (ED) that occurs at impact parameters large enough so that there is no nuclear interaction. In these cases strong electromagnetic fields are produced for a short time at the nucleus. For large charges and ultrarelativistic energies, the intense electromagnetic pulse produces cross-sections much larger than the total hadronic cross-section. These effects place significant constraints on the storage times of the heavy ion beams planned for RHIC and LHC.\\\\ \\\\In this experiment we measure the cross-sections for the one- and two-neutron removal processes resulting from the interaction of 160 and 40~GeV/nucleon Pb beams on Au and Co targets. Thin Au targets were bombarded in the beam line of the NA50 experiment. Gamma rays from the residual nuclides produced in the bombardment were measured to determine the saturation activities of $^{196}$Au and $^{195}$Au resulting from ED of the Au target. This along with cross-se...

  8. 208 External Degree Programme Graduates' Perception of Students ...

    African Journals Online (AJOL)

    Nekky Umera

    1988-03-02

    Mar 2, 1988 ... face tutorials, provision of study materials to the learners, guidance and ... mathematics or combinations in which one of the subjects was mathematics ... Science, Commerce and Architecture (Young, 1976). ... accommodation and teaching space (University of Nairobi Students' ..... English/Literature. 7. 5.

  9. Publications | Page 208 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  10. 40 CFR 20.8 - Requirements for certification.

    Science.gov (United States)

    2010-07-01

    ... directed; (3) Local government requirements for control of air pollution, including emission standards; (4... the useful life, or (C) reduce the total operating costs of the operating unit (of the plant or other property) most directly associated with the pollution control facility; and (iii) Does not significantly...

  11. 12 CFR 208.61 - Bank security procedures.

    Science.gov (United States)

    2010-01-01

    ... procedures for opening and closing for business and for the safekeeping of all currency, negotiable...; the cost of the security devices; other security measures in effect at the banking office; and the... directors on the implementation, administration, and effectiveness of the security program. (e) Reserve...

  12. 40 CFR 59.208 - Charcoal lighter material testing protocol.

    Science.gov (United States)

    2010-07-01

    ... briquette over 0.9 kilograms (2 pounds), of uniform shape with no broken pieces using an analytical balance... flame. (5) Conduct at least six test runs for both the electric probe ignition and for the lighter...

  13. 8 CFR 208.4 - Filing the application.

    Science.gov (United States)

    2010-01-01

    ... Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS PROCEDURES FOR ASYLUM AND... interview, or an immigration judge, in a hearing, shall review the application and give the applicant the opportunity to present any relevant and useful information bearing on any prohibitions on filing to determine...

  14. Energy spectrum of 208Pb(n,x) reactions

    Science.gov (United States)

    Tel, E.; Kavun, Y.; Özdoǧan, H.; Kaplan, A.

    2018-02-01

    Fission and fusion reactor technologies have been investigated since 1950's on the world. For reactor technology, fission and fusion reaction investigations are play important role for improve new generation technologies. Especially, neutron reaction studies have an important place in the development of nuclear materials. So neutron effects on materials should study as theoretically and experimentally for improve reactor design. For this reason, Nuclear reaction codes are very useful tools when experimental data are unavailable. For such circumstances scientists created many nuclear reaction codes such as ALICE/ASH, CEM95, PCROSS, TALYS, GEANT, FLUKA. In this study we used ALICE/ASH, PCROSS and CEM95 codes for energy spectrum calculation of outgoing particles from Pb bombardment by neutron. While Weisskopf-Ewing model has been used for the equilibrium process in the calculations, full exciton, hybrid and geometry dependent hybrid nuclear reaction models have been used for the pre-equilibrium process. The calculated results have been discussed and compared with the experimental data taken from EXFOR.

  15. Statistical analysis of the mesospheric inversion layers over two symmetrical tropical sites: Réunion (20.8° S, 55.5° E and Mauna Loa (19.5° N, 155.6° W

    Directory of Open Access Journals (Sweden)

    N. Bègue

    2017-11-01

    Full Text Available In this investigation a statistical analysis of the characteristics of mesospheric inversion layers (MILs over tropical regions is presented. This study involves the analysis of 16 years of lidar observations recorded at Réunion (20.8° S, 55.5° E and 21 years of lidar observations recorded at Mauna Loa (19.5° N, 155.6° W together with SABER observations at these two locations. MILs appear in 10 and 9.3 % of the observed temperature profiles recorded by Rayleigh lidar at Réunion and Mauna Loa, respectively. The parameters defining MILs show a semi-annual cycle over the two selected sites with maxima occurring near the equinoxes and minima occurring during the solstices. Over both sites, the maximum mean amplitude is observed in April and October, and this corresponds to a value greater than 35 K. According to lidar observations, the maximum and minimum mean of the base height ranged from 79 to 80.5 km and from 76 to 77.5 km, respectively. The MILs at Réunion appear on average ∼ 1 km thinner and ∼ 1 km lower, with an amplitude of ∼ 2 K higher than Mauna Loa. Generally, the statistical results for these two tropical locations as presented in this investigation are in fairly good agreement with previous studies. When compared to lidar measurements, on average SABER observations show MILs with greater amplitude, thickness and base altitudes of 4 K, 0.75 and 1.1 km, respectively. Taking into account the temperature error by SABER in the mesosphere, it can therefore be concluded that the measurements obtained from lidar and SABER observations are in significant agreement. The frequency spectrum analysis based on the lidar profiles and the 60-day averaged profile from SABER confirms the presence of the semi-annual oscillation where the magnitude maximum is found to coincide with the height range of the temperature inversion zone. This connection between increases in the semi-annual component close to the

  16. 49 CFR Subpart D - Appendix A-1 of FMVSS No. 208 Phase-in Reporting Requirements

    Science.gov (United States)

    2010-10-01

    ... manufacturers of passenger cars, and of trucks, buses and multipurpose passenger vehicles with a gross vehicle... passenger cars, and of trucks, buses and multipurpose passenger vehicles with a GVWR of 3,856 kg (8,500 lb... meaning. (b) Bus, gross vehicle weight rating or GVWR, multipurpose passenger vehicle, passenger car, and...

  17. Investigation of excited states and isomer decay in doubly odd 208Fr

    International Nuclear Information System (INIS)

    Kanjilal, D.; Bhattacharya, S.; Goswami, A.; Kshetri, R.; Raut, R.; Saha, S.; Bhowmik, R.K.; Gehlot, J.; Jnaneswari, G.; Muralithar, S.; Singh, R.P.; Mukherjee, B.; Mukherjee, G.

    2008-01-01

    A systematic study of the 212 Fr nuclei will reveal many other interesting features like the interplay of the single particle and the collective degrees of freedom in generating high angular momenta, collectively, if any, in these nuclei at higher spins, and possibly many more

  18. 37 CFR 41.208 - Content of substantive and responsive motions.

    Science.gov (United States)

    2010-07-01

    ...) Raise a threshold issue, (2) Seek to change the scope of the definition of the interfering subject... to practice in patent cases 11.6, 11.9 B Breach of trust 10.23 Business transactions or relations....10 I Illegal conduct involving moral turpitude 10.23 Illegal fees for services 10.36 Improper...

  19. 8 CFR 208.24 - Termination of asylum or withholding of removal or deportation.

    Science.gov (United States)

    2010-01-01

    ... relating to the original claim, the alien's life or freedom no longer would be threatened on account of race, religion, nationality, membership in a particular social group, or political opinion in the...

  20. Effect on Tensor Correlations on Gamow- Teller States in 90Zr and 208Pb

    International Nuclear Information System (INIS)

    Bai, C. L.; Sagawa, H.; Zhang, H. Q.

    2009-01-01

    The tensor terms of the Skyrme effective interaction are included in the self-consistent Hartree-Fock plus Random Phase Approximation (HF-RPA) model. The Gamow-Teller (GT) strength function of 9 0Z r and 2 08P b are calculated with and without the tensor terms. The main peaks are moved downwards by about 2 MeV when including the tensor contribution. About 10% of the non-energy weighted sum rule is shifted to the excitation energy region above 30 MeV by the RPA tensor correlations. The contribution of the tensor terms to the energy weighted sum rule is given analytically, and compared to the outcome of RPA. A microscopic origin of the quenching of GT sum rule is discussed in relation with the coupling to giant spin-quadrupole excitations by the tensor interactions.(author)

  1. Dipole response in Pb-208 within a self-consistent multiphonon approach

    Czech Academy of Sciences Publication Activity Database

    Knapp, F.; Lo Iudice, N.; Veselý, Petr; Andreozzi, F.; De Gregorio, G.; Porrino, A.

    2015-01-01

    Roč. 92, č. 5 (2015), s. 054315 ISSN 0556-2813 R&D Projects: GA ČR GA13-07117S Grant - others:GA MŠk(CZ) LM2010005 Institutional support: RVO:61389005 Keywords : photoneutron * cross-section * neutron scattering Subject RIV: BE - Theoretical Physics Impact factor: 3.146, year: 2015

  2. The Efficacy of Cardiac Anti-miR-208a Therapy Is Stress Dependent

    NARCIS (Netherlands)

    Eding, Joep E C; Demkes, Charlotte J; Lynch, Joshua M; Seto, Anita G; Montgomery, Rusty L; Semus, Hillary M; Jackson, Aimee L; Isabelle, Marc; Chimenti, Stefano; van Rooij, Eva

    2017-01-01

    MicroRNAs (miRNAs) are important regulators of biology and disease. Recent animal efficacy studies validate the therapeutic benefit of miRNA modulation and underscore the therapeutic value of miRNA-targeting oligonucleotides. However, whether disease conditions (stress) influence the pharmacological

  3. Tank 241-AP-105, cores 208, 209 and 210, analytical results for the final report

    International Nuclear Information System (INIS)

    Nuzum, J.L.

    1997-01-01

    This document is the final laboratory report for Tank 241-AP-105. Push mode core segments were removed from Risers 24 and 28 between July 2, 1997, and July 14, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-AP-105 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997) and Tank Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT), differential scanning calorimetry (DSC) analysis, or total organic carbon (TOC) analysis exceeded the notification limits as stated in TSAP and DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report. Appearance and Sample Handling Two cores, each consisting of four segments, were expected from Tank 241-AP-105. Three cores were sampled, and complete cores were not obtained. TSAP states core samples should be transported to the laboratory within three calendar days from the time each segment is removed from the tank. This requirement was not met for all cores. Attachment 1 illustrates subsamples generated in the laboratory for analysis and identifies their sources. This reference also relates tank farm identification numbers to their corresponding 222-S Laboratory sample numbers

  4. 48 CFR 15.208 - Submission, modification, revision, and withdrawal of proposals.

    Science.gov (United States)

    2010-10-01

    ... solicitation. Offerors may use any transmission method authorized by the solicitation (i.e., regular mail, electronic commerce, or facsimile). If no time is specified in the solicitation, the time for receipt is 4:30... not unduly delay the acquisition; and— (i) If it was transmitted through an electronic commerce method...

  5. 33 CFR 208.10 - Local flood protection works; maintenance and operation of structures and facilities.

    Science.gov (United States)

    2010-07-01

    ... shall be brought to a satisfactory condition or shall be promptly replaced. Diesel and gasoline engines... machines, fuel for gasoline or diesel powered equipment, and flash lights or lanterns for emergency... the efficient operation and maintenance of all of the structures and facilities during flood periods...

  6. 12 CFR 208.41 - Definitions for purposes of this subpart.

    Science.gov (United States)

    2010-01-01

    ... (including related surplus), minus all intangible assets except mortgage servicing assets to the extent that... Condition and Income (Call Report), minus intangible assets as provided in the definition of tangible equity... total consolidated assets, as calculated in accordance with the Board's Capital Adequacy Guidelines for...

  7. 12 CFR Appendix C to Part 208 - Interagency Guidelines for Real Estate Lending Policies

    Science.gov (United States)

    2010-01-01

    ... institutions' business plans and, when undertaken in a prudent manner, will not be subject to examiner... policies and strategic plan. Factors that should be considered include: • The size and financial condition... institution's board of directors. (See additional reporting requirements described under “Exceptions to the...

  8. Strategic Forum Number 208: Turbulent Transition in Iraq: Can It Succeed?

    Science.gov (United States)

    2004-06-01

    ministers including a prime minister, and a judiciary. There is separation of powers —legislative, executive, and judicial. The assembly will elect the... separation of powers based on geographic and historical realities and not race, ethnicity, nationality, or religious sect (confession). Formulation of

  9. Turbulent Transition in Iraq: Can It Succeed? (Strategic Forum, Number 208, June 2004)

    Science.gov (United States)

    2004-06-01

    council, a council of ministers including a prime minister, and a judiciary. There is separation of powers —legislative, executive, and judicial. The...defined as a system of separation of powers based on geographic and historical realities and not race, ethnicity, nationality, or religious sect

  10. 12 CFR 208.22 - Community development and public welfare investments.

    Science.gov (United States)

    2010-01-01

    ... economic development; (D) Investing in, developing, or otherwise assisting job training or placement... entity located in a low- or moderate-income area if the entity creates long-term employment opportunities... company itself in satisfaction of a debt previously contracted. ...

  11. Effect of Tensor Correlations on Gamow-Teller States in 90Zr and 208Pb

    International Nuclear Information System (INIS)

    Bai, C. L.; Zhang, H. Q.; Zhang, X. Z.

    2009-01-01

    The tensor terms of the Skyrme effective interaction are included in the self-consistent Hartree-Fock plus Random Phase Approximation (HF-RPA) model. The Gamow-Teller (GT) strength functions of 9 0Z r and 2 08P b is calculated with and without the tensor terms. The main peaks are moved downwards by about 2 MeV when including the tensor contribution. About 10% of the non-energy weighted sum rule is shifted to the excitation energy region above 30 MeV by the RPA tensor correlations. The contribution of the tensor terms to the energy weighted sum rule is given analytically, and compared to the outcome of RPA. A microscopic origin of the quenching of GT sum rule due to the tensor force is discussed.(author)

  12. 41 CFR 101-39.208 - Vehicles removed from defined areas.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management System Services... operated outside the geographical area served by the issuing GSA IFMS fleet management center. However... shall notify the issuing GSA IFMS fleet management center of the following: (1) The location at which...

  13. 18 CFR 1304.208 - Shoreline stabilization on TVA-owned residential access shoreland.

    Science.gov (United States)

    2010-04-01

    ... of gabions and riprap to stabilize eroded shorelines. (1) The riprap material must be quarry-run stone, natural stone, or other material approved by TVA. (2) Rubber tires, concrete rubble, or other... concrete, gabions, or other materials acceptable to TVA. Railroad ties, rubber tires, broken concrete...

  14. 7 CFR 1430.208 - Payment rate and dairy operation payment.

    Science.gov (United States)

    2010-01-01

    ... the months that the Boston Class I milk price under the applicable milk marketing order is equal to or... the feed components of the estimated price of 16 percent Mixed Dairy Feed per pound noted on page 33... be made to dairy operations when the Boston Class I milk price under the applicable Federal milk...

  15. The epigenetic modifier Fam208a is required to maintain epiblast cell fitness

    Czech Academy of Sciences Publication Activity Database

    Bhargava, Shohag; Cox, B.; Polydorou, Ch.; Grešáková, Veronika; Kořínek, Vladimír; Strnad, Hynek; Sedláček, Radislav; Epp, Trevor Allan; Chawengsaksophak, Kallayanee

    2017-01-01

    Roč. 7, léto (2017), č. článku 9322. ISSN 2045-2322 R&D Projects: GA ČR GA15-23165S; GA MŠk LO1419; GA MŠk(CZ) ED1.1.00/02.0109; GA MŠk ED2.1.00/19.0395; GA MŠk(CZ) LM2011032; GA MŠk(CZ) LM2015040; GA MŠk(CZ) LQ1604 Institutional support: RVO:68378050 Keywords : bone morphogenetic protein -4 * position-effect variegation * gastrulating mouse embryo * anterior-posterior axis * mesoderm differentiation * expression pattern * mice lacking * postimplantation development * definitive endoderm * primitive streak Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016

  16. 42 CFR 412.208 - Puerto Rico rates for Federal fiscal year 1988.

    Science.gov (United States)

    2010-10-01

    ... by— (1) Adjusting for variations in case mix among hospitals; (2) Excluding an estimate of indirect... rates for Federal fiscal year 1988. (a) General rule. CMS determines the Puerto Rico adjusted DRG...) Geographic classification. (1) For purposes of this paragraph (e) of this section, the following definitions...

  17. 31 CFR Appendix B to Part 208 - Model Disclosure for Use After ETA SM Becomes Available

    Science.gov (United States)

    2010-07-01

    ..., low-cost accounts in addition to full-service checking or savings accounts. (2) Receive your payment through a basic, low-cost account called an ETA SM. If you receive a Federal benefit, wage, salary, or retirement payment, you are eligible to open an ETA SM. This account is available for a low monthly fee at...

  18. 48 CFR 1852.208-81 - Restrictions on Printing and Duplicating.

    Science.gov (United States)

    2010-10-01

    ..., presswork, duplicating, silk screen processes, binding, microform, and the end items of such processes and... one sheet, size 8-1/2×11 inches (215×280 mm), one side only, and one color ink. (d) This clause does...

  19. People and things. CERN Courier, November 1980, v. 20(8)

    International Nuclear Information System (INIS)

    Anon.

    1980-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. Each year the high energy physics programme in the USA is reviewed by a subpanel of the HEPAP (High Energy Physics Advisory Panel) meeting at Woods Hole. Among the speakers at the dedication ceremony for the new PEP electron-positron collider at SLAC on 5 September was Frank Press, President Carter's advisor on science and technology; Discovering exotic nuclear behaviour is something of a speciality at ISOLDE, the CERN on-line isotope separator. From 24-26 September, Argonne National Laboratory sponsored a Conference on the subject of ternary superconductors. Two improved portable radiation monitors have been developed at the Los Alamos Scientific Laboratory and are now being manufactured by outside industry

  20. 12 CFR Appendix D-2 to Part 208 - Interagency Guidelines Establishing Information Security Standards

    Science.gov (United States)

    2010-01-01

    ... Relationships Risk Management Principles,” Nov. 1, 2001; FDIC FIL 68-99, Risk Assessment Tools and Practices for.... Definitions II. Standards for Safeguarding Customer Information A. Information Security Program B. Objectives III. Development and Implementation of Customer Information Security Program A. Involve the Board of...

  1. 48 CFR 1352.208-70 - Restrictions on printing and duplicating.

    Science.gov (United States)

    2010-10-01

    ... COMMERCE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352... copying in excess of the limits in paragraph (a) of this clause are unallowable without prior written..., duplicating, and copying in excess of the limits specified in paragraph (a) of this clause, a provision...

  2. 12 CFR Appendix D-1 to Part 208 - Interagency Guidelines Establishing Standards for Safety and Soundness

    Science.gov (United States)

    2010-01-01

    ... systems. B. Internal audit system. C. Loan documentation. D. Credit underwriting. E. Interest rate..., information systems and internal audit systems, in accordance with section 36 of the FDI Act (12 U.S.C. 1831m... with applicable laws and regulations. B. Internal audit system. An institution should have an internal...

  3. SU-E-T-208: Incidence Cancer Risk From the Radiation Treatment for Acoustic Neuroma Patient

    Energy Technology Data Exchange (ETDEWEB)

    Kim, D [Kyung Hee University International Med. Serv., Seoul (Korea, Republic of); Chung, W [Kyung Hee University Hospital at Gangdong, Seoul, Seoul (Korea, Republic of); Shin, D [Kyung Hee University Hospital, Seoul, Seoul (Korea, Republic of); Yoon, M [Korea University, Seoul (Korea, Republic of)

    2014-06-01

    Purpose: The present study aimed to compare the incidence risk of a secondary cancer from therapeutic doses in patients receiving intensitymodulated radiotherapy (IMRT), volumetric modulated arc therapy (VMAT), and stereotactic radiosurgery (SRS). Methods: Four acoustic neuroma patients were treated with IMRT, VMAT, or SRS. Their incidnece excess relative risk (ERR), excess absolute risk (EAR), and lifetime attributable risk (LAR) were estimated using the corresponding therapeutic doses measured at various organs by radio-photoluminescence glass dosimeters (RPLGD) placed inside a humanoid phantom. Results: When a prescription dose was delivered in the planning target volume of the 4 patients, the average organ equivalent doses (OED) at the thyroid, lung, normal liver, colon, bladder, prostate (or ovary), and rectum were measured. The OED decreased as the distance from the primary beam increased. The thyroid received the highest OED compared to other organs. A LAR were estimated that more than 0.03% of AN patients would get radiation-induced cancer. Conclusion: The tyroid was highest radiation-induced cancer risk after radiation treatment for AN. We found that LAR can be increased by the transmitted dose from the primary beam. No modality-specific difference in radiation-induced cancer risk was observed in our study.

  4. 48 CFR 1815.208 - Submission, modification, revision, and withdrawal of proposals. (NASA supplements paragraph (b))

    Science.gov (United States)

    2010-10-01

    ... late proposal criteria do not apply to Announcements of Opportunity, NASA Research Announcements, and Small Business Innovative Research (SBIR) Phase I and Phase II solicitations, and Small Business... Acquisition Regulations System NATIONAL AERONAUTICS AND SPACE ADMINISTRATION CONTRACTING METHODS AND CONTRACT...

  5. 24 CFR 92.208 - Eligible community housing development organization (CHDO) operating expense and capacity...

    Science.gov (United States)

    2010-04-01

    ... development organization. Such costs include salaries, wages, and other employee compensation and benefits; employee education, training, and travel; rent; utilities; communication costs; taxes; insurance; equipment...

  6. 14 CFR 1207.102 - Waiver of prohibition in 18 U.S.C. 208.

    Science.gov (United States)

    2010-01-01

    ... Counsel; and (v) Procurement Officers. (2) For all other Headquarters employees, the Associate... Ethics. (e) Cross-references. For regulations concerning general waiver guidance and exemptions under 18...

  7. 22 CFR 208.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-04-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not covered...

  8. 29 CFR 779.208 - Auxiliary activities which are “related activities.”

    Science.gov (United States)

    2010-07-01

    ... eating and drinking facilities (note that employees primarily engaged in certain food service activities... Act if the specific conditions are met; see § 779.388); (j) The operation of employee benefit and...

  9. 42 CFR 422.208 - Physician incentive plans: requirements and limitations.

    Science.gov (United States)

    2010-10-01

    ... HEALTH AND HUMAN SERVICES (CONTINUED) MEDICARE PROGRAM MEDICARE ADVANTAGE PROGRAM Relationships With... beyond any salary, fee-for-service payments, capitation, or returned withhold. Capitation means a set... committee participation, are not considered payments in the determination of substantial financial risk...

  10. Tank 241-AP-105, cores 208, 209 and 210, analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Nuzum, J.L.

    1997-10-24

    This document is the final laboratory report for Tank 241-AP-105. Push mode core segments were removed from Risers 24 and 28 between July 2, 1997, and July 14, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-AP-105 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997) and Tank Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT), differential scanning calorimetry (DSC) analysis, or total organic carbon (TOC) analysis exceeded the notification limits as stated in TSAP and DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report. Appearance and Sample Handling Two cores, each consisting of four segments, were expected from Tank 241-AP-105. Three cores were sampled, and complete cores were not obtained. TSAP states core samples should be transported to the laboratory within three calendar days from the time each segment is removed from the tank. This requirement was not met for all cores. Attachment 1 illustrates subsamples generated in the laboratory for analysis and identifies their sources. This reference also relates tank farm identification numbers to their corresponding 222-S Laboratory sample numbers.

  11. Sexospécificités | Page 208 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Hunger can be eradicated “in my lifetime,” says the man known as the father of the Green Revolution in India. M.S. Swaminathan speaks about his values, his achievements, and his ambitions. According to Time magazine, Professor Monkombu Sambasivan Swaminathan ranks alongside Mahatma Gandhi, the Dalai Lama, ...

  12. Inelastic heavy ion scattering on 90Zr and 208Pb at intermediate energies

    International Nuclear Information System (INIS)

    Blumenfeld, Y.; Beaumel, D.; Chomaz, P.; Frascaria, N.; Garron, J.P.; Jacmart, J.C.; Roynette, J.C.; Scarpaci, J.A.; Suomijarvi, T.

    1988-01-01

    Heavy ion inelastic scattering has been investigated using the SPEG spectrometer at GANIL. It is shown that the use of such a high resolution spectrometer allows a quantitative study of the giant resonances excited in heavy ion collisions. The contribution of the pick-up break-up mechanism to the high excitation energy region (E > 30 MeV) is then discussed. Recent results obtained with 40 Ar beams at two different incident energies show that target excitations are also present in this energy region

  13. 44 CFR 208.2 - Definitions of terms used in this part.

    Science.gov (United States)

    2010-10-01

    ... defined term unless such capitalization results from the application of standard capitalization or style... performance of the contemplated activity. Daily Cost Estimate means a Sponsoring Agency's estimate of Task... and Rescue (US&R), and other specialists combined to provide operations, planning, logistics, finance...

  14. Investigation on the parity violation in the 207Pb(npol, γ)208Pb reaction

    International Nuclear Information System (INIS)

    Abov, Yu.G.; Ermakov, O.N.; Karpikhin, I.L.

    1987-01-01

    The results of the investigation of P-odd asymmetry in the emission of γ-rays after absorption of transverse-polarized neutrons by nuclei 207 Pb are given. The measurements were carried out on polarized thermal neutron beam of the ITEP reactor. The obtained upper limit of the P-odd asymmetry coefficient is 1.7x10 -5 at the 90% confidence level. This result may be crucial for one-particle (valent) mechanism of the mixing of compound resonance wave function componets having opposite parities

  15. 12 CFR 208.43 - Capital measures and capital category definitions.

    Science.gov (United States)

    2010-01-01

    ... RESERVE SYSTEM MEMBERSHIP OF STATE BANKING INSTITUTIONS IN THE FEDERAL RESERVE SYSTEM (REGULATION H... Lending Supervision Act of 1983 (12 U.S.C. 3907), or section 38 of the FDI Act, or any regulation... categories of asset quality, management, earnings, liquidity, or sensitivity to market risk. ...

  16. 12 CFR 208.25 - Loans in areas having special flood hazards.

    Science.gov (United States)

    2010-01-01

    ... borrower for the cost of premiums and fees incurred in purchasing the insurance. (h) Determination fees—(1...) Use of prescribed form of notice. A member bank will be considered to be in compliance with the... us for further information. ___ The community in which the property securing the loan is located...

  17. 24 CFR 1003.208 - Criteria for compliance with the primary objective.

    Science.gov (United States)

    2010-04-01

    ... considered is the creation or retention of jobs except as provided in paragraph (b)(4) of this section.) To... households. (d) Job creation or retention activities. An activity designed to create or retain permanent jobs.... (4) An activity designed to provide job training and placement and/or other employment support...

  18. Lun Afr J Tradit Complement Altern Med. (2014) 11(1):205-208

    African Journals Online (AJOL)

    cadewumi

    The objective of this paper was to study the antidepressant effect of Danzhi Xiaoyao ... Methods: Experimental animals were grouped and given different doses of .... Its main manifestations include emotional downturn, reduced verbal action, ...

  19. METAFUNCTION ANALYSIS OF DONAL DUCK‘S COMIC AND ITS 208 TRANSLATION

    Directory of Open Access Journals (Sweden)

    Gilang Fadhilia Arvianti

    2017-12-01

    Full Text Available Translating comic is different from other different text. Most of the text that is used in the comic is dialogue or spoken language that usually can be found in the subtitle of the film. Analyzing the accurateness of the translation text can be analyzed by using Metafunction approach. In translating text into target text, not all meaning is transferring into target text. It can influence the message that is brought by the source text into target text. Although explicitly the meaning is transferring to target language, in Metafunction approach it can be analyzed that not all the meaning is transferred into target text. This becomes the reason of taking this case as an object of this research. The aims of this research are to know the meaning realization in ideational analysis approach. The method of this research uses descriptive qualitative since the data and the analysis are in the form of sentence and description. The data will be taken from Donald Duck‘s Comic and its translation version. The techniques that will be used in this research is content analysis. This research also applies crieterion-based sampling that is used only to get theoretically generalization. Since this research is hoped to give significant contribution to student of English Teaching and Learning in learning metafunction analysis, the function of this research is to explain impact of Metafunction shifting toward the equivalence of translation in target text. Thus this research not only can be learning material for analyzing metafunction in specific text, but also in learning translation.

  20. 44 CFR 208.39 - Reimbursement for personnel costs incurred during Activation.

    Science.gov (United States)

    2010-10-01

    ...) Reimbursement of additional salary and overtime costs. DHS will reimburse any identified additional salary and...). (g) Reimbursement for Backfill costs upon Activation. DHS will reimburse the cost to Backfill System... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Reimbursement for personnel...