WorldWideScience

Sample records for acs news service

  1. 26 CFR 49.4253-2 - Exemption for news services.

    Science.gov (United States)

    2010-04-01

    ... collection of news for the public press or radio or television broadcasting or in the dissemination of news through the public press or by means of radio or television broadcasting; or (2) In the collection or..., press association, radio or television news broadcasting agency, or news ticker service, to any...

  2. Media Convergence and Digital News Services

    OpenAIRE

    Appelgren, Ester

    2007-01-01

    In this thesis, media convergence strategies and added value of digital news services are investigated, focusing on the newspaper industry and it’s audience. Convergence implies that previously unalike areas come together, approaching a common goal. A subordinate concept of convergence, i.e., media convergence, is a concept that has become common when denoting a range of processes within the production of media content, its distribution and consumption. Newspapers are one of many so-called pu...

  3. Summer Food Service Program. Nourishing News. Volume 3, Issue 8

    Science.gov (United States)

    Idaho State Department of Education, 2009

    2009-01-01

    The primary goal of the Summer Food Service Program (SFSP) is to provide nutritious meals to children in low-income areas when school is not in session. This issue of "Nourishing News" focuses on SFSPs. The articles contained in this issue are: (1) Is Your Summer Food Program Financially Fit? (Jean Zaske); (2) Keeping the "Bugs" Away: An Ounce of…

  4. 75 FR 28231 - Cotton Classification and Market News Service: Notice of Request for an Extension and Revision of...

    Science.gov (United States)

    2010-05-20

    ... Agricultural Marketing Service Cotton Classification and Market News Service: Notice of Request for an... the currently approved information collection Cotton Classification and Market News Service. DATES... submit written comments concerning this proposal to Shethir Riva, Chief, Research and Promotion,...

  5. Introducing high performance distributed logging service for ACS

    Science.gov (United States)

    Avarias, Jorge A.; López, Joao S.; Maureira, Cristián; Sommer, Heiko; Chiozzi, Gianluca

    2010-07-01

    The ALMA Common Software (ACS) is a software framework that provides the infrastructure for the Atacama Large Millimeter Array and other projects. ACS, based on CORBA, offers basic services and common design patterns for distributed software. Every properly built system needs to be able to log status and error information. Logging in a single computer scenario can be as easy as using fprintf statements. However, in a distributed system, it must provide a way to centralize all logging data in a single place without overloading the network nor complicating the applications. ACS provides a complete logging service infrastructure in which every log has an associated priority and timestamp, allowing filtering at different levels of the system (application, service and clients). Currently the ACS logging service uses an implementation of the CORBA Telecom Log Service in a customized way, using only a minimal subset of the features provided by the standard. The most relevant feature used by ACS is the ability to treat the logs as event data that gets distributed over the network in a publisher-subscriber paradigm. For this purpose the CORBA Notification Service, which is resource intensive, is used. On the other hand, the Data Distribution Service (DDS) provides an alternative standard for publisher-subscriber communication for real-time systems, offering better performance and featuring decentralized message processing. The current document describes how the new high performance logging service of ACS has been modeled and developed using DDS, replacing the Telecom Log Service. Benefits and drawbacks are analyzed. A benchmark is presented comparing the differences between the implementations.

  6. News from the Library: Scientific Information Service - service interruption

    CERN Multimedia

    2014-01-01

    Techniques de l'Ingénieur has been part of the selection of databases offered by the Scientific Information Service for the last five years.   Unfortunately, as a consequence of budget reductions, and after careful consideration of all available options, we have to end this subscription. It will be still possible to purchase access to individual chapters via the Library services.  Furthermore, we are considering ending our subscriptions to Web of Science and Springer Materials (the Landolt-Börnstein database) during the course of 2015. We thank you for your understanding and welcome your feedback to library.desk@cern.ch

  7. news

    Directory of Open Access Journals (Sweden)

    Marina Tkacheva

    2012-06-01

    Full Text Available UIA NewsA Thinking Head and a Nursing CowThe Regular General Meeting of the Members of the Self-Regulatory Organization IndependentPartnership “The Baikal Association of Architects and Engineers” of March 23“BukhArt”: the Beginning of the Second Five-Year PeriodThe VIIth Forum of Architects-Skiers from Siberia and UralThe Second Landscape Conference in Krasnoyarsk“Geo-Decor”, so Simple and Unexpected254 Years and the 20th AnniversaryThe Book “Irkutsk Architects” Arkhangelsk Museum of Wooden Architecture «Malye Korely»The Valletta Principles for the Safeguarding and Management of Historic Cities, Towns and Urban AreasCreative Project in VologdaThe Nomad 2. Circles and Spirals

  8. ENS NucNet: the rapid worldwide nuclear news service

    International Nuclear Information System (INIS)

    NucNet is now a global fax-based network which circulates nuclear news and information of public interest in a language that the public can easily understand. NucNet aims for a balanced picture of nuclear to reach the public via nuclear communicators and the media, through a rapid flow of accurate information. (author)

  9. NEWS

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    The consumer clothing prices rose 3.3% in January February 9,National Bureau of Statistics data show that in January,the national consumer price level rose by 4.5% year-on-year,consumer prices rose by 5.5%,prices of services rose by 2.2%; national consumer price level rose 1.5% month-on-month,consumer prices rose by 1.8%, prices of services rose by 0.8%. It is estimated that among the 4.5% year-on-year increase of comsumer prices of January, there are approximately 3.0% caused by the price

  10. 26 CFR 31.3121(b)(14)-1 - Services in delivery or distribution of newspapers, shopping news, or magazines.

    Science.gov (United States)

    2010-04-01

    ... newspapers, shopping news, or magazines. 31.3121(b)(14)-1 Section 31.3121(b)(14)-1 Internal Revenue INTERNAL... distribution of newspapers, shopping news, or magazines. (a) Services of individuals under age 18. Services... the time of, the sale of newspapers or magazines to ultimate consumers under an arrangement...

  11. 26 CFR 31.3306(c)(15)-1 - Services in delivery or distribution of newspapers, shopping news, or magazines.

    Science.gov (United States)

    2010-04-01

    ... newspapers, shopping news, or magazines. 31.3306(c)(15)-1 Section 31.3306(c)(15)-1 Internal Revenue INTERNAL..., shopping news, or magazines. (a) Services of individuals under age 18. Services performed by an employee... magazines to ultimate consumers under an arrangement under which the newspapers or magazines are to be...

  12. How Did the Meanings Constructed by Taiwanese Pre-Service Teachers from Educational News Media Affect Their Beliefs?

    Science.gov (United States)

    Liu, Shih-Hsiung; Tsao, Shih-Chieh

    2013-01-01

    The study investigates how Taiwanese pre-service teachers make meaning after reading positive or negative news coverage of educational events and how they construct meaning impact their pedagogical beliefs. An experiment with a two-group pre-test-post-test design, consisting of a positive and negative news group, is conducted. Multimedia news…

  13. 26 CFR 31.3401(a)(10)-1 - Remuneration for services in delivery or distribution of newspapers, shopping news, or magazines.

    Science.gov (United States)

    2010-04-01

    ... distribution of newspapers, shopping news, or magazines. 31.3401(a)(10)-1 Section 31.3401(a)(10)-1 Internal..., shopping news, or magazines. (a) Services of individuals under age 18. Remuneration for services performed... services performed by an employee in, and at the time of, the sale of newspapers or magazines to...

  14. ACS after Servicing Mission 4: The WFC Optimization Campaign

    Science.gov (United States)

    Golimowski, David; Cheng, Ed; Loose, Markus; Sirianni, Marco; Lupie, Olivia; Smith, Linda; Arslanian, Steve; Boyce, Kevin; Chapman, George; Chiaberge, Marco; Desjardins, Tyler; Dye, Darryl; Grogin, Norman; Lim, Pey Lian; Lucas, Ray; Maybhate, Aparna; Mil, Kathleen; Mutchler, Max; Ricardo, Raphael; Scott, Barbara; Serrano, Beverly; Suchkov, Anatoly; Waczynski, Augustyn; Welty, Alan; Wheeler, Thomas; Wilson, Erin

    2011-07-01

    The ACS CCD Electronics Box Replacement (CEB-R) installed during SM4 features a Teledyne SIDECAR ASIC that permits optimization of the WFC via adjustment of CCD clock voltages, bias voltages, and pixel transmission timing. A built-in oscilloscope mode allows sensing of the analog signal from each output amplifier. An on-orbit campaign to optimize the performance of the WFC was undertaken at the start of the SMOV period. Initial tests with pre-SM4 default voltages and timing patterns showed that WFC's performance matches or exceeds its pre-failure levels, notwithstanding the expected increases in dark current and hot pixels and the decline in charge-transfer efficiency due to prolonged exposure to HST's radiation environment. The WFC2 CCD exhibited anomalous behavior when operated with nondefault settings of its amplifiers' reset-drain voltage (VOD). The CCD again displayed normal behavior when VOD was restored to its default setting. Consequently, the Optimization Campaign was truncated after two iterations, and ACS science operations commenced with the pre-SM4 default configuration.

  15. Coordinated Control Scheme for Ancillary Services from Offshore Wind Power Plants to AC and DC Grids

    DEFF Research Database (Denmark)

    Sakamuri, Jayachandra N.; Altin, Müfit; Hansen, Anca Daniela;

    2016-01-01

    This paper proposes a new approach of providing ancillary services to AC and DC grids from offshore wind power plants (OWPPs), connected through multi-terminal HVDC network. A coordinated control scheme where OWPP’s AC grid frequency modulated according to DC grid voltage variations is used...... to detect and provide the ancillary service requirements of both AC and DC grids, is proposed in this paper. In particular, control strategies for onshore frequency control, fault ridethrough support in the onshore grid, and DC grid voltage control are considered. The proposed control scheme involves only...... local measurements and therefore avoids the need of communication infrastructure otherwise required for communication based control, and thus increases the reliability of the control system. The effectiveness of the proposed control scheme is demonstrated on a MTDC connected wind power system developed...

  16. News from the Library: Two new online services available at CERN: thank you for your feedback!

    CERN Multimedia

    CERN Library

    2012-01-01

    The Library has activated two different new online services, as a result of very successful trial periods and thanks to your positive feedback and strong support: PressDisplay and Nucleonica.   PressDisplay is an online portal where one can browse and read online articles from more than 1,900 newspapers from 95 countries, as soon as they are published. Le Monde, International Herald Tribune and many more titles are available in their original layout including text and images. Thanks to RSS feeds, users can directly receive news from their favorite newspapers, but articles can also be printed and sent via email. Based on the very positive feedback we got from the community, the CERN Library has activated a one-year subscription to PressDisplay, and a wealth of information is now available at everyone's fingertips at CERN. In addition to that, the latest Library news about Nucleonica, the nuclide and isotope database derived from the Karlsruhe Nuclide Chart, generated so much interest ...

  17. The IAEA's WorldAtom Internet site: International news and information services

    International Nuclear Information System (INIS)

    The International Atomic Energy Agency (IAEA) provides news and public information services via the Internet through its WorldAtom home page. The page is accessible at www.iaea.org/worldatom. Following are brief highlights of the items available on the site by clicking Press Centre, Reference Centre, or other links: Daily Press Review: Summaries of selected news items pertaining to global nuclear developments and the IAEA's work are provided each day, drawing upon a wide range of global media sources. IAEA NewsBriefs: Regularly featured are updates about IAEA activities related to areas of safety, technology transfer, and nuclear safeguards. Meetings and training courses: News about IAEA-sponsored symposia, seminars, and other meetings, as well as information about international meetings on atomic energy sponsored by other organizations, are updated on a daily basis. Press releases and statements: All IAEA press releases and media advisories since 1995 are accessible on the site. Topical and feature pages: In-depth coverage and links to information resources within and outside the IAEA are regularly given to selected topics of high international interest involving the IAEA. IAEA publications: listings and overviews of IAEA technical reports, safety standards, and other publications are updated as they are issued. Scientific and technical information: WorldAtom includes links (Reference Centre) to the International Nuclear Information System, IAEA's extensive bibliographic database of references and resources, to the nuclear database, and to departmental pages at IAEA that focus on IAEA programs and activities. IAEA documents: Electronic versions of official IAEA documents are added as they are issued. These documents include the texts and status lists of international conventions under IAEA auspices; IAEA information circulars to member states; IAEA annual reports (since 1995); and background reports and documents for the IAEA General Conference related to

  18. 76 FR 4649 - ACS Energy Services, Inc.; Supplemental Notice That Initial Market-Based Rate Filing Includes...

    Science.gov (United States)

    2011-01-26

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission ACS Energy Services, Inc.; Supplemental Notice That Initial Market-Based... supplemental notice in the above-referenced proceeding, ACS Energy Services, Inc.'s application for...

  19. 75 FR 41522 - Novell, Inc., Including On-Site Leased Workers From Affiliated Computer Services, Inc., (ACS...

    Science.gov (United States)

    2010-07-16

    ... in the Federal Register on December 11, 2009 (74 FR 6599). At the request of the State Agency, the... Computer Services, Inc., (ACS), Provo, UT; Amended Certification Regarding Eligibility To Apply for Worker... reports that workers leased from Affiliated Computer Services, Inc., (ACS) were employed on-site at...

  20. Supporting User Generated Content for Mobile News Services: A Case Study

    Directory of Open Access Journals (Sweden)

    Christos K. Georgiadis

    2012-07-01

    Full Text Available Web 2.0 applications encourage users to contribute to the production of richer content. In this context, our work mainly focuses on providing mobile users the ability to share content and to support user generated content production. Specifically, in our case study, features both for a mobile Web and for a mobile native application are implemented, capable of providing news services enriched with indicative social networking elements. The results of our work are largely related to the understanding of the required proper solutions, based on the investigation of serious technical challenges: the XML‐RPC library for the Android platform is exploited, as well as a specific Backend Joomla! component is built (Rsstoa to handle consistently external content sources, such as feeds and multipart emails.

  1. Translation Principles in News Service for Major Sports Events%大型赛事新闻服务稿件的翻译原则

    Institute of Scientific and Technical Information of China (English)

    郭峥

    2016-01-01

    News service,started in 2000 Sydney Olympic Games,is officially launched in English.To serve local media,news service has provided bilingual materials (Chinese &English)in major sports events that were held in China and this has come to the issue of translating news service.In order to improve translation quality of news service and provide qualified news materials to journalists,the paper starts from the relation between news service and translation.By expounding the connotation,essence and development history,the paper proves the necessity and importance of translation work.Then the paper explains basic literary style for qualified news service translation through introducing literary style of news service,corresponding translation style and translation principle in news service to provide reference for standard news service translation.%新闻服务始于2000年悉尼奥运会,其工作语言为英语。但为服务本地媒体,在中国举办的大型体育赛事里,新闻服务提供中英双语的素材。在其中,新闻服务的稿件便涉及到翻译。为提升新闻服务中翻译质量,向记者提供合格的新闻素材,本论文首先从新闻服务及翻译的关系入手,通过对内涵、本质、发展的历史的阐述,论证翻译工作的必要性和重要性;然后通过介绍新闻服务的文体及对应的翻译体和新闻服务中翻译原则,阐述合格的新闻服务翻译所需具备的基本样式和文体格式,为规范新闻服务翻译工作提供一个参考。

  2. Research News

    Science.gov (United States)

    Research News - National Multiple Sclerosis Society Skip to navigation Skip to content Menu Navigation National Multiple Sclerosis ... Email Home Research Research News & Progress Research News Research News Share Smaller Text Larger Text Print Read ...

  3. ENS NucNet: Europe's nuclear news service open to the world

    International Nuclear Information System (INIS)

    NucNet is a Europewide network which circulates nuclear news and information that the public should be informed of, written in a language that the public can easily understand. NucNet is aiming for a balanced picture of nuclear to reach the public via the media, through rapid flow of accurate information. (author)

  4. 7 CFR 28.904 - Market news.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Market news. 28.904 Section 28.904 Agriculture..., TESTING, AND STANDARDS Cotton Classification and Market News Service for Producers Classification and Market News Services § 28.904 Market news. The Director shall cause to be distributed to producers...

  5. Towards Simpler Custom and OpenSearch Services for Voluminous NEWS Merged A-Train Data (Invited)

    Science.gov (United States)

    Hua, H.; Fetzer, E.; Braverman, A. J.; Lewis, S.; Henderson, M. L.; Guillaume, A.; Lee, S.; de La Torre Juarez, M.; Dang, H. T.

    2010-12-01

    To simplify access to large and complex satellite data sets for climate analysis and model verification, we developed web services that is used to study long-term and global-scale trends in climate, water and energy cycle, and weather variability. A related NASA Energy and Water Cycle Study (NEWS) task has created a merged NEWS Level 2 data from multiple instruments in NASA’s A-Train constellation of satellites. We used this data to enable creation of climatologies that include correlation between observed temperature, water vapor and cloud properties from the A-Train sensors. Instead of imposing on the user an often rigid and limiting web-based analysis environment, we recognize the need for simple and well-designed services so that users can perform analysis in their own familiar computing environments. Custom on-demand services were developed to improve data accessibility of voluminous multi-sensor data. Services enabling geospatial, geographical, and multi-sensor parameter subsets of the data, as well a custom time-averaged Level 3 service will be presented. We will also show how a Level 3Q data reduction approach can be used to help “browse” the voluminous multi-sensor Level 2 data. An OpenSearch capability with full text + space + time search of data products will also be presented as an approach to facilitated interoperability with other data systems. We will present our experiences for improving user usability as well as strategies for facilitating interoperability with other data systems.

  6. News & Announcements

    Science.gov (United States)

    2001-08-01

    News from Journal House National Chemistry Week (NCW) Celebrating Chemistry and Art is the theme of NCW 2001, to be held November 4-10, 2001. As you make plans for participating in the celebrations in your area, keep in mind that JCE is developing special materials on this theme, which will appear in our October issue: Classroom Activities, a comprehensive Illustrated Resource Paper, Report from Online, specially written brief articles illustrated in color, articles related to the theme, and CLIPs (Chemical Laboratory Information Profiles). Awards Announced Passer Award Passer Award recipients from the April 1 closing date are: George Bennett, Millikin University, Decatur, IL Daniel Berger, Bluffton College, Bluffton, OH Karen Dunlap, Sierra College, Rocklin, CA Myung-Hoon Kim, Georgia Perimeter College, Dunwoody, GA Cheryl Longfellow, Philadelphia University, Philadelphia, PA Jerry Maas, Oakton Community College, Des Plaines, IL Tim Royappa, University of West Florida, Pensacola, FL Visiting Scientist Award, Western Connecticut Section Diane Bunce, The Catholic University of America, has been selected as the 2001 Visiting Scientist of the Western Connecticut Section of the ACS. The award, presented annually since 1967, brings an outstanding chemical educator to visit high schools in Fairfield County, CT. In May, Bunce visited three high schools, Christian Heritage School, Fairfield High School, and Greenwich High School, where she interacted with teachers and students and presented lectures and demonstrations to several chemistry classes. She was also keynote speaker at the ACS local section's Education Night. The awardee is selected by a committee of university and high school teachers, industrial chemists, and the previous Visiting Scientist; there is an honorarium of 1500 plus expenses. Welch Award Roger D. Kornberg, a professor of structural biology at the Stanford University School of Medicine, received the 2001 Welch Award for his discovery of the nucleosome

  7. What leads to readers’ satisfaction with the mobile news apps service? An investigation into the roles of content originality and user experience

    Institute of Scientific and Technical Information of China (English)

    Wenjing; HE; Xiaoyu; CHEN; Yichen; LI; Yueyi; QIU

    2015-01-01

    Purpose: This study aims to explore whether content originality and user experience have positive effects on online news readers’ satisfaction with the mobile apps service.Design/methodology/approach: Data was collected via a Web-based survey. Data analysis of this study can be divided into two stages. In the first stage, a descriptive statistical analysis was conducted based on a sample of 612 respondents. In the second stage, the correlation among content originality, user experience and satisfaction was analyzed based on a sample of 377 mobile news apps users. Findings: Results of the first stage showed that social media and mobile news apps were the most important tools for users to access news, and different types of media were playing complementary roles in information transmission. Users held a positive attitude toward their mobile news reading experience and they described news they read on mobile apps with such words as "interesting", "instant", "positive", "profound", and "ironic". Results of the second stage confirmed our hypothesis that content originality and user experience both had positive impacts on user satisfaction.Research limitations: The questionnaires were distributed entirely online, so the sample may not be representative of the general population being studied and thus undermine the reliability and generalization of the findings to some extent. Moreover, this study adopted only one method(survey) and more methods such as interviews can be used to improve the accuracy of the results.Practical implications: The findings of this study can not only provide insights into a better understanding of users’ mobile reading behavior, but also help mobile information service providers attract more users.Originality/value: This is one of the first studies to explore the effects of content originality and user experience on online news readers’ satisfaction with the mobile apps service.

  8. News and Features Updates from USA.gov

    Data.gov (United States)

    General Services Administration — Stay on top of important government news and information with the USA.gov Updates: News and Features RSS feed. We'll update this feed when we add news and featured...

  9. ENS NucNet: Europe's nuclear news service open to the world

    International Nuclear Information System (INIS)

    NucNcet is a Europe-wide network which circulates nuclear news and informations that the public should be informed of, written in a language that the public can easily understand. NucNet is aiming for a balanced picture of nuclear to reach the public via the media, through a rapid flow of accurate information. All nuclear countries in Eastern and Western Europe, including the Soviet Union, participate in NucNet. Within each country, all sources of nuclear information, such as utilities, nuclear power plants, the fuel cycle industry, safety authorities and waste organisations, are directly linked to the ENS NucNet central office in Berne. Using faxes, they supply central office with all information about nuclear energy which is of interest to the public. This is done in various languages. The central office chooses the most important information, and edits it in English before distributing the material through the system, using the most up-to-date computer-fax equipment. (orig.)

  10. News & Announcements

    Science.gov (United States)

    2000-02-01

    . Works well. Activity:CD Light: An Introduction to Spectroscopy. J. Chem. Educ. 1998, 75, 1568A (December 1998). Workshop?yes Booth?yes, with colored plastic onlynot solutions Notes:Can be difficult to measure and cut cardboard for spectroscope. Pre-made spectroscopes and partially constructed ones to show method could be provided. Needs good light source to work well. Activity:Cleaning Up with Chemistry: Investigating the Action of Zeolite in Laundry Detergent. J. Chem. Educ. 1999, 76, 1461A (October 1999). Workshop?yes Booth?could demonstrate tubes of soapy water with and without zeolite Notes:Need access to water. Quick and easy. More information about JCE Classroom Activities is available on JCE Online at: http://jchemed.chem.wisc.edu/AboutJCE/Features/JCE_CA/. Here you will find the notes described above and a list of all published Classroom Activities. The site is updated regularly. Awards Announced United Nations Environment Program The United Nations Environment Program (UNEP) has selected Mario J. Molina, professor of earth, atmosphere, and planetary sciences at Massachusetts Institute of Technology, as the winner of the 1999 UNEP Sasakawa Environment Prize. The prize, worth $200,000, is for his outstanding global contributions in the field of atmospheric chemistry. ACS Northeastern Section The Northeastern Section of the American Chemical Society has awarded the Henry A. Hill Award to Morton Z. Hoffman, professor of chemistry at Boston University. The award is given annually to a member of the section for outstanding service. Award Deadlines Mettler-Toledo Thermal Analysis Education Grant Mettler-Toledo has established a grant to honor Edith A. Turi of the Polymer Research Institute, Polytechnic University, Brooklyn, NY, for her lifelong contribution to the cause of thermal analysis education. The grant will be awarded on an annual basis to not-for-profit organizations in North America that confer degrees up to the Ph. D. level and provide or intend to provide

  11. National Park Service - SRI - Soil Survey Geographic (SSURGO) for National Park Service Units (A-C TEST)

    Data.gov (United States)

    National Park Service, Department of the Interior — This data set was developed in conjunction with the U.S. Department of Agriculture, Natural Resources Conservation Service, and meets the standards and...

  12. News of CanalUGR tracked on Google News, Yahoo! News and Bing News

    OpenAIRE

    Herrero-Solana, V??ctor; Arboledas M??rquez, Luis; Leger??n-??lvarez, Elisa

    2013-01-01

    Dataset contains 613 news of CanalUGR (University of Granada Communication Office) tracked on the main online news aggregators (Google News, Yahoo! News and Bing News). We include: number in CanalUGR, media, country, type.

  13. L’Union européenne et les négociations de l’Accord sur le commerce des services (ACS) - Trade in Services Agreement (TiSA)

    OpenAIRE

    Guillenteguy, Laura; Ghio, Clara

    2016-01-01

    Depuis 2013, 22 États ainsi que l’Union européenne négocient un accord plurilatéral portant sur le commerce des services : l’Accord sur le Commerce des Services (ACS). Cet accord vise la libéralisation renforcée et multisectorielle du commerce international des services. Cet article éclaire les principales caractéristiques du futur accord, au regard notamment de l’Accord commercial sur le commerce des Services (AGCS), précédemment conclu dans le cadre de l’OMC. L’ACS constitue une solution de...

  14. NEWS: Institute news

    Science.gov (United States)

    2000-07-01

    Department of Physics and Astronomy at the University of Leeds. Physics at Work Exhibition: 12-14 September, University of Cambridge The year 2000 Exhibition will be the 16th organized by Brenda Jennison. The exhibition will be held at the Cavendish Laboratory and further details can be obtained from Brenda at the University (tel: 01223 332888, fax: 01223 332894 or e-mail: bmj10@cam.ac.uk). News on GNVQ science The Institute of Physics and the Royal Society of Chemistry are currently financing the compilation of a directory of resources to assist teachers in identifying and selecting suitable materials for teaching the new GNVQ science specifications. Work on the first part of the directory will soon be completed and it is hoped to publish the material in both print and electronic forms before the end of the summer term. This first part covers resources - all evaluated by practising GNVQ teachers - supporting the teaching of the compulsory units for Advanced GNVQ Science. A small team comprising a physics teacher, a chemistry teacher and a biology teacher, all involved with GNVQ programmes and led by Dr Ken Gadd, has carried out the work. They have established a network of teachers around the country to help with the evaluation of curriculum materials. The next part of the project will be to examine the feasibility of providing a similar listing for the optional units at this level. Future development, depending on the availability of funds, will extend the project to Intermediate level programmes in science, including the Part One, once its structure has been agreed at QCA. Further information about the Directory and the next phase of development will be available in the autumn. Activities Physics on Stage The future of science, technology and the ensuing wealth creation potential for Britain will depend on the quality of science education in schools today. Yet the numbers studying physics, which underpins science and engineering, are falling. This problem is currently

  15. News & Announcements

    Science.gov (United States)

    2000-01-01

    /TD/TDhome.html. This site also has links to JCE guidelines for prospective authors. Volunteers should contact Vitz by the medium of their preference: Ed Vitz, Editor, Tested Demonstrations, Journal of Chemical Education, Department of Chemistry, Kutztown University, Kutztown, PA 19530; phone: 610/683-4443; fax: 610/683-1352; email: vitz@kutztown.edu. Awards Announced ACS Regional Awards in High School Chemistry Teaching The American Chemical Society has announced winners of regional awards in high school chemistry teaching for 1999. Winners have demonstrated excellence in teaching, exceptional ability to challenge and inspire students, extracurricular work, and willingness to keep up to date in the field. The award consists of two certificates (one for the recipient, the other for display at the recipient's school) and a cash prize of 1,000. Thomas W. Adams, Indiana Academy for Science, Mathematics & Humanities at Ball State University, Muncie, Indiana: Central Region Arthur J. Crumm, Barstow School, Kansas City, Missouri: Midwest Region Esther H. Freeman, Tabb High School, Yorktown, Virginia: Southeast Region Joan A. Laredo-Liddell, St. Barnabas High School, Bronx, New York: Middle Atlantic Region, 1998 David T. Lee, Mountain Lakes High School, Mountain Lakes, New Jersey: Middle Atlantic Region, 1999 Diane Coley McGann, Santa Ana High School, Santa Ana, California: Western Region William J. Pilotte, Newington High School, Newington, Connecticut: Northeast Region Judith C. Seydel, Idaho Falls High School, Idaho Falls, Idaho: Northwest Region Brenda A. Wolpa, Canyon Del Oro High School, Tucson, Arizona: Southwest/Rocky Mountain Region NSF Distinguished Public Service Award As a part of its celebration in 2000 of its half-century in existence, the National Science Foundation has announced the recipient of its Distinguished Public Service Award. Samuel P. Massie, U.S. Naval Academy, Annapolis, Maryland (Emeritus) 1999 Ford Foundation Fellowships The National Academies have announced the

  16. Novel field test design for acquisition of DC and AC parameters during service

    DEFF Research Database (Denmark)

    Thorsteinsson, Sune; Poulsen, Peter Behrensdorff; Schou, Jørgen;

    2016-01-01

    Being able to monitor early signs of PV module degradation, is needed to ensure stable power production throughout the service life of a PV installation. Recently, impedance spectroscopy is proven to be a useful tool for detection of the presence and location of significant errors, and may have p...

  17. Young people’s news orientations and uses of traditional and new media for news

    NARCIS (Netherlands)

    A. van Cauwenberge; L. d'Haenens; H. Beentjes

    2013-01-01

    This article reports on Flemish college students’ news orientations and their uses of traditional and new media for news within a public service media environment. We used five homogeneous focus groups that covered variation in news media use. The analysis of the focus groups revealed major differen

  18. CERN television news

    CERN Multimedia

    2002-01-01

    CERN events brought right to your desktop by the new video bulletin.   CERN now has its very own news broadcast , or rather 'webcast', with a host of special reports and even a star presenter. From today onwards, just go to the Bulletin's web page, click on the 'video news' link and sit back and enjoy the latest news about CERN, presented in images by Wendy Korda. The ten-minute newscast in both French and English, the Organization's two official languages, presents interviews, pictures of experiments and computer-generated graphics, bringing you right up to date with some of the Laboratory's latest stories. The show concludes with a selection of the best snapshots taken by the CERN Photo Lab. So every one or two months CERN's Audio-Video Service (ETT/DH) will be putting together a video news report that you can watch on your own desktop computer. Daniel Boileau, Patrick Gilbert de Vautibault and Jacques Fichet, the Service's three technicians, came up with the idea of producing this regular feat...

  19. No news is good news?

    CERN Document Server

    Peter Schmid

    I'm retired and living back home in Austria. But I am still excited about ATLAS and I try to follow the progress of the project as closely as I can. The ATLAS e-news are an excellent source of information. Appearing now every month they provide a broad, solid view of what is going on. But I'm greedy; I'd love to be "on-line". When the first End-Cap Toroid moved from hall 180 to the pit I was frustrated. I knew that it was happening but I could only get first pictures and reports a few days later. In the meantime the ECT was lowered into the cavern; no information on this available nowhere up to the this issue of the e-news. Here is my dream: an "ATLAS news ticker", i.e. a web page with the news appearing on the day they happen; just one line of information, possibly with a reference to a picture, a person or a report. My idea isn't new. On the ATLAS web-site for the public we have a window "latest news". But I was disappointed when, until a week ago, the latest news dated from December 2006 !!! Can't we do...

  20. The News China Can Use

    Institute of Scientific and Technical Information of China (English)

    JACK CARNEY

    2010-01-01

    @@ Xinhua, China's biggest news wire service, began broadcasting English-language programs on its China Xinhua News Network Corp. (CNC) on July 1. CNC will soon go on to broadcast other programs in French, Spanish, Portuguese, Arabic and Russian. CNC TV itself, now broadcasting 24 hours a day, was inaugurated in December 2009 amid much fanfare as "an important move for Xinhua to enrich the agency's business sectors and embrace the multimedia world," said Xinhua President Li Congjun during its launch.

  1. Mixed News on Drug Abuse Among Lesbian, Gay Americans

    Science.gov (United States)

    ... gov/news/fullstory_161477.html Mixed News on Drug Abuse Among Lesbian, Gay Americans This group is more ... said Kana Enomoto, deputy principal administrator at the Substance Abuse and Mental Health Services Administration (SAMHSA). She spoke ...

  2. Crise dos serviços de saúde no cotidiano da mídia impressa The news about the health service crisis in the newspaper

    Directory of Open Access Journals (Sweden)

    Vera Sonia Mincoff Menegon

    2008-01-01

    Full Text Available Apoiando-nos na perspectiva da Psicologia Social, acatamos o pressuposto de que a mídia é um importante espaço de difusão de informações, atuando como co-produtora de sentidos e de subjetividades no cotidiano das pessoas. Assim, a partir da análise de notícias, publicadas em jornais de Campo Grande, MS, tendo como tema serviços de saúde e, mais especificamente, notícias sobre um período de crise nesses serviços, problematizamos o posicionamento do hospital como lócus privilegiado no cuidado com a saúde e as formas verticais de negociação. A ruptura com essa associação e a abertura ao diálogo é um grande desafio para que o Sistema Único de Saúde (SUS se constitua em um sistema público, pautado pelos eixos da integralidade e da humanização na atenção à saúde que, no debate atual, formatam propostas defendidas pela Saúde Coletiva e outras áreas que atuam na saúde, entre eles a Psicologia.From the perspective of Social Psychology, we agree on the assumption that news media is an important space to propagate information, acting as a co-producer of meanings and of subjectivities in people's everyday lives. Therefore, based on the analysis of newspaper news, published in local newspapers of Campo Grande , MS, and having as their subject health service, more specifically news about the crisis in this kind of service, we critically consider the positioning of hospitals as the privileged locus for health care as well as the vertical forms of negotiation. The rupture with this association and the opening for dialogue conveys a great challenge for the Sistema Única de Sáude - SUS (Brazil's public health care system so that it can be constituted as a public system, based on universal health care and humanization of health care attention which, under current debate, forms the proposals defended by Collective Health and other fields of knowledge involved in health care, including Psychology.

  3. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  4. Good News is No News

    NARCIS (Netherlands)

    D.J.C. van Dijk (Dick)

    2007-01-01

    textabstractNews plays a crucial role in determining prices in financial markets. In an efficient market, current prices fully and correctly reflect all available information, such that only truly new information leads to price adjustment. This lecture shows that using high-frequency data makes it p

  5. News & Announcements

    Science.gov (United States)

    1999-09-01

    that new technologies are having on the nation's campuses in the context of student learning and ways to achieve this learning cost-effectively. The Program has three areas of work: the Pew Grant Program in Course Redesign; the Pew Symposia in Learning and Technology; the Pew Learning and Technology Program Newsletter. The Pew Learning and Technology Program is coordinated by the newly created Center for Academic Transformation at Rensselaer Polytechnic Institute led by its executive director, Carol A. Twigg. The Center's mission is to serve as a source of expertise and support for those in and around higher education who wish to transform their academic practices to make them more accessible, more effective, and more productive by taking advantage of the capabilities of information technology. For further information, see the Center Web site at www.center.rpi.edu or contact Abbie Basile at basila@rpi.edu or 518/276-8323. Materials Available Outstanding Science Trade Books for Children The 1999 list of Outstanding Trade Books for Children, a cooperative project between NSTA and the Children's Book Council, has been published recently. Published annually for more than 20 years, the list of outstanding trade books is intended to help educators, librarians, parents, and others interested in science education to promote science through reading. The books are geared for children in grades K-8. This 1999 list is available through the NSTA Web site at www.nsta.org/pubs/sc, or through NSTA's Fax on Demand service (888/400-NSTA); when prompted, select number 842 to receive a faxed copy of the trade book list. ACS Pamphlet on Global Climate Change and Fact Sheet on Chemical Weapons Global Climate Change, an updated pamphlet that replaces the 1990 version, presents an overview of the factors that influence climate and describes the basis of recent public concerns. The pamphlet explains in clear, concise language what scientists know and don't know about the greenhouse effect. The

  6. News Bias in the 1972 Campaign: A Cross-Media Comparison. Journalism Monographs No. 58.

    Science.gov (United States)

    Hofstetter, C. Richard

    The television networks nightly news coverage of the 1972 Presidential campaign was examined between July 10 and November 6, 1972 to assess the nature and impact of political bias in news coverage. The campaign news coverage of two newspapers and one wire service was also compared with respect to the content and length of each medium's news about…

  7. NewsNet

    OpenAIRE

    Maffei, Lucia

    2000-01-01

    NewsNet wants to highlight the opening of a “unified law portal” as part of the plan for the E-government (http://www.governo.it/sez_dossier/neweconomy/e-government/sintesi.html) signed by the Ministers Council. The outlined overview shows from one side the creation of service portals that allow people and industries to obtain easily information on laws, and from the other the creation of helpdesks where asking the Administrations on the basis of the electronic identity card and the digital s...

  8. Measuring News Media Literacy

    Science.gov (United States)

    Maksl, Adam; Ashley, Seth; Craft, Stephanie

    2015-01-01

    News media literacy refers to the knowledge and motivations needed to identify and engage with journalism. This study measured levels of news media literacy among 500 teenagers using a new scale measure based on Potter's model of media literacy and adapted to news media specifically. The adapted model posits that news media literate individuals…

  9. Language, News and Volatility

    OpenAIRE

    Byström, Hans

    2014-01-01

    I use Google News TM to study the relation between news volumes and stock market volatilities. More than nine million stock market-related news stories in English and (Mandarin) Chinese are collected and the dynamics of the news volume and the stock market volatility is compared in both the Anglophone world and the Sinophone world. I find that the stock market volatility and the number of publicly available global news stories are strongly linked to each other in both languages. Contemporaneo...

  10. How well they retrieve fresh news items: News search engine perspective

    Directory of Open Access Journals (Sweden)

    Mohammad Ubaidullah Bokhari

    2016-09-01

    Full Text Available People are nowadays opting news search engines for searching news instead of traditional web search engines as, number of specialized news search services have been developed. So it becomes necessary to evaluate these news search systems and help users to select the best one. Lots of work has been done to measure the traditional effectiveness of web search engines, major work has been done for relevance based evaluation using precision based measures, where topical relevance is often the main selection criteria, but less work has been done to measure the time-sensitive effectiveness of the news search systems where freshness matters. In this paper we used a scheme using mathematical statistics to measure the time-sensitive effectiveness of four news search systems, i.e., how well they retrieve the fresh documents. To our knowledge there is a lack of a good measure that combines both time-independent effectiveness and the relative freshness of news items so our scheme, using top ten results for 100 news queries on four news search engines with the basic idea to pull all the relevant results from the news search systems we want to compare together into a single ranked list based on their recency and analyse the relative positions of these results, will be useful in stuffing this gap.

  11. News; Actualites

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2005-04-15

    The main news of the LPG industry from February to May 2005 are gathered in the first part. 8 articles are then gathered in this data-sheet, they deal with: 1) the French 'Charte de l'environnement': environment is now taken into account in the French fundamental Law 2) the French Prime Minister sets the targets for the National Council for Sustainable Development 3) the French government's policy for State environment-friendly items purchasing 4) Primagaz and Butagaz receive awards at the ENEO exhibition in Lyon 5) a French decree on pressure equipment, concerning among others, the role of controlling bodies on LPG tanks requalification 6) BP launches its chemical branch Innovene, in view of selling it this year 7) the French gas congress and exhibition 8) Favex, distributor in France of the US Mosquito Magnet System, launches a campaign. (O.M.)

  12. Health in the news: an analysis of magazines coverage of health issues in veterans and military service organizations.

    Science.gov (United States)

    Jitnarin, Nattinee; Poston, Walker S C; Haddock, Christopher K; Jahnke, Sara

    2015-05-01

    The purpose of this study was to conduct a content analysis of Veterans and Military Service Organizations (VMSOs) magazines to determine what health-related topics VMSOs target and how they inform their constituencies about health issues. Health-related topics in 288 VMSOs' magazines from 21 VMSOs published in 2011 and 2012 were coded by trained raters using a standardized manual. The top three most addressed health topics were Health Services (Health care, Insurance), Disability and Disability benefits, and post-traumatic stress disorder. Topics least frequently covered were Tobacco and Smoking cessation, Illegal drugs, Alcohol, Gulf War Syndrome, and Weight and Body composition. VMSOs are concerned about the health and well-being of their members given the considerable amount of content devoted to certain health topics such as health insurance concerns, disability, and post-traumatic stress disorder. However, other health concerns that affect a considerable number of both current military personnel and veterans and cost both the Department of Veterans Affairs and the Department of Defense millions annually, such as drug and alcohol problems, and tobacco use and smoking cessation, are infrequently covered. The results of this study improve our understanding of the health-related information that reaches the military and veteran populations through this important media outlet.

  13. News Service Sales Research based on C & R tree%基于分类回归树的新闻服务营销研究

    Institute of Scientific and Technical Information of China (English)

    汪秀

    2013-01-01

    数据挖掘技术中的分类和回归树(Classification And Regression Tree,CART)节点是一种基于树的分类预测方法,使用递归分区来将训练记录分割类似的输出字段值。文章将C&R树应用于市场营销研究,目标是寻找意愿接受互动新闻服务并购买的潜在客户。通过使用已有的客户数据作为训练样本,建立了一个分类回归模型,可以用于未来数据的预测,从而有助于企业更好地针对不同类型的客户进行不同的营销策略。%The Classification and Regression Tree node (Classification And Regression Tree,CART) in Data Mining techniques is a tree-based classification and prediction method that uses recursive partitioning to split the training records into segments with similar output field values. In this paper, it is applied to a marketing study which is to find the potential customers having the intentions to buy an online interactive news service. Through using the existing customer data as training samples, a classification and regression model is established, which can be used to predict future data and help the companies better carry out different marketing strategies for different types of customers.

  14. Hot News Recommendation System from Heterogeneous Websites Based on Bayesian Model

    Directory of Open Access Journals (Sweden)

    Zhengyou Xia

    2014-01-01

    Full Text Available The most current news recommendations are suitable for news which comes from a single news website, not for news from different heterogeneous news websites. Previous researches about news recommender systems based on different strategies have been proposed to provide news personalization services for online news readers. However, little research work has been reported on utilizing hundreds of heterogeneous news websites to provide top hot news services for group customers (e.g., government staffs. In this paper, we propose a hot news recommendation model based on Bayesian model, which is from hundreds of different news websites. In the model, we determine whether the news is hot news by calculating the joint probability of the news. We evaluate and compare our proposed recommendation model with the results of human experts on the real data sets. Experimental results demonstrate the reliability and effectiveness of our method. We also implement this model in hot news recommendation system of Hangzhou city government in year 2013, which achieves very good results.

  15. Physics News

    CERN Multimedia

    Gianotti, F.

    In spite of the fact that real data will only come in the year 2006, this is a very busy and interesting time for Physics-related activities. A very short overview of these activities is given in this issue of the ATLAS News Letter, while the various topics will be described in more detail in the next issues. The Physics and Combined Performance groups are working in four main areas: 1) Assess the ATLAS potential for physics, with emphasis on new channels and ideas. Recent examples are Extra-dimensions, invisible Higgs decays, heavy ion physics, the expected potential of a "Super-LHC" running at a luminosity of 10^35, etc.. 2) Improve the understanding of the detector performance and optimise the reconstruction algorithms. Examples of issues in the pipeline are: can we tag charm-jet ? What can we gain in the jet energy resolution by combining the calorimeter and tracker information to reconstruct the jet energy ? 3) Follow detector changes and detector-related issues and monitor the impact on the perform...

  16. Novae news

    CERN Multimedia

    2012-01-01

    As announced in the previous Bulletin, Novae has opened a new snack bar on the Flagstaff car park, just a few metres from CERN's reception area (Building 33).   Just a few metres from the CERN Reception, the new Novae snack point welcomes visitors and CERNois. Opening hours Currently: Monday to Friday, 8 a.m. to 4 p.m. From September: Monday to Friday, 7:45 a.m. to 5 p.m.; Saturdays from 8 a.m. to 2 p.m. The snack bar selection includes breakfast, starting at 2.70 CHF, cold dishes from 5 CHF, and hot dishes from 6 CHF.   Novae has also installed a 24-hour-a-day food vending machine in the CERN hostel (Building 39) and in Building 13. You can buy pasta and cooked dishes for 6.50 CHF to 8 CHF. In addition, a groceries vending machine has been installed in the main building, just across from the news kiosk. Nearly 60 different items are available around the clock. Finally, Novae has introduced a new payment system in several buildings on the Meyrin site. It accepts credit ca...

  17. Personalized News Recommendation: A Review and an Experimental Investigation

    Institute of Scientific and Technical Information of China (English)

    Lei Li; Ding-Ding Wang; Shun-Zhi Zhu; Tao Li

    2011-01-01

    Online news articles,as a new format of press releases,have sprung up on the Internet.With its convenience and recency,more and more people prefer to read news online instead of reading the paper-format press releases.However,a gigantic amount of news events might be released at a rate of hundreds,even thousands per hour.A challenging problem is how to efficiently select specific news articles from a large corpus of newly-published press releases to recommend to individual readers,where the selected news items should match the reader's reading preference as much as possible.This issue refers to personalized news recommendation.Recently,personalized news recommendation has become a promising research direction as the Internet provides fast access to real-time information from multiple sources around the world.Existing personalized news recommendation systems strive to adapt their services to individual users by virtue of both user and news content information.A variety of techniques have been proposed to tackle personalized news recommendation,including content-based,collaborative filtering systems and hybrid versions of these two.In this paper,we provide a comprehensive investigation of existing personalized news recommenders.We discuss several essential issues underlying the problem of personalized news recommendation,and explore possible solutions for performance improvement.Further,we provide an empirical study on a collection of news articles obtained from various news websites,and evaluate the effect of different factors for personalized news recommendation.We hope our discussion and exploration would provide insights for researchers who are interested in personalized news recommendation.

  18. News search, blogs and feeds a toolkit

    CERN Document Server

    Vage, Lars

    2010-01-01

    This book is about news search and monitoring. Aimed at professionals with a strategic need of monitoring the surrounding world, users with a need to find the best news sources, monitoring services and news search strategies and techniques will benefit from reading this book. The main purpose is to present a practical handbook with an analysis of readily available tools, blending with passages of a theoretical nature. It is also useful for students at LIS programmes and related information programmes and for librarians and information professionals. The authors aim to aid the reader in reachin

  19. News/Press Releases

    Data.gov (United States)

    Office of Personnel Management — A press release, news release, media release, press statement is written communication directed at members of the news media for the purpose of announcing programs...

  20. Understanding Health News

    Science.gov (United States)

    ... out potential risks. Slide 11 Is It Real Online News? Or Just Advertising? In April 2011, the Federal Trade Commission warned the public about fake online news sites promoting an acai berry “weight-loss” ...

  1. Market News Price Dataset

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Real-time price data collected by the Boston Market News Reporter. The NOAA Fisheries' "Fishery Market News" began operations in New York City on February 14, 1938....

  2. Disease Outbreak News

    Science.gov (United States)

    ... and response operations Diseases Biorisk reduction Disease Outbreak News (DONs) Latest DONs 26 August 2016 Middle East ... Disease outbreaks by country RSS feeds Disease outbreak news Announcement: WHO to change the way it reports ...

  3. Haberin Geleceği: Gazetelerle İlgili Bilgi Hizmetlerinin Yapılanması ve Kullanımı / The Future of News: Building and Using Information Services in Connection with Newspapers

    Directory of Open Access Journals (Sweden)

    H. İnci Önal

    2007-04-01

    Full Text Available The purpose of the present research is to specify the current stand and future of information services in providing news. Libraries and archives that collect newspapers, and supply services to let the readers to have quick and easy access to their contents, increase their activities and in conjunction to this, their experience. As an initial step of the present research, by methods of interviewing and administering questionnaires, Ankara branch office responsible of six nationwide distributed daily newspapers were investigated. Data were compiled about the present situation, provided services, problems to be confronted, and work plans. According to the evaluations, it seems that the developments in information technologies would also impose important tasks to librariesin case of disseminating newspaper information.

  4. Personal news

    NARCIS (Netherlands)

    NN,

    1950-01-01

    Dr J. Hutchinson retired after 44 years of service in the Royal Botanic Gardens at Kew (May 31, 1948), as Keeper of the Museum. He will devote his time mainly to the writing of some general handbooks especially his Genera Plantarum. He was succeeded by F.N. Howes, D. Sc. Mr H.K. Airy Shaw was appoin

  5. News & Announcements

    Science.gov (United States)

    1999-08-01

    News from Journal House Perspective on JCE Online Recently a reader asked us for a perspective on JCE Onlinehow the chemical education community is receiving it and how the Journal staff itself views it. We share our responses below. Subscriber Numbers How many people subscribe to JCE Online+? As of June 1, 1999, our records show that 13% of individual JCE subscriptions in the USA include JCE Online+. This percentage has increased significantly during the past year- in June 1998 it was approximately 4% and December 1998 about 7%. Almost all subscribers to JCE Online subscribe to print as well. Since JCE Online has only very recently been made available to institutional subscribers, there are no numbers to report. There has been considerable interest in online from libraries. Given that JCE Online+ is a fairly recent subscriber option and that many subscribers have a wait-and-see approach to any new option, we feel that the numbers above are quite high. The steady growth is encouraging. Online Usage How many people visit our Web site? Statistics for the period January 1, 1999, through May 31, 1999, that may be of interest include: Total Pages Served 361,115 Total Visits 138,377 Total Unique Visitors 51,744 Total Repeat Visitors 11,536 Average Visit Length 03:05 Average Requests/Visit 10.8 Average Pages/Visit 2.6 Average Daily Visits 916 Online Rationale and Expectations JCE Online is a very important part of the whole Journal, but we do not expect it to supplant print: online and print are very different media. Usage of JCE Online is growing steadily; our subscribers are realizing what we have learned: it is not possible to deliver the Journal in the print medium alone- print is no longer adequate to accomplish our mission. Examples of things not possible in print include: ·JCE Index to all 76 years of Journal issues, available all the time with responses within seconds. ·Supplementary materials that are important to only a limited number of our subscribers

  6. Library news

    CERN Multimedia

    CERN Library

    2010-01-01

    The CERN Library has been providing electronic access to the "Techniques de l'Ingénieur" database for the past 8 months. As a reminder, this is a multidisciplinary database of over 4000 technical and scientific articles in French, covering a broad range of topics such as mechanical engineering, safety, electronics and the environment. In a few simple steps, you can create your own account, select the types of documents you are interested in and configure your settings so as to receive alerts when articles in your field of activity are published. You can now access this resource from outside CERN using the "remote access to electronic resources" service. Further information is available here. Direct access to the database. Remote access to electronic resources. If you have any questions or comments, don't hesitate to contact us at: library.desk@cern.ch.

  7. Principles of Multimedia News Systems for Business Applications

    Directory of Open Access Journals (Sweden)

    Ioan I. ANDONE

    2009-01-01

    Full Text Available In the past few years considerable demand for business oriented multimedia information systems has developed. A multimedia information system is one that can create, import, integrate, store, retrieve, edit, and delete two or more types of media materials in digital form, such as audio, image, full-motion video, and text information. Multimedia information systems play a central role in many business activities. They represent a very special class complex computing systems. This paper surveys a special type of multimedia information systems: multimedia news systems. Multimedia news systems deal with architectures to manage complex multimedia news databases, online presentation and distribution services or the integration of several existing services to meta-services using intelligent news retrieval engines. The leading presentation platform in multimedia news presentation is news networks providing television services and Internet content distribution. The primary focus is on advanced multimedia news systems infrastructure, document standards, application architecture and principles for multimedia news on the Web that suggest long-term trends in this increasingly important area.

  8. Who Makes The News?

    DEFF Research Database (Denmark)

    Jørndrup, Hanne; Bentsen, Martine

    As newsroom staff around the world went about their day on 25 March 2015, hundreds of volunteers located in over 100 countries gathered to monitor their news media as part of the Fifth Global Media Monitoring Project (GMMP). The Global Media Monitoring Project (GMMP) is the world’s longest......-running and most extensive research on gender in the news media. It began in 1995 when volunteers in 71 countries around the world monitored women’s presence in their national radio, television and print news. The research revealed that only 17% of news subjects – the people who are interviewed or whom the...... Danish media. In 2010 women made up 31 % of the news subjects compared to the global average of 24 % women. This year the share of women in news has declined to 25% so Denmark is almost on level with the global average....

  9. Routinizing Breaking News

    DEFF Research Database (Denmark)

    Hartley, Jannie Møller

    2011-01-01

    This chapter revisits seminal theoretical categorizations of news proposed three decades earlier by US sociologist Gaye Tuchman. By exploring the definition of ”breaking news” in the contemporary online newsrooms of three Danish news organisations, the author offers us a long overdue re......-theorization of journalistic practice in the online context and helpfully explores well-evidenced limitations to online news production, such as the relationship between original reporting and the use of ”shovelware.”...

  10. 78 FR 32226 - Poultry Market News Reports; Request for Extension and Revision of the Currently Approved...

    Science.gov (United States)

    2013-05-29

    ...; ] DEPARTMENT OF AGRICULTURE Agricultural Marketing Service Poultry Market News Reports; Request for Extension... Livestock, Poultry, Meat, Grain, and Their Related Products Used as Market News Information AGENCY... collection. AMS recently merged its Livestock and Grain Market News Division with the Poultry Market...

  11. "Offline": the 2004 European parliamentary elections on television news in the enlarged Europe

    NARCIS (Netherlands)

    C.H. de Vreese; S.A. Banducci; H.A. Semetko; H.G. Boomgaarden

    2005-01-01

    We outline the competitive television news market in the enlarged European Union (EU) and demonstrate the continued importance of traditional media, in particular television, in the context of proliferation in choice of news sources, including on-line news services. Drawing upon a content analysis o

  12. "Off-line": the 2004 European parliamentary elections on television news in the enlarged Europe

    NARCIS (Netherlands)

    Vreese, de Claes H.; Banducci, Susan A.; Semetko, Holli A.; Boomgaarden, Hajo G.

    2005-01-01

    We outline the competitive television news market in the enlarged European Union (EU) and demonstrate the continued importance of traditional media, in particular television, in the context of proliferation in choice of news sources, including on-line news services. Drawing upon a content analysis o

  13. Education for a Culture of Peace: The Culture of Peace News Network as a Case Study

    Science.gov (United States)

    Adams, David

    2013-01-01

    The Culture of Peace News Network, an internet news service, is analyzed in the framework of a general approach to education for a culture of peace. Its format reflects the eight program areas for a culture of peace as adopted by the UN General Assembly. Among its other operating principles are universality of news with all cultures and regions of…

  14. Swisster – a news website for Anglophones

    CERN Multimedia

    2008-01-01

    Employees of CERN can now sign up for a free account at Swisster.ch, an English language website devoted to Swiss news and current affairs. « prev next » The website, which is aimed at English speakers in Switzerland, normally requires an annual subscription of 300 CHF, but has teamed up with sponsors to offer a free subscription for CERN employees. The service provides a daily newsletter containing the main news and other information sent to subscribers every working day. The Swisster website also offers a variety of services such as health, education and food forums called "corners", as well as weather & snow forecasts, blogs and even a TV guide for Anglophones. The editorial team of English-speaking journalists is based in Lausanne, Geneva, Zurich and Neuchatel and covers news for expatriates and English speakers living and working in Switzerland. Swisster.ch also has a Saturday morning radio show from 08:30 to 09:30, on Radio Cit�...

  15. Good And Bad News

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    <正>A distinguished scientist was participating in a panel discussion on the results of the nation’s future water supply.“Gentlemen,” he said.“I have some good news and bad news for you,Our study shows that by the year 2010 everyone will be drinking recycled sewage from

  16. BRAZILIAN NEWS PORTALS CHARACTERISTICS

    Directory of Open Access Journals (Sweden)

    Heloiza G. Herckovitz

    2011-02-01

    Full Text Available A content analysis of four Brazilian news media portals found that economic news dominated the top headlines with little attention paid to education, the environment and welfare. Other trends included a focus on local events and national news sources, reliance on few sources, mostly official ones, and a low percentage of news that fitted the concept of newsworthiness (a combination of both social significance and deviance concepts. Other findings of a study of 432 top news stories published by UOL, Estadão, iG and Terra during a 15-day period between February and March 2008 indicate that the top portions of the portals’ front pages carry news that lacks story depth, editorial branding, and multimedia applications. The results suggest that online news portals are in their infancy although Brazil has the largest online population of Latin America. This study hopes to shed light on the gatekeeping process in Brazilian news portals. Brazilian media portals have yet to become a significant editorial force able to provide knowledge about social issues and public affairs in a socially responsible fashione.

  17. With News Search Engines

    Science.gov (United States)

    Gunn, Holly

    2005-01-01

    Although there are many news search engines on the Web, finding the news items one wants can be challenging. Choosing appropriate search terms is one of the biggest challenges. Unless one has seen the article that one is seeking, it is often difficult to select words that were used in the headline or text of the article. The limited archives of…

  18. Good Friends, Bad News

    DEFF Research Database (Denmark)

    Hansen, Lars Kai; Arvidsson, Adam; Nielsen, Finn Årup;

    The link between affect, defined as the capacity for sentimental arousal on the part of a message, and virality, defined as the probability that it be sent along, is of significant theoretical and practical importance, e.g. for viral marketing. A quantitative study of emailing of articles from...... positive sentiments support virality. To test the hypothesis we analyze three corpora: A complete sample of tweets about the COP15 climate summit, a random sample of tweets, and a general text corpus including news. The latter allows us to train a classifier that can distinguish tweets that carry news...... and non-news information. We present evidence that negative sentiment enhances virality in the news segment, but not in the non-news segment. We conclude that the relation between affect and virality is more complex than expected based on the findings of Berger and Milkman (2010), in short 'if you want...

  19. News coverage of climate change in Nature News and ScienceNOW during 2007

    DEFF Research Database (Denmark)

    Nielsen, Kristian Hvidtfelt; Kjærgaard, Rikke Schmidt

    2011-01-01

    of appreciating climate change, its severe consequences, and its anthropogenic causes. During that year the two journals’ online news services Nature News and ScienceNOW framed climate change to fit particular agendas resulting in markedly different narratives. This article demonstrates that Nature News reported......Climate change has become one of the most favored topics in mass media, political discourses, and scientific discussions during the past decade. By the end of 2007 the scientific journals Science and Nature both demonstrated the urgency of climate change by emphasizing the importance and necessity...... more critically on political decisions, scientific results, and social matters of climate change compared to ScienceNOW. Operating under different institutional constraints ScienceNOW generally took a more cautious line. The evidence drawn from both textual and visual analyses shows that news sections...

  20. News aggregators influence on the quality of Internet-journalism

    Directory of Open Access Journals (Sweden)

    Chernetsky Petr Petrovich

    2015-09-01

    Full Text Available The article is devoted to the news aggregators and their impact on the quality of journalism in the Internet. The paper gives a definition of “news aggregators”, details the most famous of them, and lists some of the major problems which news aggregators are facing today. In addition, the article proves the thesis that news aggregators have a negative impact on the quality of news online. This is primarily due to the writing of the text for robots, not people, with a focus not on the quality and depth of the study, but the speed. Another major problem - the “theft” of news by websites-competitors and each other, as well as rewriting messages of various news services with a focus on sensationalism. All this leads to a general decline in the quality of journalistic texts on the Internet - in an effort to attract additional traffic news websites often the quality of materials are put into the background. At the end of the article it is made a forecast on the future of news aggregators.

  1. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area....

  2. Ranking a Stream of News

    OpenAIRE

    Del Corso, Gianna; Gulli, Antonio; Romani, Francesco

    2004-01-01

    searching on news is one of the most important activity on line. Indeed, Google, Yahoo, MSN and many others have proposed commercial search engines for indexing news feeds. Despite this commercial interest, no academic research has focused on ranking a stream of news and a set of news sources. In this paper, we introduce this problem by proposing a ranking framework which models: (1) the process of news stream generation, (2) the news clustering by topics, and (3) the evolution of news over t...

  3. Tweeting News Articles

    Directory of Open Access Journals (Sweden)

    Marco Toledo Bastos

    2013-09-01

    Full Text Available In this article we investigate the impact of social media readership to the editorial profile of newspapers. We analyze tweets containing links to news articles from eight of the largest national newspapers in the United States, United Kingdom, Spain, Brazil, and Germany. The data collection follows the first two weeks of October 2012 and includes 2,842,699 tweets with links to news articles. Twitter-shortened links were resolved using a three-pass routine and assigned to 1 of the 21 newspaper sections. We found the concentration of links to news articles posted by top users to be lower than reported in the literature and the strategy of relaying headlines on Twitter via automatic news aggregators (feeds to be inefficient. The results of this investigation show which sections of a newspaper are the most and least read by readers in different parts of the world, with German readers placing greater emphasis on Politics and Economy; Brazilians on Sports and Arts; Spaniards on Local and National news; Britons and Americans on Opinion and World news. We also found that German and Spanish readers are more likely to read multiple national newspapers, while British readers more often resort to foreign sources of news. The results confirm that feedback to news items from a large user base is pivotal for the replication of content and that newspapers and news items can be clustered according to the editorial profile and principles of newsworthiness inherited from legacy media. The results of this investigation shed light onto the networked architecture of journalism that increasingly depends on readership agency.

  4. Breaking News as Radicalisation

    DEFF Research Database (Denmark)

    Hartley, Jannie Møller

    The aim of the paper is to make explicit how the different categories are applied in the online newsroom and thus how new categories can be seen as positioning strategies in the form of radicalisations of already existing categories. Thus field theory provides us with tools to analyse how online...... journalists are using the categorisations to create hierarchies within the journalistic field in order to position themselves as specialists in what Tuchman has called developing news, aiming and striving for what today is know as breaking news and the “exclusive scoop,” as the trademark of online journalism...... provides us with the following two research questions: How does the category of breaking news fit into Tuchmans typology related to time, planning and technology? What types of stories are providing journalistic capital and how are online news stories categorised relatively within the journalistic field?...

  5. CCG - News & Events

    Science.gov (United States)

    NCI's Center for Cancer Genomics (CCG) has been widely recognized for its research efforts to facilitiate advances in cancer genomic research and improve patient outcomes. Find the latest news about and events featuring CCG.

  6. A guide to reading health care news stories.

    Science.gov (United States)

    Schwitzer, Gary

    2014-07-01

    From April 16, 2006, through May 30, 2013, a team of reviewers from HealthNewsReview.org, many of whom were physicians, evaluated the reporting by US news organizations on new medical treatments, tests, products, and procedures. After reviewing 1889 stories (approximately 43% newspaper articles, 30% wire or news services stories, 15% online pieces [including those by broadcast and magazine companies], and 12% network television stories), the reviewers graded most stories unsatisfactory on 5 of 10 review criteria: costs, benefits, harms, quality of the evidence, and comparison of the new approach with alternatives. Drugs, medical devices, and other interventions were usually portrayed positively; potential harms were minimized, and costs were ignored. Our findings can help journalists improve their news stories and help physicians and the public better understand the strengths and weaknesses of news media coverage of medical and health topics. PMID:24796314

  7. Agency and civic involvement in news production via Facebook commentary

    DEFF Research Database (Denmark)

    Eberholst, Mads Kæmsgaard; Hartley, Jannie Møller

    Social media services such as Facebook, Twitter and Youtube, where users create and share content, has become a large part of most peoples everyday digital life and equally media companies has realised that these services plays a great role in peoples news con-sumption pattern. On these services...

  8. Networks in the news media

    DEFF Research Database (Denmark)

    Bro, Peter

    When news reporters connect people in a single news story or in a series of coherent news stories they essentially construct networks in the news media. Networks through which social actors are aligned symbolically in written, visible or audible form. These socio-symbolic networks not only copy...... more formal types of social networks, but also complement or even substitute social networking elsewhere, and as such this particular type of social network offers people both inside and outside the news room new potentials - and problems. This article describe the basic vision of networks in the news...

  9. Making Radio Waves: Tune in to These Tips for Getting Your Campus News on the Air.

    Science.gov (United States)

    Stubbee, Melinda

    1993-01-01

    Radio is a relatively simple and effective way to make campus news and information available to the public. Establishing a college radio news service is not difficult, and developing a sound-bite service requires little equipment or expertise, just careful attention to quality and technique. More sophisticated systems can be developed easily. (MSE)

  10. Work Roles, News Gathering Equipment, and Newscasts in Current U.S. Television News Departments.

    Science.gov (United States)

    Harless, James D.; Collins, Erik L.

    In the Spring of 1973, American television news editors were surveyed for data on staff size, operating budgets, work roles, camera equipment, portable VTR equipment, wire services, mobile equipment, and number of newscasts. The data obtained are reported in five levels of operating budgets with a summary of the statistics for each area of news…

  11. Science news release and its benefits to your research

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    News release to the latest science findings is beneficial to both researchers and their served institutions as well as the public. It will help to set a bridge of communication between researchers, the public and media, and publishers, making the latest research findings well known to the public. World Journal of Gastroenterology has currently freely opened the News Release Service System (WJG-NRSS) for original articles with potential significance and novelty for news release to mass media to broaden the findings to the public.

  12. News | Division of Cancer Prevention

    Science.gov (United States)

    News about scientific advances in cancer prevention, program activities, and new projects are included here in NCI press releases and fact sheets, articles from the NCI Cancer Bulletin, and Clinical Trial News from the NCI website.

  13. Creative Cycling of News Professionals

    OpenAIRE

    Astrid Gynnild, PhD.

    2007-01-01

    The theory of creative cycling emerged from my PhD study of news professionals in Norway. The study was carried out according to classic grounded theory principles (Glaser and Strauss 1967, Glaser 1978, 1998, 2001, 2005), and the area of interest was the performance of news journalism in the multimedia age. The theory runs counter to widespread tendencies of industrial age thinking in news media. It emphasizes news professionals’ search for meaning in their daily work, and suggests that their...

  14. Communications and media services

    Science.gov (United States)

    Mcculla, James W.; Kukowski, James F.

    1990-01-01

    NASA's internal and external communication methods are reviewed. NASA information services for the media, for the public, and for employees are discussed. Consideration is given to electron information distribution, the NASA TV-audio system, the NASA broadcast news service, astronaut appearances, technology and information exhibits, speaker services, and NASA news reports for internal communications. Also, the NASA worldwide electronic mail network is described and trends for future NASA communications and media services are outlined.

  15. Automatic Association of News Items.

    Science.gov (United States)

    Carrick, Christina; Watters, Carolyn

    1997-01-01

    Discussion of electronic news delivery systems and the automatic generation of electronic editions focuses on the association of related items of different media type, specifically photos and stories. The goal is to be able to determine to what degree any two news items refer to the same news event. (Author/LRW)

  16. Googling the news

    DEFF Research Database (Denmark)

    Ørmen, Jacob

    2016-01-01

    Search engines provide a window into the changing association between websites and keywords across cultures and countries and over time. As such, they offer journalism and news researchers an opportunity to study how search engines, in this case Google, mediate news events and stories online....... However, search results are not straightforward to study. Since search results are made in the act of searching and will have to be retrieved from Google Search in real-time, there is a range of different ontological and methodological issues related to this data source. This paper addresses these issues...

  17. Global news production

    DEFF Research Database (Denmark)

    Clausen, Lisbeth

    Events around the world are broadcast by giant media players such as CNN, BBC and NHK amongst others. Consumers of news media receive the final message without knowing the processes that the images, the text and the sound have gone through. The media players can be considered as professional...... generators of national news, who manipulate presentations according to professional standards as well as local needs that are culturally based. This book explores how powerful political and economic agendas in the national media environment influence the production processes. It shows how the outcome...

  18. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an...

  19. From Popularity Prediction to Ranking Online News

    OpenAIRE

    Tatar, Alexandru; Antoniadis, Panayotis; Dias De Amorim, Marcelo; Fdida, Serge

    2014-01-01

    News articles are an engaging type of online content that captures the attention of a significant amount of Internet users. They are particularly enjoyed by mobile users and massively spread through online social platforms. As a result, there is an increased interest in discovering the articles that will become popular among users. This objective falls under the broad scope of content popularity prediction and has direct implications in the development of new services for online advertisement...

  20. News from Academy Bay

    OpenAIRE

    1984-01-01

    The 25th anniversary of the Galapagos National Park. Fire at the Darwin Research Station. The control of introduced mammals. Good news about the Hood tortoises. The endangered land iguanas. Penguins, cormorants and flamingos in 1984. A workshop on national parks. International conservation award to Secretary Ripley. Visits and events at the Charles Darwin Research Station.

  1. Irish Chemical News

    OpenAIRE

    Roche, James J.; Franklin, Margaret; Hobbs, Patrick; Hodnett, Kieran; Cantwell, Helen; Bradley, Derek; Burke, Mary

    2016-01-01

    Contents: A Message from the President p.3 -- Editorial p.5 -- Polymorphic Transformations in Pharmaceutical Compounds p.7 -- Navigating the Challenges of Method Validation –with a little help from Eurachem p.24 -- Obituary: Professor Richard Butler NUI Galway, February 10th, 2016 p.30 -- Congress 2016: Chemistry and Society, GMIT p.34 -- Characterisation of Biopharmaceuticals p.40 -- Industry & Business news p.78.

  2. News of the Year.

    Science.gov (United States)

    St. Lifer, Evan; Olson, Renee; Milliot, Jim; Bing, Jonathan

    1998-01-01

    Reviews library news for 1997. Highlights public library budgets, examined by number of patrons served; Internet filters and censorship; librarians and the media; private and government funding sources; outsourcing; expectations for growth in the publishing industry, emphasizing the Asian economic crisis; and new ideas from the next generation of…

  3. Spreading the News

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    For all the progress in establishing a government news release system in China, the State Council Information Office acknowledges there is still much room for improvement Being a government spokesperson anywhere in the world is no easy job. It is particularly the case in China, where there is legislation in place on government information release. Cai Wu, Minister of the State Council Information Office,

  4. Antarctic news clips, 1991

    Science.gov (United States)

    1991-08-01

    Published stories are presented that sample a year's news coverage of Antarctica. The intent is to provide the U.S. Antarctic Program participants with a digest of current issues as presented by a variety of writers and popular publications. The subject areas covered include the following: earth science; ice studies; stratospheric ozone; astrophysics; life science; operations; education; antarctic treaty issues; and tourism

  5. BBC Breakfast News

    OpenAIRE

    Swann, David

    2014-01-01

    Dr David Swann Interviewed on BBC Breakfast News by business correspondent Steph McGovern about his 'Design of the Year' nomination- the ABC Syringe. BBC Breakfast is the UK’s most watched morning programme with an average daily audience of 6.8m.

  6. News Editing. Second Edition.

    Science.gov (United States)

    Westley, Bruce H.

    A revision of the first edition of "News Editing," this is a textbook for the newspaper editor. The duties of the editor are detailed, as are those of other newspaper employees. Among the basic editing skills the author includes suggestions for sentence structure, word usage, and vocabulary. Examples are given of editing for objectivity, handling…

  7. 'I've used the word cancer but it's actually good news': discursive performativity of cancer and the identity of urological cancer services.

    Science.gov (United States)

    Kazimierczak, Karolina Agata; Skea, Zoe

    2015-03-01

    Drawing on the ethnographic study of urological cancer services, this article explores how a set of particular discourses embedded in the everyday clinical work in a large teaching hospital in the UK helps materialise particular configurations of cancer and related professional identities. Emerging on the intersection of specific socio-material arrangements (cancer survival rates, treatment regimens, cancer staging classifications, metaphors, clinical specialities) and operating across a number of differential relations (curable/incurable, treatable/untreatable, aggressive/nonaggressive), these configurations help constitute the categories of 'good' and 'bad' cancers as separate and contrasting entities. These categories help materialise particular distributions of power and are thus implicated in the making of specific claims about the identity of urological cancer services as unique and privileged. Exploring these issues in view of feminist and material-semiotic approaches to studying science, technology and medicine, this article seeks to move away from the understanding of cancer discourses as primarily linguistic performances, proposing to see them instead as arrangements of practices and relations simultaneously material and semiotic through which particular categories, entities and phenomena acquire their determinate nature. In doing so, it seeks to contribute to sociology's broader concern with discursive performativity of cancer. PMID:25847531

  8. A special broadcast of CERN's Video news

    CERN Multimedia

    2003-01-01

    A special edition of CERN's video news giving a complete update on the LHC project is to be broadcast in the Main Auditorium. After your lunch make a small detour to the Main Auditorium, where you see the big picture. On 14, 15 and 16 May, between 12:30 and 14:00, a special edition of CERN's video news bulletin will be broadcast in the Main Auditorium. You will have the chance get up-to-date on the LHC project and its experiments. With four years to go before the first collisions in the LHC, the LHC Project Leader Lyn Evans will present a status report on the construction of the accelerator. The spokesmen of the five LHC experiments (ALICE, ATLAS, CMS, LHCb and TOTEM) will explain how the work is going and what the state of play will be in four years' time. This special video news broadcast is the result of collaboration between the CERN Audiovisual Service, the Photo Service and the External communication section. The broadcast will begin with a brand-new programme title sequence. And just as in the real c...

  9. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  10. ACOUSTICAL STANDARDS NEWS.

    Science.gov (United States)

    Stremmel, Neil; Struck, Christopher J

    2016-07-01

    American National Standards (ANSI Standards) developed by Accredited Standards Committees S1, S2, S3, S3/SC 1, and S12 in the areas of acoustics, mechanical vibration and shock, bioacoustics, animal bioacoustics, and noise, respectively, are published by the Acoustical Society of America (ASA). In addition to these standards, ASA publishes a catalog of Acoustical American National Standards. To receive a copy of the latest Standards catalog, please contact Neil Stremmel.Comments are welcomed on all material in Acoustical Standards News.This Acoustical Standards News section in JASA, as well as the National Catalog of Acoustical Standards and other information on the Standards Program of the Acoustical Society of America, are available via the ASA home page: http://acousticalsociety.org. PMID:27475185

  11. Benchmarking news recommendations: the CLEF NewsREEL use case

    OpenAIRE

    Hopfgartner, Frank; Brodt, Torben; Seiler, Jonas; Kille, Benjamin; Lommatzsch, Andreas; Larson, Martha; Turrin, Roberto; Serény, Andrá

    2015-01-01

    The CLEF NewsREEL challenge is a campaign-style evaluation lab allowing participants to evaluate and optimize news recommender algorithms. The goal is to create an algorithm that is able to generate news items that users would click, respecting a strict time constraint. The lab challenges participants to compete in either a "living lab" (Task 1) or perform an evaluation that replays recorded streams (Task 2). In this report, we discuss the objectives and challenges of the NewsREEL lab, summar...

  12. NetWorking News

    DEFF Research Database (Denmark)

    Fritsch, Jonas; Iversen, Ole Sejer; Dindler, Christian;

    For many years cooperative design was primarily concerned with the development of IT supported systems for professional users. However, the cooperative design approach can embrace other social practices such as children’s everyday life. At a methodological level there is no difference in designin...... the Networking News workshop, offers an opportunity to make first hand studies of children’s IT supported social activities in an informal classroom setting....

  13. News of nuclear engineering

    International Nuclear Information System (INIS)

    Data on news of nuclear engineering in Bulgaria, Pakistan, Serbia, USA, South Africa, South Korea and Japan are presented. Problems of reactor safety, construction of new nuclear units at existing sites, highly enriched uranium removal are treated. Companies performing jobs on designing, manufacture of different nuclear reactor components are named. Questions of environment protection, timely information on accidents at NPP and qualified maintenance are discussed

  14. Contact: Releasing the news

    Science.gov (United States)

    Pinotti, Roberto

    The problem of mass behavior after man's future contacts with other intelligences in the universe is not only a challenge for social scientists and political leaders all over the world, but also a cultural time bomb as well. In fact, since the impact of CETI (Contact with Extraterrestrial Intelligence) on human civilization, with its different cultures, might cause a serious socio-anthropological shock, a common and predetermined worldwide strategy is necessary in releasing the news after the contact, in order to keep possible manifestations of fear, panic and hysteria under control. An analysis of past studies in this field and of parallel historical situations as analogs suggests a definite "authority crisis" in the public as a direct consequence of an unexpected release of the news, involving a devastating "chain reaction" process (from both the psychological and sociological viewpoints) of anomie and maybe the collapse of today's society. The only way to prevent all this is to prepare the world's public opinion concerning contact before releasing the news, and to develop a long-term strategy through the combined efforts of scientists, political leaders, intelligence agencies and the mass media, in order to create the cultural conditions in which a confrontation with ETI won't affect mankind in a traumatic way. Definite roles and tasks in this multi-level model are suggested.

  15. News and Announcements

    Science.gov (United States)

    1999-05-01

    1998 ACS Meeting in Boston he suffered a serious fall following a stroke, from which he never recovered. One of his last photographs, taken the previous day at a Journal luncheon, appears on page 1360 of the November 1998 issue. His commentary on his long career in chemistry and education appears on page 1520 of the December 1998 issue. Seaborg was a Nobel laureate, discoverer of elements, scientific advisor to presidents, former chancellor of the University of California, former chairman of the Atomic Energy Commission, chairman of the steering committee of the CHEM Study project, founder of Lawrence Hall of Science, , the list goes on and on. He was at the same time a passionate supporter of education. Seaborg published fourteen articles in the Journal between 1951 and 1998. He was interviewed in 1975 by David Ridgway as part of the Impact series (JCE 1975, 52, 70), and that interview is highly recommended reading (see supplement to this article). He received the 1994 ACS George C. Pimentel Award in Chemical Education; his award address was published in the ACS Division of Chemical Education's CHED Newsletter, Fall 1995. Memorial articles with details of his life and his scientific contributions have appeared in The New York Times (Saturday, February 27, 1999, page 1) and Chemical & Engineering News (March 8, 1999, page 29). But there is also the spirit of the man, what he believed in, what he tried to do, what he hoped he had accomplished. A sense of that can be gained from the excerpts that are reprinted below, taken first from the Impact interview and then from the award address. Ridgway: On reflection, now, out of your many contributions to chemistry, is there one that you feel has had more of an impact than others? Seaborg: The discovery of plutonium would answer that question. The impact there is probably nearly as great as any single chemical discovery. Ridgway: What was the state of the "art" in your field when you first decided to bend your energies in this

  16. Query-free news search

    OpenAIRE

    Henzinger, Monika; Chang, Bay-Wei; Milch, Brian; Brin, Sergey

    2003-01-01

    Many daily activities present information in the form of a stream of text, and often people can benefit from additional information on the topic discussed. TV broadcast news can be treated as one such stream of text; in this paper we discuss finding news articles on the web that are relevant to news currently being broadcast.We evaluated a variety of algorithms for this problem, looking at the impact of inverse document frequency, stemming, compounds, history, and query length on the re...

  17. Features of English News Headlines

    Institute of Scientific and Technical Information of China (English)

    尚菲菲

    2013-01-01

    Nowadays Chinese people are attaching great importance to English news that not only offers worldwide information but gives a hand to English learners with their improvement in English. As is called the eyes of English news, headlines are partic-ularly important. Generally speaking, English news headlines are precise, brief and as attractive as possible. They have their own grammar features and vocabulary features while different devices are employed to make them expressive and striking.

  18. Social Networks as News Sources in Croatia’s Most Viewed Television Newscast

    Directory of Open Access Journals (Sweden)

    Marija Volarević

    2013-12-01

    Full Text Available Assuming that journalists use social networks when searching for news, this paper represents one of the first studies to explore how often television journalists use social networks as news sources in the main television newscasts. Using content analysis, this paper examines news reports that mention social networks from 1 March to 31 May 2013, in the main Daily News on public service Croatian Television (HTV and commercial national television channel Nova TV. The purpose of this paper is to explore the extent to which social media is used as a source for news by television journalists. The study shows that television journalists have started using social networks as news sources when searching for information and that they tend to use the information from the most popular social networks, Facebook and Twitter. The analysis points to substantial differences between HTV and Nova TV in reporting on events with information from social networks.

  19. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  20. PUSHED NEWS: When the news comes to the cellphone

    Directory of Open Access Journals (Sweden)

    Antonio Fidalgo

    2009-12-01

    Full Text Available Combining two findings of recent surveys on the Internet whichstate that 1 “the Internet will soon surpass all other media as a main source for national and international news” and 2 “the mobile device will be the primary connection tool to the Internet in 2020” leads us to the conclusion that smartphones will soon be the primary source for news access. But if so, how will news come to the Internetconnected cellphones? In accordance with the distinction, already drawn in 1997, between push and pull technologies as two different forms of how content is delivered to the end users, cellphones are characterized as push devices (passive reception, in opposition to computers, classified as pull devices (active reception. The news items that fit cellphones are pushed news. And they will be pushed as SMS, e-mails, tweets and through news aggregators.

  1. CERN Video News on line

    CERN Document Server

    2003-01-01

    The latest CERN video news is on line. In this issue : an interview with the Director General and reports on the new home for the DELPHI barrel and the CERN firemen's spectacular training programme. There's also a vintage video news clip from 1954. See: www.cern.ch/video or Bulletin web page

  2. News media old and new

    DEFF Research Database (Denmark)

    Schrøder, Kim Christian

    2014-01-01

    This article presents and discusses three different approaches to the exploration of the cross-media challenges facing news audiences, as they seek access to, navigate in and make sense of the multitude of news sources across print, broadcasting, online and mobile media platforms. From a moderniz...

  3. A Commentary on News Translation

    Institute of Scientific and Technical Information of China (English)

    姚雅晴

    2011-01-01

    News language is formal,especially the high register vocabulary it employed to deliver the message unveiled by culturally and politically stamped style which challenges the translator a lot.Nida's formal and dynamic equivalence theory,Bielsa and Bassnett news translation theories and other methods and strategies are introduced to cope with these challenges and get the message across without distortion.

  4. A CENTURY OF NEWS DISCOURSE

    Directory of Open Access Journals (Sweden)

    Allan Bell

    2003-05-01

    Full Text Available This paper traces the development of news discourse across the 20th century ihrough a case study ofthe coverage of three expeditions to the South Pole: Captain Scott in 1912, Sir Edmund Hillary in 1958, and Peter Hillary in 1999. The way the news about the three expeditions reached New Zealand media serves as a framework and an illustration to examine three related issues: how technology has changed the time and place dimensions of news delivery; the consequent and concomitant shifts in news presentation; and associated changes in how humans have understood time and place. News values remain the same at a broad level across the century, but different in detail. Nationalism is obtrusive, but its focus shifts. In news practice, the deadline and the scoop drive the news in al1 three periods, but the scooping medium shifts from press to radio to television. The lapse between an event and its reporting shrinks exponentially from months to hours to minutes. The design of newspaper front pages changes radically, and news language compresses. There are social impacts, with newsworthy figures receiving closer exposure and the audience being cast in a more voyeuristic role.

  5. Translation in Global News Agencies

    OpenAIRE

    Ben Othman, Zeineb

    2012-01-01

    The work is divided into two parts. The 1st part is the translation of Chapter One "Power language and translation" and the Chapter Four "Translation in Global News Agencies". The 2nd part is about the characteristics and theories of translation particularly in News Agencies and Institutions as well as the difficulties I found in the translation of a specialized book.

  6. School Violence and the News

    Science.gov (United States)

    ... 5 Things to Know About Zika & Pregnancy School Violence and the News KidsHealth > For Parents > School Violence and the News Print A A A Text ... la escuela y las noticias Incidents of school violence are terrible and frightening, but fortunately they are ...

  7. Internet Archaeology News

    Directory of Open Access Journals (Sweden)

    Cèsar Carreras Monfort

    1999-05-01

    Full Text Available La revista Internet Archaeology News s'adreça a un públic restringit, especialitzat en arqueologia i sobretot en aplicacions de caràcter informàtic i noves metodologies de treball. El fet que la revista neixi amb la voluntat d'ésser innovadora en el seu camp i molt especialitzada no treu que el nivell de les col·laboracions sigui de força qualitat gràcies a la política del equip editorial.

  8. Climate News Across Media Platforms

    DEFF Research Database (Denmark)

    Eskjær, Mikkel Fugl

    2015-01-01

    In a changing media landscape marked by technological, institutional and cultural convergence, comparative and cross-media content analysis represents a valuable analytical tool in mapping the diverse channels of climate change communication. This paper presents a comparative study of climate...... change news on five different media platforms: newspapers, television, radio, web-news and mobile news. It investigates the themes and actors represented in public climate change communication as well as the diverse possibilities of participating in public debates and information sharing. By combining...... quantitative and qualitative content analysis the paper documents and explores the extent and character of climate change news across different media platforms. The study aims at contributing to the on-going assessment of how news media are addressing climate change at a time when old and new media...

  9. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede;

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  10. LATIN--Latin American Regional News Agency.

    Science.gov (United States)

    Nichols, John Spicer

    The establishment of a regional news agency for Latin America to improve the balance of news flow and increase the transmission of news more applicable to regional problems has often been proposed. Despite wide acceptance of the concept, the birth of the Third World's first regional news agency, Agencia Latinoamericana de Informacion (LATIN), has…

  11. A Contextual-Bandit Approach to Personalized News Article Recommendation

    CERN Document Server

    Li, Lihong; Langford, John; Schapire, Robert E

    2010-01-01

    Personalized web services strive to adapt their services (advertisements, news articles, etc) to individual users by making use of both content and user information. Despite a few recent advances, this problem remains challenging for at least two reasons. First, web service is featured with dynamically changing pools of content, rendering traditional collaborative filtering methods inapplicable. Second, the scale of most web services of practical interest calls for solutions that are both fast in learning and computation. In this work, we model personalized recommendation of news articles as a contextual bandit problem, a principled approach in which a learning algorithm sequentially selects articles to serve users based on contextual information about the users and articles, while simultaneously adapting its article-selection strategy based on user-click feedback to maximize total user clicks. The contributions of this work are three-fold. First, we propose a new, general contextual bandit algorithm that is ...

  12. AC power supply systems

    International Nuclear Information System (INIS)

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  13. Targeted News in an Intranet

    OpenAIRE

    Chen, Lisan; Schiller Shi, Tingting

    2013-01-01

    In SharePoint 2013, Microsoft added a social networking function in the personal sites (My Site) of a user. In this version, a personal news feed has been added which shows events regarding subjects the user follows, such as document changes, user updates, tagged posts, and site activities. The purpose of the thesis is to investigate whether or not it is possible to extend the news feed function by adding an independent component as part of My Site, to allow users to follow corporate news by ...

  14. Overview of CLEF NewsREEL 2015: News Recommendation Evaluation Lab

    OpenAIRE

    Kille, Benjamin; Lommatzsch, Andreas; Turrin, Roberto; Sereny, Andras; Larson, Martha; Brodt, Torben; Seiler, Jonas; Hopfgartner, Frank

    2015-01-01

    News reader struggle as they face ever increasing numbers of articles. Digital news portals are becoming more and more popular. They route news items to visitors as soon as they are published. The rapid rate at which new news is published gives rise to a selection problem, since the capacity of new portal videos to absorb news is limited. To address this problem, new portals deploy news recommender systems in order to support their visitors in selecting items to read. This p...

  15. RHYTHM STRUCTURE IN NEWS READING

    Directory of Open Access Journals (Sweden)

    Lluís Mas Manchón

    2013-06-01

    Full Text Available Rhythm is central to news reading in radio and television programs. This paper proposes a three level structure for rhythm in news discourse. It gives a comprehensive definition of rhythm and types of rhythm. Firstly, the Base Rhythm Structure consists of semantic and pragmatic rhythmic accents, coincident with very specific words. Secondly, these accents are grouped together according to type, frequency and order, thereby configuring three types of “rhythmic units” (the Internal Rhythm Structure: starting, main and end units. A last structure level presents four discursive factors that are very important in integrating the overall time structure of news announcing (the Melodic Rhythm Structure. This integral structure for news announcing rhythm should be further tested in acoustic-experimental studies under the criterion of information transmission efficacy.

  16. Increasing Learning from TV News.

    Science.gov (United States)

    Perloff, Richard M.; And Others

    1982-01-01

    Describes an experiment that manipulated two variables, repetition and pausing for viewer "digestion" of information in a news telecast. Concludes that the use of repetition increased viewers' retention of information, but that pauses did not. (FL)

  17. Mobile news - a review and model of journalism in an age of mobile media

    DEFF Research Database (Denmark)

    Westlund, Oscar

    2012-01-01

    -related content and services began to flourish. Accessing mobile news has gained traction in the everyday life of the public. In parallel, legacy news media have in recent years developed news provision, by repurposing or customising journalistic content published for mobile sites and/or applications....... This article explores the production of mobile news, by discussing and synthesising the findings of the contemporary literature found in the nexus of journalism and mobile media. It posits a model of journalism focusing on the roles of humans and technology in activities characterised by customising......The technological convergence of mobile “phones” and multimedia has been taking place since the 1990s, but it was not until the commercial birth of touchscreen-enabled mobile devices, offered with flat-rate subscriptions for mobile internet, that widespread production and use of news...

  18. No News in Business Cycles

    OpenAIRE

    Forni, Mario; Gambetti, Luca; Sala, Luca

    2011-01-01

    This paper uses a structural, large dimensional factor model to evaluate the role of 'news' shocks (shocks with a delayed effect on productivity) in generating the business cycle. We find that (i) existing small-scale VECM models are affected by 'non-fundamentalness' and therefore fail to recover the correct shock and impulse response functions; (ii) news shocks have a limited role in explaining the business cycle; (iii) their effects are in line with what predicted by standard neoclassical t...

  19. AC1 Wing

    Directory of Open Access Journals (Sweden)

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  20. AC1 Wing

    OpenAIRE

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  1. The Translation of English News Headlines

    Institute of Scientific and Technical Information of China (English)

    Ma Xiaona

    2013-01-01

    News headline translation is one of the most important types of news translation. As news headline is strongly purposeful, the translation of it must be achieved by some special methods. The history of news headline translation is almost as long as that of newspapers, but it has not been attached enough attention to. In the last twenty years, Chinese scholars of this field have paid much greater attention to news headline translation. Concerned studies of principles of news headline translation have also been made remarkable progress.

  2. Translation Strategies on English Sports News

    Institute of Scientific and Technical Information of China (English)

    张金柱; 冷冰冰

    2016-01-01

    With the improvement of people's life, sports has become an indispensable part of our life, which promotes sports news. Besides, sports news is one of the most significant way to promote cultural communication and enhance mutual understanding. Thus, sports news has an increasing role in the communication between China and outside world due to its unique advantages. Therefore, sports news translation has great practical and theoretical significance in today's society. with the analysis on the function and characteristics of the sports news, This thesis studies the sports news translation and proposes some practical translation skills.

  3. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  4. News from Council

    CERN Multimedia

    2016-01-01

    With this message I would like to share with you some highlights of this week’s Council meetings.   A major topic was the approval of CERN’s Medium Term Plan (MTP) 2017-2021, along with the budget for 2017. In approving the document, Council expressed its very strong support for the research programme the MTP outlines for the coming years.  Another important topic this week was the formal approval of the High Luminosity LHC project, HL-LHC. This comes as extremely good news not only for CERN, but also for particle physics globally. HL-LHC is the top priority of the European Strategy for Particle Physics in its 2013 update, and is part of the 2016 roadmap of the European Strategy Forum on Research Infrastructures, ESFRI. It was also identified as a priority in the US P5 strategy process, and in Japan’s strategic vision for the field. It secures CERN’s future until 2035, and ensures that we will achieve the maximum scientific return on the investment...

  5. New Bulletin: Latest News

    CERN Multimedia

    2005-01-01

    The paper version of the CERN Bulletin will be published twice a month with effect from 18 April 2005. The electronic version will be updated weekly. This year will see many changes in the Bulletin, designed to make it more economical, more compact and more attractive. From 18 April the paper version of the Bulletin will be published twice monthly, so we shall have to stop calling it the "Weekly". The purpose of this change in publication frequency is to redistribute the resources of the Publications Section of the Communications Group so that it can produce new brochures for the general public. However, so as not to compromise on topicality and communication of information, the Official News and General Information sections, the Pension Fund and training announcements and the seminar schedule will continue to be updated weekly. If you have signed up to be informed of the updates, you will continue to receive a weekly e-mail reminding you that the electronic version of the Bulletin has been updated. Offici...

  6. Decoding the codes: A content analysis of the news coverage of genetic cloning by three online news sites and three national daily newspapers, 1996 through 1998

    Science.gov (United States)

    Hyde, Jon E.

    This study compared news coverage of genetic cloning research in three online news sites (CNN.com, ABC.com, and MSNBC.com) and three national daily newspapers (The New York Times, The Washington Post, and USA Today). The study involved the analysis of 230 online and print news articles concerning genetic cloning published from 1996 through 1998. Articles were examined with respect to formats, sources, focus, tone, and assessments about the impact of cloning research. Findings indicated that while print news formats remained relatively constant for the duration of this study, online news formats changed significantly with respect to the kinds of media used to represent the news, the layouts used to represent cloning news, and the emphasis placed on audio-visual content. Online stories were as much as 20 to 70% shorter than print stories. More than 50% of the articles appearing online were composed by outside sources (wire services, guest columnists, etc.). By comparison, nearly 90% of the articles published by print newspapers were written "in-house" by science reporters. Online news sites cited fewer sources and cited a smaller variety of sources than the newspapers examined here. In both news outlets, however, the sources most frequently cited were those with vested interests in furthering cloning research. Both online and print news coverage of cloning tends to focus principally on the technical procedures and on the future benefits of cloning. More than 60% of the articles focused on the techniques and technologies of cloning. Less than 25% of the articles focused on social, ethical, or legal issues associated with cloning. Similarly, articles from all six sources (75%) tended to be both positive and future-oriented. Less than 5% of the total articles examined here had a strongly negative or critical tone. Moreover, both online and print news sources increasingly conveyed a strong sense of acceptance about the possibility of human cloning. Data from this study

  7. News and Announcements

    Science.gov (United States)

    1999-06-01

    1999 EAS Awards The Eastern Analytical Symposium (EAS) announces the winners of their 1999 awards, which will be presented during their annual meeting, to be held November 14-19, 1999, at the Garden State Convention Center in Somerset, NJ. ACS Analytical Chemistry Division, Findeis Young Investigator Award David Clemmer, Indiana University EAS Award for Achievements in Separation Science Milton L. Lee, Brigham Young University EAS Award for Achievements in Near-Infrared Spectroscopy Phil Williams, Grain Research Laboratory, Winnipeg, Canada EAS Award for Achievements in Magnetic Resonance Frank A. L. Anet, University of California, Los Angeles (Emeritus) EAS Award for Outstanding Achievements in the Fields of Analytical Chemistry Catherine Fenselau, University of Maryland at College Park Galactic Industries Award for Achievements in Chemometrics Harald Martens, Norwegian University of Science and Technology Proposal Deadlines National Science Foundation Division of Undergraduate Education (DUE) Course, Curriculum, and Laboratory Improvement (CCLI) June 7, 1999 NSF Collaboratives for Excellence in Teacher Preparation (CETP) Preliminary proposals, Track 1 May 1, 1999 Formal proposals, Track 1 September 1, 1999 DUE online 1999 guidelines, NSF 99-53 available at http://www.nsf.gov/cgi-bin/getpub?nsf9953 For further information about NSF DUE programs consult the DUE Web site, http://www.ehr.nsf.gov/EHR/DUE/start.htm. Program deadlines are at http://www.ehr.nsf.gov/EHR/DUE/programs/programs.htm . To contact the DUE Information Center, phone: 703/306-1666; email: undergrad@nsf.gov. The Camille and Henry Dreyfus Foundation, Inc. Camille Dreyfus Teacher-Scholar Awards Program: November 16, 1998 Henry Dreyfus Teacher-Scholar Awards Program: July 1, 1999 New Faculty Awards Program: May 14, 1999 Faculty Start-up Grants for Undergraduate Institutions: May 14, 1999 Scholar/Fellow Program for Undergraduate Institutions: July 1, 1999 Special Grant Program in the Chemical Sciences

  8. Society for the History of Psychology News.

    Science.gov (United States)

    Lee, Shayna Fox

    2016-05-01

    Presents the Society for the History of Psychology News column. This column records miscellaneous publication news, announcements, research notes, reviews of books, and conference information, as well as references that support their writings. (PsycINFO Database Record PMID:27100928

  9. Application of Economy Principle in News English

    Institute of Scientific and Technical Information of China (English)

    潘红

    2016-01-01

    The economy principle of language obtained full manifestation in news English. This paper presents major ways in which people make news English economic, i.e. using short words, abbreviations, affixes, compounds and words with extended meanings and conversions.

  10. The shifting cross-media news landscape

    DEFF Research Database (Denmark)

    Schrøder, Kim Christian; Steeg Larsen, Bent

    2010-01-01

    market, as a consequence of accelerating divisions between 'overview' and 'depth' news media (across print, broadcasting and the internet). The project is carried out in a partnership of university-based researchers and analysts from one of the major newspaper publishers in Denmark, and presents the......The article offers new insights for democracy and for news producers by mapping the use and users of today’s cross-media news landscape, as the everyday consumption of news across the range of available news media and formats is shifting as a result of transformations of technology, culture and...... news media, a user-anchored concept which incorporates the different functionalities of the situational cross-media use of news by citizen/consumers in everyday life. Empirically the article presents the findings of a large-scale survey that traces the imminent challenges facing players in the news...

  11. The shifting cross-media news landscape

    DEFF Research Database (Denmark)

    Schrøder, Kim Christian; Steeg Larsen, Bent

    2010-01-01

    market, as a consequence of accelerating divisions between 'overview' and 'depth' news media (across print, broadcasting and the internet). The project is carried out in a partnership of university-based researchers and analysts from one of the major newspaper publishers in Denmark, and presents......The article offers new insights for democracy and for news producers by mapping the use and users of today’s cross-media news landscape, as the everyday consumption of news across the range of available news media and formats is shifting as a result of transformations of technology, culture......” of news media, a user-anchored concept which incorporates the different functionalities of the situational cross-media use of news by citizen/consumers in everyday life. Empirically the article presents the findings of a large-scale survey that traces the imminent challenges facing players in the news...

  12. 21 CFR 880.5510 - Non-AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Non-AC-powered patient lift. 880.5510 Section 880.5510 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is...

  13. Users' reading habits in online news portals

    OpenAIRE

    Esiyok, Cagdas; Kille, Benjamin; Jain, Brijnesh Johannes; Hopfgartner, Frank; Albayrak, Sahin

    2014-01-01

    The aim of this study is to survey reading habits of users of an online news portal. The assumption motivating this study is that insight into the reading habits of users can be helpful to design better news recommendation systems. We estimated the transition probabilities that users who read an article of one news category will move to read an article of another (not necessarily distinct) news category. For this, we analyzed the users' click behavior within plista data set. Key findings are ...

  14. On Linguistic Features of News English

    Institute of Scientific and Technical Information of China (English)

    宋少华

    2008-01-01

    This essay mainly studies the linguistic features of News English on stylistics.The study is made mainly on three aspects of News English.They are lexical features.sentence features and grammar features of News English.Through the study we find that News English,as a distinctive and new language.has its own lin-guistic features in words, sentences and grammar.

  15. Agency and civic involvement in news production via Facebook commentary

    DEFF Research Database (Denmark)

    Eberholst, Mads Kæmsgaard; Hartley, Jannie Møller

    Social media services such as Facebook, Twitter and Youtube, where users create and share content, has become a large part of most peoples everyday digital life and equally media companies has realised that these services plays a great role in peoples news con-sumption pattern. On these services...... users can contribute to the publication process, in theory broadening the diversity of public debate. This paper explores user involvement on the Facebook pages of Danish mainstream online newspapers in November 2012 and investigate the hypothesises that user interactivity gives audiences greater power...

  16. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  17. An Economic Theory of News Selection.

    Science.gov (United States)

    McManus, John

    Over the years, journalists, social scientists, and government commissions have defined news in a variety of ways, but their definitions consistently lack the notion that, above all, news is a commodity and must sell. Within the journalism profession, and particularly in television news, the potential for conflict between a media corporation's…

  18. Semantic Analysis of FBI News Reports

    DEFF Research Database (Denmark)

    Nizamani, Sarwat; Memon, Nasrullah

    2012-01-01

    In this paper we present our work on semantic analysis of FBI News reports. In the paper we have considered the News which are of the immense significance for the analyst who want to analyze the News of specific area. With this definite analysis we are able to extract critical events or concepts...

  19. Navigating cross-media news use

    DEFF Research Database (Denmark)

    Swart, Joëlle; Peters, Chris; Broersma, Marcel

    2016-01-01

    The current news media landscape is characterized by an abundance of digital outlets and increased opportunities for users to navigate news themselves. Yet, it is still unclear how people negotiate this fluctuating environment to decide which news media to select or ignore, how they assemble...

  20. Technology: News Readers and Other Handy Utilities

    Science.gov (United States)

    Van Horn, Royal

    2004-01-01

    In this article, the author discusses how there are advantages and disadvantages to using an Internet News Reader instead of a Web browser. The major advantage is that one can read the headlines and short summaries of news articles from dozens of sources quickly. Another advantage the author points out to news readers is that one gets a short…

  1. Daily Market News Sentiment and Stock Prices

    NARCIS (Netherlands)

    D.E. Allen (David); M.J. McAleer (Michael); A.K. Singh (Abhay)

    2015-01-01

    textabstractIn recent years there has been a tremendous growth in the influx of news related to traded assets in international financial markets. This financial news is now available via print media but also through real-time online sources such as internet news and social media sources. The increas

  2. The Places and Spaces of News Audiences

    DEFF Research Database (Denmark)

    on-demand. Day-by-day, month-by-month, year-by-year, technology moves forward, impacting more than just the ways in which we get news. These fundamental shifts change what news ‘is’. This book expands our understanding of contemporary news audiences and explores how the different places and spaces...

  3. Visualizing news: obstacles, challenges, and solutions

    NARCIS (Netherlands)

    Smit, Gerard; Haan, Yael de; Buijs, Laura; Bakker, Piet

    2013-01-01

    Depicting news graphically is considered an apt way to deal with challenges of modern journalism: to disclose big data, and present news attractively, visually, and fast to grasp. This study delves into reported obstacles and challenges for the production of news visualizations. It focuses on the qu

  4. Perspectives of English Language News

    Institute of Scientific and Technical Information of China (English)

    徐秋霞

    2007-01-01

    English is used more than any other languages, so all of us should get a good command of it in order to be more competitive in this society. There're many ways to master this language, but through reading English language newspaper, with which we have so much contact everyday, is obviously more convenient and interesting. English language newspaper contain several parts, the features of each of them will be analyzed in this thesis together with a specific piece of news. Furthermore, some effective methods of reading and understanding English language news will be proposed.

  5. News from IAEA Headquarters

    International Nuclear Information System (INIS)

    Full text: Two more countries have joined the Agency - Panama and Jordan - bringing IAEA membership up to 96. Mr. Ginige Richard Walter de Silva (Ceylon) has been appointed Director of the Division of Conference and General Services of the Agency. Born in 1911 at Nugegeda, Ceylon, Mr. de Silva obtained his B.Sc. in Physics at London University and his M.A. in Physics and Mathematics at Cambridge University. He has had a long career in the Civil Service, mainly in the administrative, commercial and finance branches of government. Mr.de Silva took over from Mr. Arthur E. Barrett, Chief of the Conference and Engineering Services, who had been Acting Director of the Division for a long period of time, and who will be leaving the Agency later this year to take up work elsewhere. From the early days of IAEA in 1957, Mr. Barrett has been closely associated with the establishment of the Agency's temporary headquarters in Vienna. He has been in charge of the planning and design of the technical facilities for the various conference installations and responsible for the servicing of all the General Conference sessions since 1958. In fact, Mr. Barrett has played an essential part in the creation of the Vienna Congress Centre in the former Hofburg Imperial Palace. Educated at Cambridge and London Universities, Mr. Barrett has had some 35 years of public service, first in the BBC in London and subsequently with the United Nations in New York. (author)

  6. News on pediatric urology

    Directory of Open Access Journals (Sweden)

    Giuseppe Masnata

    2015-10-01

    Full Text Available Pediatric urology is a pediatric speciality dedicated to the diagnosis and treatment of congenital and acquired genitourinary tract diseases. It is a speciality that is rapidly changing, thanks to the technological development that has been emerging in recent years. There have been important diagnostic and therapeutic news.Congenital anomalies of the kidneys and urinary tract (CAKUT include various entities of structural malformations that result from defects in their morphogenesis. Clinical research and genetic studies on the origins of CAKUT are quickly evolving, with significant growth of high-quality research.Management goals of CAKUT include prevention of febrile urinary tract infections (UTIs in newborns and toddles and renal injury, while minimizing the morbidity of treatment and follow-up. Treatment options include observation with or without continuous antibiotic prophylaxis (CAP and surgical correction. Now, randomized controlled studies show that children with normal urinary tracts or low-grade vesicoureteral reflux (VUR do not benefit from prophylaxis.All children with known mechanical or functional obstructions of the urinary tract are considered to have UTI. Functional obstruction often results from lower urinary tract dysfunction (LUTD of either neurogenic or non-neurogenic origin and dilating VUR.The role of bladder and bowel dysfunction (BBD in children with UTI and the long-term risk of renal scarring have shed new light on treatment strategies. Often it is BBD, rather than reflux, that causes UTI in children older than 2 years.Pediatric urology has evolved in recent years, with a greater focus on bladder and renal function, minimally invasive treatment, evidence-based interventions, and guideline adherence. Other topics in pediatric urology include urinary incontinence in children with special needs and the use of robot-assisted laparoscopic surgery (RALS in children, with advantages over conventional laparoscopic surgery

  7. News from the world

    International Nuclear Information System (INIS)

    This document gathers information from around the world and concerning nuclear industry. The most relevant are the following. The Russian group 'Atomstroy-Export' will build 2 PWR-type reactors (ES-2006 - 1200 MW) in Belarus in the following years. The American NRC has refused to accept the demand of Unistar for a combined license concerning the construction and operation of a new nuclear power plant (Calvert-Cliffs-3) under the consideration that Unistar belongs at 100% to a foreign company (EDF). SKB, the Swedish company for the management of radioactive wastes, has filed a demand for the construction of storage center for spent fuels in deep geological layers and of a unit for processing spent fuels. Areva has bought back the Siemens' share (34%) in Areva-NP for 1.63 billions euros. Exelon and Constellation, 2 American electricity producers have announced their merging, the new group, called Exelon will rank second in the Usa in terms of number of household customers (6.6 millions). The French Nuclear Safety Authority (ASN) has declared that the year 2010 was quite satisfactory in terms of nuclear safety and radiation protection in French facilities. Several agreements concerning cooperation in the domain of nuclear energy have been recently signed between France and Chile, France and Saudi Arabia and between France and South Africa. (A.C.)

  8. The News Media and the Expectation Formation of Firms

    OpenAIRE

    Buchen, Teresa

    2013-01-01

    Forming expectations about the future path of the economy and the own business prospects is not costless for a fi rm. Instead, acquiring and processing the relevant macroeconomic information requires valuable resources. One important source of information that provides a coding service is the mass media. This paper investigates empirically whether the news media have an independent influence on the expectation formation process of fi rms that goes beyond the actual economic developments. Usin...

  9. Engaging and Disengaging with Political News

    DEFF Research Database (Denmark)

    Ørmen, Jacob; Linaa Jensen, Jakob

    The possibilities of accessing and engaging with news are bigger than ever, due to developments in the media markets (e.g. the increase of commercial broadcasters) and technological innovations (e.g. the advent of smartphones and tablets) among other things. At the same time, studies have shown...... cluster analysis of a survey of the adult Danish population (n = 1205). The typology encompasses archetypical ways user can consume (e.g. watching news on TV, reading news in print as well as digital versions, encountering news on social networks and in face-to-face situations) and discuss political news...

  10. News of the Year.

    Science.gov (United States)

    Albanese, Andrew R.; Oder, Norman; Rogers, Michael; St. Lifer, Evan; Jay, M. Ellen; Milliot, Jim

    2001-01-01

    Includes three articles that discuss the top stories from "Library Journal", including the demand for librarians, the Digital Millennium Copyright Act, library education, database publishers, electronic research services, the Uniform Computer Information Transactions Act (UCITA), Internet filtering, and electronic reference; the school library…

  11. NEWS IN BRIEF

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Tourism Incomein the First Quarter;Foreign Mountaineers to Climb Qomolangma;Tibet Mountodneers to Assaultthe last 8000-M Peak;Telephone Service Available to All Border Counties;New Members of the Camping Ground;More Farmers Drink Sanitary Water;

  12. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  13. News and Announcements

    Science.gov (United States)

    1999-04-01

    resource professionals to participate in a diverse, comprehensive, carefully focused program with many opportunities for interactive and one-on-one communication. The conference has five tracks with each track having five focus areas: technical infrastructure; planning and strategy; service delivery; applications and best practices; and management and organization. Speakers at the general session include Colin Powell, retired chairman of the Joint Chiefs of Staff; Rita Colwell, director of the National Science Foundation; and Barry Munitz, president of the J. Paul Getty Trust. For more information visit the conference WWW site at http://www.educause.edu/conference/e99. Proposal Deadlines National Science Foundation Division of Undergraduate Education (DUE) Course, Curriculum, and Laboratory Improvement (CCLI) June 7, 1999 NSF Collaboratives for Excellence in Teacher Preparation (CETP) Preliminary proposals, Track 1 May 1, 1999 Formal proposals, Track 1 September 1, 1999 DUE online 1999 guidelines, NSF 99-53 available at http://www.nsf.gov/cgi-bin/getpub?nsf9953 For further information about NSF DUE programs consult the DUE Web site at http://www.ehr.nsf.gov/EHR/DUE/start.htm or contact the DUE Information Center; phone: 703/306-1666; email: undergrad@nsf.gov. The Camille and Henry Dreyfus Foundation, Inc. Camille Dreyfus Teacher-Scholar Awards Program: November 16, 1998 Henry Dreyfus Teacher-Scholar Awards Program: July 1, 1999 New Faculty Awards Program: May 14, 1999 Faculty Start-up Grants for Undergraduate Institutions: May 14, 1999 Scholar/Fellow Program for Undergraduate Institutions: July 1, 1999 Special Grant Program in the Chemical Sciences: July 15, 1999 Postdoctoral Program in Environmental Chemistry: February 26, 1999 Further information may be obtained from The Camille and Henry Dreyfus Foundation, Inc., 555 Madison Avenue, Suite 1305, New York, NY 10022; phone: 212/753-1760; email: admin@dreyfus.org; www: http://www.dreyfus.org/ Research Corporation Cottrell

  14. Broadcast News: An Interdisciplinary Project.

    Science.gov (United States)

    Nielsen, Carol; Sassi, Brenda

    Fourth graders in the Meroby School, Mexico, Maine, produce a weekly news program that is transmitted to all classrooms via closed circuit television. The classroom teacher is in charge of day-to-day preparation, working on the writing and the necessary skills with students. Teachers and students use their creativity to come up with new…

  15. Guess Who's in the News.

    Science.gov (United States)

    Wassom, Julie

    1996-01-01

    Examines the power of positive publicity as cost-effective child-care marketing. Suggests that getting positive press can make marketing easier, less expensive, and fun. Notes that by creating news stories and developing a working relationship with targeted media, child-care-center directors can inform, educate, and create new prospects and…

  16. The Aesthetics of News. Revised.

    Science.gov (United States)

    Glasser, Theodore L.

    That every community needs its own distinctive newspaper is the conclusion drawn in this review of the literature on journalism and communication. Following a summary of John Dewey's definition of democracy in the introduction, the first section of the paper points out the conflict that newspapers experience in trying to be a news source…

  17. Cultural Knowledge in News Comprehension

    DEFF Research Database (Denmark)

    Mathieu, David

    2009-01-01

    perspective, through the lens of cognition and pragmatics, revealing the role played by cultural knowledge in comprehension and the underlying relationship between a text and its intended audience. It is argued that recipients ‘problematise’ the news texts, a process by which the texts answer questions...... that take their roots in the cultural knowledge of the recipients....

  18. Teaching Social Work Students to Use News Media for Public Education Purposes.

    Science.gov (United States)

    Brawley, Edward A.; Martinez-Brawley, Emilia E.

    1982-01-01

    Efforts to teach social work students to use the news media (television, radio, and local newspapers) to publicize social work activities and social service programs and to educate the public about existing and needed services are described. Information is given on the opportunities in most localities for public education activities and results…

  19. Exploring Digital News Publishing Business Models

    DEFF Research Database (Denmark)

    Lindskow, Kasper

    News publishers in the industrialized world are experiencing a fundamental challenge to their business models because of the changing modes of consumption, competition, and production of their offerings that are associated with the emergence of the networked information society. The erosion...... of the traditional business models poses an existential threat to news publishing and has given rise to a continuing struggle among news publishers to design digital business models that will be sustainable in the future. This dissertation argues that a central and underresearched aspect of digital news publishing...... business models concerns the production networks that support the co-production of digital news offerings. To fill this knowledge gap, this dissertation explores the strategic design of the digital news publishing production networks that are associated with HTML-based news offerings on the open Web...

  20. News on Accounting and Tax Treatment Related to the Activity of Intracommunitarian Goods Transport

    OpenAIRE

    Pravãþ Ionela-Cristina

    2012-01-01

    The economical activity of transport fits within the broad category of services, but in terms of taxation, transport services are treated as an exception, compared to how services are approached in general. Among the categories of transportation services, intracommunitarian transport shows certain particularities. Therefore, we proposed in this work to address from a theoretical point of view a series of news occured in the tax and accounting treatment of specific business operations of intra...

  1. News from CHIS

    CERN Multimedia

    2014-01-01

    New contract between CERN and UNIQA Following a competitive call for tender, the consortium UNIQA Switzerland and UNIQA Austria has been awarded the contract for providing third-party administrative services for CERN’s Health Insurance Scheme. The contract will enter into force on 1 January 2015 for an initial period of five years, renewable by CERN for a further period of five years. This means that the Third-Party Administrator of the CHIS remains the same as before. While the services remain essentially the same, certain improvements are foreseen under this new contract.  Some of these will impact the members directly and positively, while others will improve the supervision of the Scheme by CERN’s administration. More details will be provided in the next CHIS Bulletin. Approved Hospitals in Geneva: new in 2014 In 2014, CERN has concluded new agreements with the following care providers in Geneva: ·     &a...

  2. News from the Library

    CERN Multimedia

    CERN Library

    2010-01-01

    The LHC Library to be merged with the Central Library. Not everyone knows that CERN Scientific Information Service currently counts three physical libraries on site. The Central Library is located in Building 52 and there are two satellite libraries located respectively in building 30 (the LHC Library) and in building 864 on Prévessin site (the SPS Library). Moreover, the Legal Service Library is located in Building 60. In the past, there have been at CERN up to 6 satellite libraries; they were essential at a time when information was only in paper form and having multiple copies of documents located in several places at CERN was useful to facilitate scientific research. Today, this need is less critical as most of our resources are online. That is why, following a SIPB (Scientific Information Policy Board) decision, the collections of the LHC Library will be merged this summer with the Central collection. This reorganization and centralization of resources will improve loan services. The SP...

  3. Nuclear news for all

    International Nuclear Information System (INIS)

    Fifty-seven percent of the employees of the Public Service Electric and Gas Company of Newark, NJ, answered No to the question: When people outside the company talk to you about nuclear power, do you feel you have enough information to adequately explain the company's position. Five booklets produced by the company's Advertising and Community Relations Department in July 1980 would have altered those results. The booklets (Nuclear Energy and the Environment, Low-Level Radiation, Nuclear Reactor Safety, Nuclear Waste Management and Disposal, and Alternative Energy Sources for Electric Generation) are summarized, and ordering information is given

  4. Hermetisk AC-Krets

    OpenAIRE

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  5. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  6. News and Announcements

    Science.gov (United States)

    1999-02-01

    News from Journal House Conceptual Questions and Challenge Problems Many readers are trying to modify the way they teach and in so doing are trying to write new types of questions and problems. The Journal has a new online resource, the JCE Internet Conceptual Questions and Challenge Problems Web site, http://jchemed.chem.wisc.edu/JCEWWW/Resources/CQandChP/index.html . The site is a source of questions and problems that can be used in teaching and assessing conceptual understanding and problem solving in chemistry. Here you can find a library of free-response and multiple-choice conceptual questions and challenge problems, tips for writing these questions and problems, and a discussion of types of concept questions. This site is intended to be a means of sharing conceptual questions and challenge problems among chemical educators. It will be as inclusive as possible, and to achieve this readers need to share their questions and alert the authors to references or Web sites. The screen captures shown below should provide a feeling for what you will find when you visit the site. The authors, William R. Robinson and Susan C. Nurrenbern, welcome additions to the library of conceptual questions or other comments or suggestions. Contact them by email, fax, or regular mail. William R. Robinson and Susan C. Nurrenbern, Department of Chemistry, Purdue University, West Lafayette, IN 47907-1393. Bill: phone: 765/494-5453; fax: 765/494-0239; email: wrrobin@purdue.edu. Sue: phone: 765/494-0823; fax: 765/494-0239; email: nurrenbe@purdue.edu. fax: 765/494-0239. 1998 Ford Foundation Fellowships The National Research Council has announced the recipients of the 1998 fellowships for minority scholars. Three categories of fellowships were awarded: 50 to beginning graduate students, 33 to students writing their dissertations, and 28 to recent Ph.D. recipients. There were about 1,000 applicants. For information about the next competition contact the Fellowship Office of the National

  7. News and Announcements

    Science.gov (United States)

    1999-07-01

    University of Michigan in Ann Arbor, is up and running at http://www.umich.edu/ bcce. Organizers of symposia and workshops as well as proposers of papers are invited to submit their ideas over the Web or in writing to the Program Chair, Brian Coppola; phone: 734/764-7329; email: bcoppola@umich.edu, or to the Workshop Coordinator, Evelyn Jackson; phone: 517/355-9715 ext 204; email: ejackson@argus.cem.msu.edu. For general information please contact Seyhan Ege, phone: 734/764-7340, email: snege@umich.edu. ChemCareers Debuts on ChemCenter The ACS ChemCenter website has recently launched a moderated career forum where chemists, chemical engineers, scientists in related fields, students, and other interested persons pose their questions related to career development in the chemical sciences. At the site you can hear what your peers think about preparing for, launching, maintaining, and advancing a career in chemistry. You can bring questions, share experiences, or offer advice. The forum is moderated by ACS career consultants who offer their expert opinions as a part of the discussion. The address is http://www.chemcenter.org. Click on the "discussions" hypertext link under "Discover Chemistry." Green Chemistry The closing date for grant funding from the EPA/NSF Technologies for a Sustainable Environment Solicitation is July 26, 1999. For specific grant information, visit the Web site www.nsf.gov/pubs/1999/nsf99108/nsf99108.txt. For general grant information about green chemistry, go to www.epa.gov/greenchemistry, es.epa.gov/ncerqa/grants, and www.nsf.gov; phone: 202/260-2659. Grad Resources Hotline A national crisis hotline sponsored by Grad Resources was set up effective April 1999. Graduate students who face overwhelming stress or despair may call 1/877-GRAD-HLP, toll-free, 24 hours a day, every day, to speak anonymously with a counselor specially trained in graduate issues. Grad Resources is a non-profit organization serving graduate students. For further references and

  8. Misunderstanding International News in Brazil

    Directory of Open Access Journals (Sweden)

    Jacques Wainberg

    2006-06-01

    Full Text Available This study evaluates the nature of the Brazilian public comprehension of international news by revealing the quality of such reception with regard to a sample of 170 subjects randomly selected in the city of Porto Alegre, Brazil. A questionnaire was created taking as a basis the directives of Bloom et al(1972. Evaluated in it are the cognitive and aff ective dimensions of thought. In the fi rst case, questions were formulated that allowed the establishment of the level of knowledge of individuals, as well as their comprehension abilities, application, analysis, synthesis, and evaluation of a wide range of international news topics. For the aff ective dimension the following abilities were evaluated: attention, response, valorization, organization and the structuring of a value scale.

  9. News from the Library

    CERN Document Server

    CERN Library

    2010-01-01

    Discover more literature and be aware of the most popular articles! For years particle physicists have  enjoyed monitoring the most cited articles thanks to the Spires system. This is obviously an important feature that is also carried forward by Inspire, a system currently available in its beta version. For colleagues based at CERN working in closely related disciplines or in technological areas, no system has been available to monitor the most cited articles within the various specific topics. As a result of the rapid changes in the information landscape, the Library is currently streamlining the set of databases CERN subscribes to. In this context the Library is now making  different services available for site-wide evaluation. Thomson Web of Knowledge is a platform that integrates over 100 years of scientific literature and citations, covering more than 256 disciplines. This tool offers various interesting features, including the citation report, which can be a good sourc...

  10. News for analytical chemists

    DEFF Research Database (Denmark)

    Andersen, Jens Enevold Thaulov; Karlberg, Bo

    2009-01-01

    The EuCheMS Division of Analytical Chemistry (DAC) maintains a website with informations on groups of analytical chemistry at European universities (www.dac-euchems. org). Everyone may contribute to the database and contributors are responsible for an annual update of the information. The service...... is offered free of charge. The report on activities of DAC during 2008 was published in journals of analytical chemistry where Manfred Grasserbauer contributed with his personal view on analytical chemistry in the assessment of climate changes and sustainable application of the natural resources to human...... directed to various topics of analytical chemistry. Although affected by the global financial crisis, the Euroanalysis Conference will be held on 6 to 10 September in Innsbruck, Austria. For next year, the programme for the analytical section of the 3rd European Chemistry Congress is in preparation...

  11. Move! Eat better: news

    CERN Multimedia

    2013-01-01

    Are you curious to know whether you’re doing enough daily exercise…? Test yourself with a pedometer!   Through the Move! Eat better campaign, launched in May 2012, the CERN medical service is aiming to improve the health of members of the personnel by encouraging them to prioritise physical activity in conjunction with a balanced diet. Various successful activities have already taken place: relay race/Nordic walk, Bike2work, Zumba and fitness workshops, two conferences (“Physical activity for health” and “Good nutrition every day”), events in the restaurants, as well as posters and a website. Although everyone has got the message from our various communications that physical activity is good for your health, there is still a relevant question being asked: “What is the minimum amount of exercise recommended?” 10,000 steps per day is the ideal figure, which has been demonstrated as beneficial by scientific studies ...

  12. News with an attitude: assessing the mechanisms underlying the effects of opinionated news

    NARCIS (Netherlands)

    M. Boukes; H.G. Boomgaarden; M. Moorman; C.H. de Vreese

    2014-01-01

    Opinionated news targets communities of likeminded viewers, relies on dramaturgical storytelling techniques, and shares characteristics with political satire. Accordingly, opinionated news should be understood as a specific form of political entertainment. We have investigated the mechanisms underly

  13. News clippings for introductory astronomy

    Science.gov (United States)

    Bobrowsky, Matthew

    1999-09-01

    Most students entering our introductory astronomy course for nonscience majors arrive not merely lacking scientific facts-they also have misconceptions about the nature of science, and many have a handicapping ``science anxiety'' (in addition to math anxiety). So I have added a ``current science'' requirement to our introductory course. Each student must compile a file of five astronomy news articles taken from readily available sources.

  14. Social Media News: Motivation, Purpose and Usage

    Directory of Open Access Journals (Sweden)

    Samaneh Beheshti-Kashi

    2013-05-01

    Full Text Available This paper presents the results of an online survey which was conducted to analyse the use of social web inthe context of daily news. Users’ motivation and habit in the news consumption were focused. Moreover,users’ news behaviour was distinguished in three purposes such news consumption, news production andnews dissemination to find out if the usage has a passive or active character. In a second step it wasquestioned which social software is used for which purpose. In conclusion users appreciate social softwarefor features such as interactivity and information that traditional media does not provide. Among the socialweb platforms users prefer social networking sites as well as videoshare platforms. Social networking sitesalso rank first in the news production and dissemination.

  15. Automatic news recommendations via aggregated profiling

    OpenAIRE

    Mannens, Erik; Coppens, Sam; De Pessemier, Toon; Dacquin, Hendrik; Van Deursen, Davy; De Sutter, Robbie; Van De Walle, Rik

    2013-01-01

    Today, people have only limited, valuable leisure time at their hands which they want to fill in as good as possible according to their own interests, whereas broadcasters want to produce and distribute news items as fast and targeted as possible. These (developing) news stories can be characterised as dynamic, chained, and distributed events in addition to which it is important to aggregate, link, enrich, recommend, and distribute these news event items as targeted as possible to the individ...

  16. News Media Sentiment and Investor Behavior

    OpenAIRE

    Kräussl, Roman; Mirgorodskaya, Elizaveta

    2014-01-01

    This paper investigates the impact of news media sentiment on financial market returns and volatility in the long-term. We hypothesize that the way the media formulate and present news to the public produces different perceptions and, thus, incurs different investor behavior. To analyze such framing effects we distinguish between optimistic and pessimistic news frames. We construct a monthly media sentiment indicator by taking the ratio of the number of newspaper articles that contain predete...

  17. News of the Year Top Ten News of China's Textile Industry in 2009

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    @@ "As a calendar event,'China Textile' Publishing House together with China Textile News appraised and selected the ten major news of China's textile industry in 2009 as the news of the year according to the subscriptionon on a public poll basis ."

  18. News of the Year Top Ten News of China’s Textile Industry in 2009

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    "As a calendar event, ‘China Textile’ Publishing House together with China Textile News appraised and selected the ten major news of China’s textile industry in 2009 as the news of the year according to the subscriptionon on a public poll basis ."

  19. Teaching Students to Report and Write the News

    Science.gov (United States)

    Weaver, Gail Cohen

    1978-01-01

    Draws on resources in the ERIC system to discuss the following aspects of student journalism: recognizing and gathering the news; interviewing news sources; writing clear, concise, and accurate news stories; and understanding journalism law and ethics. (KS)

  20. A Critical Discourse Analysis of News Discourse

    Institute of Scientific and Technical Information of China (English)

    王冬梅

    2008-01-01

    This paper aims to explore the underlying ideologies as well as the relationship between news discoutse and ideology by analyzing a news report on Saddam Hussei's capture in New York Times from the perspective of critical discourse analysis.While making the analysis,this paper studies the details of linguistic features,trausitivity,modality and themstic choice which are based on the three metafuoctions of language proposed by Halliday in systemic-functional grammar, so as to reveal how news discourse is used by powerful groups to reinforce dominant ideologies.and to gain profound insights about the stance and attitude maintained in news reports.

  1. News: Good chemical manufacturing process criteria

    Science.gov (United States)

    This news column covers topics relating to manufacturing criteria, machine to machine technology, novel process windows, green chemistry indices, business resilience, immobilized enzymes, and Bt crops.

  2. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  3. Outsourcing the news? An empirical assessment of the role of sources and news agencies in the contemporary news landscape

    NARCIS (Netherlands)

    J.W. Boumans

    2016-01-01

    Journalists are increasingly accused of uncritically recycling subsidized material in the form of press releases and news agency copy. This practice has been labeled churnalism and is believed to compromise journalism’s autonomy and threaten news quality. While the context - rampant competition, dec

  4. Media Literacy, News Literacy, or News Appreciation? A Case Study of the News Literacy Program at Stony Brook University

    Science.gov (United States)

    Fleming, Jennifer

    2014-01-01

    This case study provides practical and theoretical insights into the Stony Brook news literacy program, which is one of the most ambitious and well-funded curricular experiments in modern journalism education and media literacy. Analysis of document, interview, and observation data indicates that news literacy educators sought to teach students…

  5. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  6. Understanding News Geography and Major Determinants of Global News Coverage of Disasters

    CERN Document Server

    Kwak, Haewoon

    2014-01-01

    In this work, we reveal the structure of global news coverage of disasters and its determinants by using a large-scale news coverage dataset collected by the GDELT (Global Data on Events, Location, and Tone) project that monitors news media in over 100 languages from the whole world. Significant variables in our hierarchical (mixed-effect) regression model, such as the number of population, the political stability, the damage, and more, are well aligned with a series of previous research. Yet, strong regionalism we found in news geography highlights the necessity of the comprehensive dataset for the study of global news coverage.

  7. Report on the 1st International Workshop on Recent Trends in News Information Retrieval (NewsIR16)

    OpenAIRE

    Martinez, Miguel; Kruschwitz, Udo; Kazai, Gabriella; Hopfgartner, Frank; Corney, David; Campos, Ricardo; Albakour, Dyaa

    2016-01-01

    The news industry has gone through seismic shifts in the past decade with digital content and social media completely redefining how people consume news. Readers check for accurate fresh news from multiple sources throughout the day using dedicated apps or social media on their smartphones and tablets. At the same time, news publishers rely more and more on social networks and citizen journalism as a frontline to breaking news. In this new era of fast- flowing instant news deli...

  8. NEWS: Post-16 update

    Science.gov (United States)

    Campbell, Peter

    2000-07-01

    sometimes hard-to-come-by information, insightful and occasionally witty comment and illustration. The fifth booklet, published in April this year, rounds off the series so far. For those who have not yet seen them, here are the questions that the booklets have explored: Making Physics Connect (editor: Peter Campbell). How can physics courses connect better with the learner and with other human activities and areas of knowledge? Physics in Mathematical Mood (editor: Simon Carson). How can we teach physics in an appropriately mathematical way, conveying the beauty and power of mathematical reasoning to students? Physics in Vocational Courses (editor: Ken Gadd). In the new National Qualifications Framework, what role should physics play in the `general vocational' and `vocational' pathways? The Study of Matter (editor: Claire Davis). What aspects of a wide and interdisciplinary subject should be included in courses at advanced level, and how can these best be taught? Revitalising Physics Education (editor: Andrew Morris). What can we learn from histories of physics and of education, or from curriculum development projects of the last thirty years? What can be said about teaching and learning physics beyond qualifications, or learned from international developments in physics education? These booklets should find their way into every physics department in the UK. They will be of immediate practical use in schools or colleges, informing teaching while also providing stimulus material for discussion among physics teachers. (The latter would rightly be called in-service training.) Student teachers will find them a good guide covering new terrain. Lecturers at higher education level will gain valuable insight into changes affecting their undergraduate intake. And the physics advisory committee of every Awarding Body will surely want to discuss issues raised in the booklets. The main message overall is that, to meet tomorrow's challenges, the many parties involved in physics

  9. Developing a News Media Literacy Scale

    Science.gov (United States)

    Ashley, Seth; Maksl, Adam; Craft, Stephanie

    2013-01-01

    Using a framework previously applied to other areas of media literacy, this study developed and assessed a measurement scale focused specifically on critical news media literacy. Our scale appears to successfully measure news media literacy as we have conceptualized it based on previous research, demonstrated through assessments of content,…

  10. News Framing in a Time of Terror

    DEFF Research Database (Denmark)

    Jørndrup, Hanne

    2016-01-01

    of the shooting as a “terror attack” transformed the news coverage into a ‘News Media’ media event (Nossek 2008), abandoning the journalistic norm of critical approach. Instead media became the scene of national mourning – at least for a couple of days until political debate and political journalism resumed...

  11. Computational Methods for Analyzing Health News Coverage

    Science.gov (United States)

    McFarlane, Delano J.

    2011-01-01

    Researchers that investigate the media's coverage of health have historically relied on keyword searches to retrieve relevant health news coverage, and manual content analysis methods to categorize and score health news text. These methods are problematic. Manual content analysis methods are labor intensive, time consuming, and inherently…

  12. Creating Reality: How TV News Distorts Events.

    Science.gov (United States)

    Altheide, David L.

    A three-year research project, including more than one year in a network affiliate station, provided the material for an analysis of current practices in television news programming. Based on the thesis that the organization of news encourages the oversimplification of events, this analysis traces the foundation of the bias called the "news…

  13. When Literature Language Meets News Language

    Institute of Scientific and Technical Information of China (English)

    卢胡卓越

    2014-01-01

    Literature language and News language are two different language type, while, for attracting readers, writers more likely apply Literature language in News reports. This paper presents some comments on this phenomenon and make analysis, using examples to understand and comment on it.

  14. When Literature Language Meets News Language

    Institute of Scientific and Technical Information of China (English)

    卢胡卓越

    2014-01-01

    Literature language and News language are two different language type,while,for attracting readers,writers more likely apply Literature language in News reports.This paper presents some comments on this phenomenon and make analysis,using examples to understand and comment on it.

  15. News Analytics for Financial Decision Support

    NARCIS (Netherlands)

    V. Milea (Viorel)

    2013-01-01

    textabstractThis PhD thesis contributes to the newly emerged, growing body of scientific work on the use of News Analytics in Finance. Regarded as the next significant development in Automated Trading, News Analytics extends trading algorithms to incorporate information extracted from textual messag

  16. Detecting Terrorism Incidence Type from News Summary

    DEFF Research Database (Denmark)

    Nizamani, Sarwat; Memon, Nasrullah

    2012-01-01

    The paper presents the experiments to detect terrorism incidence type from news summary data. We have applied classification techniques on news summary data to analyze the incidence and detect the type of incidence. A number of experiments are conducted using various classification algorithms...

  17. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  18. NEWS: AAPT Summer Meeting

    Science.gov (United States)

    Mellema, Steve

    2000-11-01

    The 2000 Summer Meeting of the American Association of Physics Teachers (AAPT) was held from 28~July-2~August at the University of Guelph in Ontario, Canada. Despite somewhat rainy weather throughout the week, the annual gathering was an enjoyable one, filled with interesting talks on the state of physics education in North America. Using a new scheduling format for the summer meeting, all of the paid workshops and tutorials were held on Saturday and Sunday 29-30 July. The invited and contributed papers for the main AAPT meeting were then presented on Monday, Tuesday and Wednesday. As had been done in 1999 in San Antonio, a two-day tandem meeting dedicated to Physics Education Research (PER) was held on Wednesday and Thursday 2-3 August, immediately after the main AAPT meeting. Over the three days of the main meeting, 60 sessions were held under the sponsorship of various AAPT committees. These included sessions (numbers in parentheses) organized by the committees on Apparatus (1), Astronomy Education (3), Awards (2), Computers (5), Graduate Education (2), High Schools (1), History and Philosophy (1), Instructional Media (3), International Education (1), Laboratories (2), Pre-High School Education (2), Programs (4), Professional Concerns (6), Research in Physics Education (8), Science Education for the Public (2), Two-Year Colleges (5), Undergraduate Education (7) and Women in Physics (4). Figure 1. Guelph Church of Our Lady. The main meeting opened on Sunday evening with an invited lecture by Dr John J Simpson from the host institution, the University of Guelph, describing the Sudbury Neutrino Observatory. At the ceremonial session that began the activities on Monday morning, recognition was given to Clifford Swartz for his almost 30 years of service as Editor of the AAPT journal, The Physics Teacher. This was followed by an invited talk by Jim Nelson from Seminole County Public School in Florida, who received the Excellence in Pre-College Teaching Award. The

  19. Stylistic Analysis on Online News Story Comments

    Institute of Scientific and Technical Information of China (English)

    LI Pei

    2013-01-01

    This study examines stylistic features of the news story comments from major online news outlets and their possible ef-fects on the evolution of the English language. With a corpus composed of 34 examples drawn from renowned news sites such as The Washington Post, The Economist, Wall Street Journal, CNN and NBC, a detailed analysis on the stylistic features and effects of the news story comments has been conducted for the purpose of discovering possible links between a poster ’s linguistic behav-ior and his thought process. The result shows that interrogative, noun phrase and verb phrase are commonly used in news story comments by virtue of their slightly ostentatious nature. Rhetorical devices such as metaphor, simile and parataxis are frequently employed among comments. And the relationship between a poster’s educational background and his postings is also touched up-on at the end of this study.

  20. Ac Hybrid Charge Controller

    Directory of Open Access Journals (Sweden)

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  1. The NEWS Water Cycle Climatology

    Science.gov (United States)

    Rodell, Matthew; Beaudoing, Hiroko Kato; L'Ecuyer, Tristan; William, Olson

    2012-01-01

    NASA's Energy and Water Cycle Study (NEWS) program fosters collaborative research towards improved quantification and prediction of water and energy cycle consequences of climate change. In order to measure change, it is first necessary to describe current conditions. The goal of the first phase of the NEWS Water and Energy Cycle Climatology project was to develop "state of the global water cycle" and "state of the global energy cycle" assessments based on data from modern ground and space based observing systems and data integrating models. The project was a multi-institutional collaboration with more than 20 active contributors. This presentation will describe the results of the water cycle component of the first phase of the project, which include seasonal (monthly) climatologies of water fluxes over land, ocean, and atmosphere at continental and ocean basin scales. The requirement of closure of the water budget (i.e., mass conservation) at various scales was exploited to constrain the flux estimates via an optimization approach that will also be described. Further, error assessments were included with the input datasets, and we examine these in relation to inferred uncertainty in the optimized flux estimates in order to gauge our current ability to close the water budget within an expected uncertainty range.

  2. News from Council - September 2016

    CERN Multimedia

    2016-01-01

    I would like to inform you of the main news from the Council this week. First of all, the Council congratulated CERN and the Collaborations on the superb performance of the accelerator complex and experiments. It has been a great year so far, with important physics results across the whole spectrum of the CERN research programme.   Looking forward, one of the main accomplishments from this week’s meetings is that the Council has approved the opening of a credit facility with the European Investment Bank (EIB) to cover the cash shortage during the peak years of the High-Luminosity LHC (HL-LHC) construction. This is very good news since it will allow us to carry out the work necessary for the HL-LHC without compromising the rest of the Laboratory’s scientific programme. Turning to the scientific and geographical enlargement, the Council approved the admission of India as an Associate Member State, and I very much hope that the agreement can be signed in the near future so that Indi...

  3. The influence of news-events on health after disaster: a longitudinal study in general practice.

    NARCIS (Netherlands)

    Veen, P.M.H. ten; Morren, M.; Yzermans, C.J.

    2009-01-01

    This study investigates the influence of local and international news events on utilization of health services resources and health complaints as presented by victims of a fireworks depot disaster. It was hypothesized that victims (N = 2,854) will show more utilization and health complaints to their

  4. Two Approaches to Surfacing Full-Text News on an Intranet

    Science.gov (United States)

    Jones, Barrett; Maslyukova, Elena

    2006-01-01

    Integrating news services into an intranet can be tricky. Even within related organizations, slight differences in subscriptions and end-user needs can necessitate different integration approaches. This article examines how the World Bank and the International Monetary Fund took separate approaches to tackle the same integration challenge in…

  5. 16 CFR 1012.6 - The news media.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 2 2010-01-01 2010-01-01 false The news media. 1012.6 Section 1012.6... PERSONNEL AND OUTSIDE PARTIES § 1012.6 The news media. The Agency recognizes that the news media occupy a... inherently public nature of the news media allows their activities to be exempt from the requirements of...

  6. The Role of Audiovisual Mass Media News in Language Learning

    Science.gov (United States)

    Bahrani, Taher; Sim, Tam Shu

    2011-01-01

    The present paper focuses on the role of audio/visual mass media news in language learning. In this regard, the two important issues regarding the selection and preparation of TV news for language learning are the content of the news and the linguistic difficulty. Content is described as whether the news is specialized or universal. Universal…

  7. Engagement with News Content in Online Social Networks

    Science.gov (United States)

    Oeldorf-Hirsch, Anne

    2011-01-01

    Reports indicate that as the Internet is displacing traditional news sources, younger users continue to be disconnected from the news. Fortunately, the Internet provides new ways of sharing and discussing news stories with others through social networking sites such as Facebook, which may be important for engaging users in the news they read…

  8. Making It "Real": Words and Pictures in Television News.

    Science.gov (United States)

    Goodman, Sharon; Manners, Paul

    1997-01-01

    Examines features of television news, drawing on a series of interviews conducted during the production of an Open University television program. Examines the visual and verbal conventions of news and attempts to highlight how and why news can appear convincing. Those interviewed included British Broadcasting Corporation news practitioners,…

  9. NEWS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    <正>China’s Aluminium Processing Industry Profits Increased According to a report by China Nonferrous Metals Industry Association in the first quarter of this year, China’s aluminium processing industry realized some 40 per cent more profits compared that in the previous year, though the aluminium price increase has promoted the cost of production. This information is rather surprising to the industry analysts.

  10. NEWS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    <正>Titanium Dioxide Plants Joined Hands for Overseas Supply Stimulated by the booming demand both in China and abroad in recent years, Guangxi titanium oxide producers have their annual production capacity exceeded 150,000 tons and their actual output is already over 120,000 tons/year. Although the province has become China’s top producer region in titanium dioxide production capacity and actual output, the development of the mines in the province has lacked behind. Presently, the province can only supply about 100,000 tons ferro-titanium concentrates, but the demand at full production capacities by the titanium dioxide producers there

  11. News

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    The list of eliminating backward production capability published Ministry of Industry and Information Technology (MIIT) declared enterprises’ list from 18 industries that to eliminate backward production

  12. News

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    2010~2011 most competitive textile enterprises unveiled China National Textile Industry Council announced recently the evaluation result of 2010~2011 most competitive textile enterprises. At the meanwhile

  13. News

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    The nation started temporary store up policy of cotton Notice of the Preplan of on the Startup of the Temporary Store Policy of Cotton2011was jointly announced on September 7,by Economic and Commercial Department of National Development and

  14. NEWS

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Cotton spinning orders tends to transferred to Southeast Asia Customs data show that in the first four months by 2012, China imported a total of 430,000 tons of cotton yarn, an increase of 40% Y/Y.The im-ports increased in the number of cotton textile, yet

  15. NEWS

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Policy, standard, regulationl China to formulate national standard for fuel cell powered vehiclesThe campaign has started in Shanghai where first two documents-vehicle term and safety requirement are expected to come in 2008.

  16. NEWS

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    <正>China’s Export of Fabricated Aluminium Kept Growing According to China customs statistics, China’s export of fabricated aluminium in 2004 grew by 57.3 per cent or 157,000 tons year on year to reach 431,000 tons. Among the total export, aluminium plates and belts were 82,000 tons, up by 56.7 per cent year on year. Export of aluminium foil grew by 63.1 per cent to 75,000 tons and export of aluminium profile and rods grew by 57 per cent to 244,300 tons.

  17. NEWS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    <正>China’s Aluminium Producers are Making Losses Due to Over Capacity According to a report from the State Development and Reform Commission. China’s aluminium production capacity is already as high as 10.3 million tons/year and the capacities staying idle is 2.6 million tons with over half of the aluminium producers making losses. Statistics shows that due to over capacity and the high alumina price, the price for electrolytic aluminium went down constantly and the aluminium producers are

  18. News

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    Textile Export Grew Fast, But Future Still Unclear According to the latest Customs data, the export of textile & garment kept stable growth from Jan. to May. The accumulated export in first five months

  19. NEWS

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    Underwear Special Fund Established in China China’s f irst underwear technology fund, ZhengMintai China Knitting (Underwear) Fund is established re- cently. It is also the fi rst specail fund in the textile industry of China. This fund is supported by China

  20. News

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Premier:Textile Industry will Overcome the DifficultiesOct. 27, Moscow. Premier Wen Jiabao made an interview regarding the current global financial crisis during his visit to Russia. He pointed out that China had adjusted the marco-economy policy in time and was going to further extend its domestic demand.

  1. News

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    "Made in China" Ad Campaign Calls for Global CooperationA 30-second TV commercial re-mains a hot topic in China nearly two weeks after four Chinese indus-try associations launched a "Made in China" ad campaign on the CNN

  2. NEWS

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>Policy, standard, regulation China mulling fuel tax to replace road tolls China’s top economic planning body is working with other organizations to handle the feasibility of setting a new fuel pricing mechanism and introducing fuel taxes to replace road tolls and cut oil prices.

  3. News

    Institute of Scientific and Technical Information of China (English)

    Celine; Yi

    2008-01-01

    China consumption in July hit 12-year high According to the statistics from National Bureau of Statistics of China, the retail sales of social consumer goods reached RMB 862.9 billion yuan in July,increased by 23.3% year on year and this is the highest record since February of 1996.Statistics

  4. News

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Import and export for cotton textile shrinkingData from General Administration of Customs shows, from January to June period 2011, accumulated export value of cotton textile and garment of our country hited

  5. NEWS

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    <正>China and Cuba will Jointly Build up a Nickel Plant China’s Minmetals Corp. will jointly build up a nickel plant in Cuba with its Cuban partner. The new production facilities there is expected to largely increase Cuba’s present nickel production of 75,000 tons/year. According to the agreement, China will hold 49 per cent of the share with Cuba holding 51 per cent. In addi-

  6. NEWS

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    POLICY China set to restructure auto industry by mergers hina said it wanted to boost its auto industry by reducing the number of companies in the sector through mergers and promoting two or three carmakers to become the dominant players. The government's plans for auto industry reform were

  7. News

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Textile Industry Sees Signs of an Easing Decline Under the interaction of global economic recession and easingdomestic macro environment,Chinese textile industry is also facingthe unstable drive of two markets,overseas and domestic.

  8. NEWS

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    <正>A 1.2 Million Ton Alumina Project Started in Henan With RMB3 billion investment, a 1.2 million tons/year alumina project started construction recently in Dengfeng City, Henan province. The first phase of the project is expected to turn out 300,000 tons alumina/year, and with RMB1 billion investment for the first phase, production will begin in July next year. This project is invested jointly by Henan’s Wuzhou Aluminium Co. Ltd. and Dengdian Electricity Group Co.. The raw materials will all come from the low grade ores left by Chalco, and in Dengfeng there are some 70 million tons of such resources. Dengdian Group has 700,000 KW of electricity capacity and it will meet the project’s requirements for water, electricity, heat and other supplies.

  9. News

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    "蓝色"年代最新"Blue"车款潮流若以"Blue"为词根,衍生出频率最高的词组、语句会是什么?blue sky,blue sea,blueJazz,还是 blueberry?"Blue"通常寓意"蓝色"、"忧郁"、"蓝调",然而在汽车制造业,近年来却赋予了"Blue"一个新的意义:"环保"!各大厂商在争相推出"Blue"技术,如Bluetec、BlueMotion 之后,便开始了新的"环保战役"。

  10. News

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    China Textile&Apparel Export Rebounds With the recovery of global economy,and the low base number of last year’s export,as well as the export product price rising droven by raw material price increase,the export of textile and apparel products turned to rebound in first half.

  11. News

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Textile & Garment Trading Volume Up 5.9% in Canton Fair Upon the closing of The 106th Canton Fair,the organizer reported 5.9% growth of the textile & garment trading volume.It is always regardes as a signal that the worst time for textile & garment industry has passed.Nevertheless, the break point might come at the mid of 2010 since the whole situation is still under recovery.

  12. News

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    RMB settlement of cross-border trade broaden to the whole nation e Central Bank revealed on Aug.23, Circular on Broaden RMB settlement of Cross-Border Trade to the Whole Nation, jointly released by Central Bank, Ministry of Finance,Ministry of Commerce, General Administrations of Customs, State Administration of Taxation and Banking Regulatory Commission, clearly defined that enterprises from Hebei,

  13. News

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    17th China International Trade Fair for Apparel Fabrics & Accessories Shanghai closes The 17th China International Trade Fair Fabrics & Accessories was held in Shanghai new international exhibition center from October 18~21. China is a big power for textile production and manufacturing, also

  14. News

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    Three Textile Exhibitions Open in Shanghai Intertextile Shanghai Home Textiles,and The 4th China Inter-national Knitting Trade Fair,and China International Trade Fair for Fibres and Yarns,is to open in Shanghai New International Expo Centre on 24-26 August 2010.

  15. News

    Science.gov (United States)

    2008-11-01

    Particle Physics: LHC switch-on inspires pupils Science Fair: Science takes centre stage in Spain Conference: Czech and Slovak physicists get together Curriculum: UK needs independent curriculum body Conference: Edmonton enjoys a physics-show treat

  16. News

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    PMI index down,the downward trend of economic growth continued China Federation of Logistics and Purchasing released November China’s Manufacturing Purchasing Managers Index(PMI) on December1,which indicated that the

  17. News

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Chinese creativity blooms in Paris Following the event of"China in Paris·Unbounded Chinese Contemporary Creativity Night"show,which was listed in the official release schedule of Paris Fashion Week and held successfully in March

  18. News

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Textile Exporters Report Profit Shrinking in First Four Monthse Ministry of Industry & Infor-mation Technology recently released China Industry Economic Operation Report 2011 Spring Edition, whichestimated the steady growth of con-sumer product industry in the future.From Jan. to Apr, the industrialadded value of statistics-worthy con-sumer product industry rose 14.2%;that’s 1.4 percentage points lowerfrom a year ago. Of which, the pace

  19. NEWS

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    <正>Metal Scrap Imports Reached 6.5 Million tons in 2005 Information from a forum held recently in Guangzhou showed that in 2005, China’s imports of scrap metals reached 6.5 million tons, accounting for about one third of the world scrap metals trade and China has become the largest importer country of scrap

  20. News

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    Textile & Clothes Orders Reach $4.56 Billon in Three Days Raw Material Prices Soaring Impact Canton Fair Leading by the cotton price, al-most all the textile and clothes raw material prices kept rising, which

  1. NEWS

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Policy, standard, regulationl Administration program for environmental protection during the 11th five-year collecting comments The State Environmental Protection Administration has recently issued the draft document for comments. The program is expected to form a framework and establish the policies for the period 2006-2010.

  2. News

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    T300 Carbon Fiber Technique Made Breakthrough Zhongfu Shenying Carbon Fiber&Key Equipment Program Completed CNTAC organized a technology achievement appraisal meeting in Lianyungang for the program of R&D of Annu

  3. NEWS

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    East China Fair Revealed Encouraging Trading Volume The just closed 20th East China Fair revealed that the trading volume reached 2.733billion USD in the fi ve days session,up21.95% from same period last year.Both the trading volume and visitor numbers implied that the foreign trade was recovering.

  4. News

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    China Sees First Quarterly Trade Deficit in 6 Years, Textile & Clothes Trade Remains Surplus China saw a trade deficit of 1.02 billion U.S. dollars from January to March this year, the fir st quarterly trade

  5. NEWS

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    <正>China’s Unfavorable Trade Status in Nonferrous Metals As one of the major nonferrous metals trading country in the world, China’s influence over the international nonferrous metals market is further enhanced. China’s import of primary aluminium last year reached 545,000 tons, up by 101.5 per cent year-on-year, and China’s export of the metals exceeded one million tons,

  6. News

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>Policy,standard,regulation China says to raise tax on big cars China’s cabinet agreed in principle to raise the consumption tax on cars with large engines to help save energy,the government said recently.

  7. NEWS

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    <正>仪式·合作Ceremony&Cooperation海航集团捐赠中国公安民警英烈基金会和海地地震灾区HNA Donates to the Foundation for China Heroic Policeman Martyrs and Haiti Earthquake Disaster2010年1月18日10:00,海航集团向中国公安民警英烈基金会和海地地震灾区捐赠仪式在海航大厦四楼会议室举行。仪式开始前,全体人员起立默哀,向逝去的8名烈士和在地震中

  8. News

    Science.gov (United States)

    2003-11-01

    Resources: Online schools video library GIREP Seminar: A seminar not a conference New Teaching Resource: Free living for teachers Space: NASA proposes MEER - Momentum Exchange Electrodynamic-Reboost Electronic Teaching Materials: Superconductivity motivates need for upper secondary curriculum subjects Gifted and Talented: Seminars seek challenges Space: Comet chasing Particle Physics: Playing with single electrons Physics on Stage: Teachers explore the meaning of life Physics on Stage: Greek national event Physics on Stage: Physics on the Slovak stage Physics on Stage: Clubbing in Germany Physics on Stage: The Sun's star performance Higher Education: Physics: so refreshing USA: Broadening the Base AAPT Summer Meeting: US teachers in good form Astronomy: High school astronomy in the Czech Republic Space: Express to Mars Particle Physics: Journey to the centre of the Earth? ASE 2004: Flight from the ASE Physics Songs: A powerful melody Teacher Training: European training looks for ideal model

  9. NEWS

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    "The twelfth ve-year plan" industrial transformation and upgrading plan released Textile industry was included in the key industries of reformRecently, the State Council officially released "industrial transformation and upgrading plan (2011-2015).

  10. News

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    "12 five-year plan" Industrial Technology Innovation Plan released"12 five-year plan" Industrial Technology Innovation Plan was released by Ministry of Industry and Information Technology on November 14,clearing the objec-tives and priorities of industrial

  11. NEWS

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Policy,standard,regulation China to enact a rule on inside car pollutants The first of its kind in China may come by the year end, an official at Beijing Municipal Labor Protection Research Institute said recently.

  12. News

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    MOC Plans New Rule for Retail Business The access fee into supermarkets and department stores pushes flat prices and damage the interest of suppliers. Yao Jian, the spokenman of Ministry of Commerce said in a recent press conference that the MOC was drafting some rules to regulate this market

  13. NEWS

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Policy, standard, regulation The NDRC sets 15 preconditions for new energy vehicles Administrative rules for the production entry have appeared on the website of the NDRC. Fail of any one of the 15 preconditions may lead to the elimination of the total project.

  14. NEWS

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    <正> Cable Industry Expected toConsume 1.7 Million Tons ofCopperAccording to industry experts,total turn over ofChina’s wire and cable industry will exceedRMB 160 billion by 2005,and the totalconsumption of copper is estimated to reach 1.7million tons.In 2002,the total output value ofChina’s cable industry was RMB 123.6 billionwhile the total sales revenue of the industrywas RMB 114.3 billion.2002 also saw aconsumption of 1.4 million tons of copper byChina’s cable industry,accounting for about 60percent of the total consumption of copper inthe domestic market.

  15. NEWS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    <正>Chalco Enters Agreement with Vietnam on Bauxite Project During a State visit to Vietnam headed by China’s President Hu Jintao, Xiao Yaqing, Chairman and CEO of China Aluminium Corp. (Chalco) signed an agreement with his Vietnamese counterpart on the development of a bauxite project in Vietnam. Top officials of the two countries attended the signing ceremony in Hanoi. This project is known to be the largest one between the two countries up to present and it is taken by leaders of both countries as an important progress in promoting the bilateral relations in economy and trade.

  16. News

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    2010 Intertextile Shanghai Apparel FabricsTrade Fair to Open Intertextile Shanghai Apparel Fabrics, the most important textile trade fair in the world, is to open for four days from 19 October 2010 at the Shanghai New International Exhibition Centre. Nearly 2,500 industry suppliers from 20 coun- tries and regions including Austria, Belgium, China,

  17. NEWS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    <正>New Zinc Smelter Started Running Out of Improved Market On July 1st, Huludao Nonferrous Metals Group Corp. launched its zinc production at a new smelter, and meanwhile another line with 50,000 tons annual capacity also restarted after five years of idling. The group’s zinc smelting capacity was originally designed for 130,000

  18. News

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Pension given to quake-hit staff After the severe earthquake struck southwestern China’s Sichuan province on May12, the China International Exhibition CenterGroup Co.,Ltd (CIEC) made immediate effortsto aid the quake-hit regions. More than 400,000yuan were donated by the group to the quake-devastated regions.

  19. NEWS

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>Policy,standard,regulation Eco-friendly cars to get policy support in China Favorable policies that support the development of new energy vehicles are expected to come out this year,an insider from the China Association of Automobile Manufacturers was quoted as saying.

  20. News

    Science.gov (United States)

    2001-01-01

    Wales: Dataloggers network teachers 11-16 Science: Educational magazines with the fun bits left in! Institute of Physics: Public Awareness of Physics Awards Events: TeachSpace 2001 Australia: Chemistry and Physics in Tasmanian Agriculture Resources: From out of this world, into your lab Nobel Prize: Nobel Prize in Physics, 2001 China: Physics education for the 21st century: avoiding a crisis Resources: The Royal Astronomical Society Forthcoming Events

  1. News

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    High-tech Prop up National Flag in Tian’anmen Square During the 60th National Day Ceremony,thousands of national flags are going to fly over the streets.They are all manufactured by an exclusive producer,Beijing Red Flag Co.,Ltd.

  2. NEWS

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Policy, standard, regulation The NDRC discontinues second-group failed passenger vehicle models The National Development and Reform Committee has recently announced the latest fuel consumption level data of passenger cars on its website.

  3. News

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    China Fashion Week 2011 Spring/Summer Concluded The nine-day China Fashion Week 2011 Spring/Summer concluded successfully in Beijing Hotel on Nov. 1st. The overall level of Chinese designers have obvious

  4. News

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    2008/2009 China Top 500 Textile & Apparel Competitiveness Enterprises 2008/2009 China Top 500 Textile & Apparel Competitiveness Enterprises List was published on Aug. 8th in Guangzhou by China National Textile & Apparel Council.

  5. NEWS

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    The 3rd Textile Entrepreneurs Survey:Economic Situation Turns to Better,Confidence Returns To follow the situation of textile enterprises, and learn the confidence of entrepreneurs on their business, China Textile Entrepreneur Association

  6. News

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    China Apparel Retail Sales Value+24.6%Y/Y in H1 The year-on-year growth of sales value remained stable According to the State Statistics Bureau,in the first half of 2011,the retail sales value of textile products including clothing,shoes,hats for

  7. News

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Shandong Ruyi: Pioneer in Energy-saving & Emission-reductionRuyi Dyeing & Printing Co., Ltd., a subsidiary of Shandong Ruyi Group, is awarded as the pioneer in energy-saving and emission-reduction in the dyeing industry by Shandong Textile

  8. NEWS

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    <正>A China Invested Zinc Mine in Mongolia will Start Operation A zinc mine invested by China Nonferrous Metals Construction Group Corp. Ltd. in Mongolia is expected to go into operation in August this year. Based on a report, this zinc mine is the first overseas project developed by the company and also the largest one invested by a Chinese company in Mongolia. The project is built through compensation trade with the mine products for paying back the cost of construction. China has acquired 51 per cent of the shares for this project.

  9. News

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    Investment in Textile Industry Kept Growth in Jan.-Apr. With the favorable policy support and the drive of domestic market demand, the investment in textile industry accumulated to 81.673 billion USD from Jan. to Apr. , up 19.95% year over year. The growth

  10. NEWS

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    OTEXA: Imports from China Kept Growth According to the latest data from OTEXA of the US,the import of Chinese textiles reached 4.202 billion USD from Jan.to Mar.this year,up 26.13% from same period last year.The growth trend was continuing.

  11. News

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    CNTAC decided on the 9th batch of featured Textile Production Bases China National Textile and Appar-el Council (CNTAC) newly selected 23 cities or towns as the 9th batch of Textile Production Bases at the Great

  12. News

    Science.gov (United States)

    2001-11-01

    IRELAND New courses for high-tech Ireland; SCIENCE YEAR Science Year launched with a jump; THE NETHERLANDS School science teachers face uncertainty; KOREA Embedding physics in a cultural context; TEACHING RESOURCES Teacher, get your hook; ICT RESOURCES Stock-take of ICT progress; INTERNET Teachers to test-drive new physics gateway; NEW ZEALAND Physics is valued in New Zealand; JAPAN Advancing Physics in Japan; HIGHER EDUCATION Networking works in Cologne; INSTITUTE MATTERS IoP demands a better deal for physics teachers; AUSTRALIA Physics numbers decline: educators blame the low impact curriculum; SCIENCE FOR THE PUBLIC More than sixty seconds in Glasgow; INTERNET A gift selection of papers from IoP; TEACHING STYLES I know what you did last summer;

  13. News

    Science.gov (United States)

    1998-04-01

    Nearly Complete Set: I have an almost complete set of J. Chem. Educ., lacking only 3-4 volumes from the early 1930's. It is in pristine condition, bound each year (except the last five years), and used gently only by myself. I am retired and willing to part with this collection for a reasonable offer - I cannot afford to donate them. Any library or individual who might have a serious interest should contact Robert Goldenberg, P. O. Box 412, Westside Station, Buffalo, NY 14213; phone: 905/871-1098; email: goldenbe@vaxxine.com.

  14. NEWS

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Cotton prices where to go after purchase and reserve end April,this year’s cotton purchasing and reserve work came to an end,the policy factors that support cotton prices weakened. For some time,how the cotton price will change has become the focus of widespread concern of the industry.

  15. NEWS

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>Policy, standard, regulation Shanghai to curb government car use to save energy Thousands of government vehicles in Shanghai will be taken off the roads for at least one day each week from the first day of November, the local government recently announced.

  16. NEWS

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Policy, standard, regulation Shanghai to enact local standards on small cars The technical condition document (DB31/T390-2007) takes effect on Dec 1, 2007. The standard is in fact a threshold for small cars sold in Shanghai.

  17. NEWS

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>Policy, standard, regulation Chongqing enacts China’s first local rule to govern the natural gas vehicle industry The administrative method is due to take effect on July 1, 2008. The legal process took the local authorities 3 years.

  18. NEWS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    <正>Zinc Smelter Ordered to Stop On River Contamination Hazard Zinc production at China’s Shaoguan Smelter is called for a halt recently due to an accident which has led to the serious pollution to a river in Guangdong province, South China. Based on a report by the environmental authorities, a recent checkup found that the water running in the smelter area has increased cadmium contamination. Initial studies showed that the cadmium content came from the waste water discharged by the smelter during a period of equipment maintenance. This water contamination case is considered by the environmental control authorities as a serious pollution case in the area for breaking the related environmental protection laws and regulations.

  19. NEWS

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Jack 8th China National Garment Brand Annual Awards announced March 25,Jack The 8th China National Garment Brand Annual Awards Presentation Ceremony held at the Beijing Century Theatre. 9 awards of Chinese clothing were unveiled,namely they are: brand style,innovation potential,quality,planning,marketing,public,value,achievements as well as other special awards such as: promote,support,clothing,manufacturing,commercial.

  20. NEWS

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Mercedes-Benz China Fashion Week concludedIn the evening of November 2nd, Mercedes-Benz China Fashion Week 2012 annual award ceremony, sponsored by WHITE COLLAR (a famous women’s apparel brand),was held in Beijing hotel golden hall.

  1. News

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    China to Raise Export Tax Rebates for Textile,Garment Products China is raising tax rebates for certain exports to help producers cope with smaller profit margins as a result of slacking market demand,the yuan’s appreciation and rising production costs.

  2. News

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Major Export Markets Going Up in Frist Four Months According to Customs Data,the export of textile and clothing accumulated to 70.255 billion USD in first four months,rising 27.05% from the same period last year.

  3. TERRA NEWS: Sensationalism and Fait-divers on the Internet

    OpenAIRE

    Carlos Golembiewski; Diógenes Pandini

    2009-01-01

    This article presents an analysis of the news program Jornal do Terra (Terra News) shown on the Terra website. The study involved two aspects: forms of news presentations on TV, based on studies by Pedro Maciel, and criteria of news value, based on Mário Erbolatto’s view. In addition, we used Luis Arthur Ferraretto’s studies of the news formats used specifically on the radio. The objective of this work was to verify what kind of news is transmitted by the news p...

  4. Breaking bad news in cancer patients

    Directory of Open Access Journals (Sweden)

    Apostolos Konstantis

    2015-01-01

    Full Text Available Objective: In a regional hospital, many patients are newly diagnosed with cancer. Breaking the bad news in these patients and their relatives is a tough task. Many doctors are not experienced in talking to patients about death or death-related diseases. In recent years, there have been great efforts to change the current situation. The aim of this study was to investigate the experience and education of medical personnel in breaking bad news in a secondary hospital. Materials and Methods: 59 doctors from General Hospital of Komotini, Greece were included in the study. All the doctors were in clinical specialties that treated cancer patients. A brief questionnaire was developed based on current guidelines such as Baile/SPIKES framework and the ABCDE mnemonic. Results: Residents are involved in delivering bad news less frequently than specialists. Only 21 doctors (35.59% had specific training on breaking bad news. 20 doctors (33.90% were aware of the available techniques and protocols on breaking bad news. 47 doctors (79.66% had a consistent plan for breaking bad news. 57 (96.61% delivered bad news in a quiet place, 53 (89.83% ensured no interruptions and enough time, 53 (89.83% used simple words and 54 (91.53% checked for understanding and did not rush through the news. 46 doctors (77.97% allowed relatives to determine patient′s knowledge about the disease. Conclusions: There were low rates of specific training in breaking bad news. However, the selected location, the physician′s speech and their plan were according to current guidelines.

  5. Operation Method for AC Motor Control during Power Interruption in Direct AC/AC Converter System

    Science.gov (United States)

    Shizu, Keiichiro; Azuma, Satoshi

    Direct AC/AC converters have been studied due to their potential use in power converters with no DC-link capacitor, which can contribute to the miniaturization of power converters. However, the absence of a DC-link capacitor makes it difficult to control the AC motor during power interruption. First, this paper proposes a system that realizes AC motor control during power interruption by utilizing a clamp capacitor. In general, direct AC/AC converters have a clamp circuit consisting of a rectifier diode(s) and a clamp capacitor in order to avoid over-voltages. In the proposed system, there is an additional semiconductor switch reverse-parallel to the rectifier diode(s), and the clamp capacitor voltage can be utilized for AC motor control by turning on the additional switch. Second, this paper discusses an operation method for AC motor control and clamp capacitor voltage control during power interruption. In the proposed method “DC-link voltage control”, the kinetic energy in the AC motor is transformed into electrical energy and stored in the clamp capacitor; the clamp capacitor is therefore charged and the capacitor voltage is controlled to remain constant at an instruction value. Third, this paper discusses a switching operation during power interruption. A dead-time is introduced between the operation of turning off all switches on the rectifier side and the operation of turning on the additional switch, which prevents the occurrence of a short circuit between the interrupted power source and the clamp capacitor. Finally, experimental results are presented. During power interruptions, an output current was continuously obtained and the clamp capacitor voltage was maintained to be equal to the instruction value of the capacitor voltage. These results indicate that both AC motor control and capacitor voltage control were successfully achieved by using the proposed system.

  6. The news machine hacking, the untold story

    CERN Document Server

    Hanning, James

    2014-01-01

    There is one mystery figure at the heart of ?Hackergate' ? Glenn Mulcaire, the News of the World's top private investigator. The former AFC Wimbledon footballer has never spoken publicly or in court about his work investigating and backing up front-page news stories (such as the News of the World's award-winning David Beckham scoop). Mulcaire's arrest in 2006 for intercepting royal-household phone messages barely registered at the time. Yet his work has continued to generate headlines and embarrassment for the establishment ? with a Prime Minister on the back foot after his former aide Andy

  7. Data Exchanges in Mobile News Apps

    DEFF Research Database (Denmark)

    Kammer, Aske; Wallberg, Filip

    2016-01-01

    This paper maps the flows of data to and from third-party actors when users access content in mobile news apps. This way, it analyzes the strategic networks of collaboration and data exchange that news organizations engage in in the digital economy, expanding the traditional two-sided model...... data from the app use. It compares central news apps across six Western democracies (Denmark, Germany, Italy, Portugal, the UK, and the USA) in order to examine whether media-systemic features (Hallin & Mancini, 2004) and privacy legislation influences data exchanges....

  8. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  9. The Interaction of Production and Consumption in the News Media Social Space

    Science.gov (United States)

    Graham, Gary; Kerrigan, Finola; Mehmood, Rashid; Rahman, Mustafizur

    Newspapers are operating in increasingly competitive and fragmented markets for audiences and advertising revenues, government media policy and changing audience requirements for news and the ways in which it is presented and delivered. A growing army of bloggers and amateur citizen journalists now delivers - but rarely edits - content for all media platforms, while new media technologies, combined with the changing structure of global news industries, are radically changing the ways in which newspapers and media business functions and struggles for profitability. Our research sought to answer the question of how the internet is impacting on producer/consumer value activities in the news media supply chain. To answer this question initial descriptive statistical analysis was performed on 51 newspapers. This was followed by a focus group undertaken with London-based news media organizations and bloggers. The findings showed that in spite of initial fear and rejection, the internet is now firmly embedded in news media supply chain operations. Firms are now using the internet as an operant resource and working proactively with consumers to develop various forms of relationship value. We highlight the role of consumers in the creation of news (editorial) content and consumer-driven moves toward a merged media platform of distribution (including television, online, mobile and printed forms). Regional news media organizations will probably continue to survive if they are able to supply a highly specialized and 'hyper local' community service. This will be in the form of 'hybrid' content: analysis, interpretation and investigative reporting in a print product that appears less than daily combined with constant updating and reader interaction on the web.

  10. Organization of the News Industry

    DEFF Research Database (Denmark)

    Vang, Jan

    2003-01-01

    In this paper the two canonical theories of the firm - transaction costs economics and theknowledge-based view of the firm - predictions on `make-or-buy' are tested on the newsindustry. The news industry provides an interesting case on which to test the two theories sinceit is characterized...... by a high degree of urgency. Urgency refers to the need to catch and processinputs fast. A tendency that is becoming more widespread in other industries where theproduction cycle tends to be reduced. The test is don on original data on the newspaper industrycollected by the author. The conclusions drawn...... are that that newspapers are organized differentlythan is predicted from the knowledge-based view of the firm and transaction cost economics.The newspapers do no specialize in core competencies measured in terms of topics covered. Onthe contrary, a precondition for outsourcing is well-developed competencies in house...

  11. A good news or bad news has greater impact on the Vietnamese stock market?

    OpenAIRE

    Nguyen, Phuong

    2015-01-01

    The arrival of news plays an extremely important role in the stock market because it mainly drives the movement of the stock market. In this paper, therefore, we would like to investigate how the Vietnamese stock market responses to the arrival of news via applying the AR – EGARCH in Mean model. Our research result indicates that the arrival of bad news has a greater impact on the conditional volatility than the arrival of good news does. We also found that there exists a positive tradeoff be...

  12. INVISIBLE GIANTS IN BROADCAST JOURNALISM: news agencies and the global news ecosystem

    Directory of Open Access Journals (Sweden)

    Maria Cleidejane Esperidião

    2011-06-01

    Full Text Available Key actors of the global informational web, the international television news agencies are not often covered in the communications field in Brazil. This paper aims to understand the dynamics established between these transnational companies and their subscribers (world television stations. It attempts to clarify how these western-led news agency companies operate within the flow of communication. It intends to identify production processes (assessment, collection, treatment and radial distribution for the Associated Press Television News (APTN and Reuters Television News (Reuters TV.

  13. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Energy Technology Data Exchange (ETDEWEB)

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  14. The New News Media: Democratic implications of undergraduate education and news consumption over social and traditional media

    OpenAIRE

    Miller, Jennifer

    2013-01-01

    Communication students at Simon Fraser University were surveyed and interviewed to deduce perceptions and behaviour of news consumption over social and traditional media. Both social media and traditional media are used to consume news with traditional media acting as the primary news source and as more accessible and reliable than social media. News stories considered important or having various perspectives were verified the most, especially world news. Extent of accessibility of sources an...

  15. Nuclear Malaysia in the news 2008

    International Nuclear Information System (INIS)

    Nuclear was a term that always misunderstood by public as a terrifying term. Nuclear activities around Malaysia were disseminated in newspaper and Malaysian Nuclear Agency as a responsible agency were collecting that news and compiled them. The purpose for this compilation were to make the public aware the benefits of nuclear energy and all the activities regarding nuclear surround them. All the news about nuclear technology were collected using various type of newspaper published in Malaysia such as Utusan Malaysia, Berita Harian, Daily Express, News Straits Time, The Star, Borneo Post and others. This news was compiled according to their main topics such as energy, nuclear in agriculture, education and others. Each year one edition of this report will publish and disseminate it to the other libraries, government agencies, school and others to make the public aware the existence of nuclear activities around their countries.

  16. The Electronic Archiving of Arab News Agencies

    Directory of Open Access Journals (Sweden)

    Haifa Ayub Gigawy

    2007-03-01

    Full Text Available This Research aims to present the electronic archives of Arab news agency websites and their methods of searching for and retrieving information. Also, its aim is to examine all their methods in order to find out which are the best and most practically useful ones. The research refers to the news agencies and the Internet, through the methods that users encounter in these inquires and links which present information. It concentrates on practical ways of searching for news items in both texts and pictures. The research contains tables showing the results. It presents a brief summery for each of Arab news agencies.The research comes to the conclusion that there are many things which need to be considered, and also some suggestions as to how the search for and retrieval of information might be improved

  17. Nuclear Malaysia in the news 2010

    International Nuclear Information System (INIS)

    Nuclear was a term that always misunderstood by public as a terrifying term. Nuclear activities around Malaysia were disseminated in newspaper and Malaysian Nuclear Agency as a responsible agency were collecting that news and compiled them. The purpose for this compilation were to make the public aware the benefits of nuclear energy and all the activities regarding nuclear surround them. All the news about nuclear technology were collected using various type of newspaper published in Malaysia such as Utusan Malaysia, Berita Harian, Daily Express, News Straits Time, The Star, Borneo Post and others. This news was compiled according to their main topics such as energy, nuclear in agriculture, education and others. Each year one edition of this report will publish and disseminate it to the other libraries, government agencies, school and others to make the public aware the existence of nuclear activities around their countries.

  18. News Media Framing of Negative Campaigning

    DEFF Research Database (Denmark)

    Pedersen, Rasmus Tue

    2014-01-01

    News media coverage of election campaigns is often characterized by use of the strategic game frame and a focus on politicians’ use of negative campaigning. However, the exact relationship between these two characteristics of news coverage is largely unexplored. This article theorizes that consumer...... demand and norms of journalistic independence might induce the news media outlets to cover negative campaigning with a strategic game frame. A comprehensive content analysis based on several newspaper types, several election campaigns, and several different measurements of media framing confirms...... that news coverage of negative campaigning does apply the strategic game frame to a significantly larger degree than articles covering positive campaigning. This finding has significant implications for campaigning politicians and for scholars studying campaign and media effects....

  19. Multimodal Indexing of Multilingual News Video

    Directory of Open Access Journals (Sweden)

    Hiranmay Ghosh

    2010-01-01

    Full Text Available The problems associated with automatic analysis of news telecasts are more severe in a country like India, where there are many national and regional language channels, besides English. In this paper, we present a framework for multimodal analysis of multilingual news telecasts, which can be augmented with tools and techniques for specific news analytics tasks. Further, we focus on a set of techniques for automatic indexing of the news stories based on keywords spotted in speech as well as on the visuals of contemporary and domain interest. English keywords are derived from RSS feed and converted to Indian language equivalents for detection in speech and on ticker texts. Restricting the keyword list to a manageable number results in drastic improvement in indexing performance. We present illustrative examples and detailed experimental results to substantiate our claim.

  20. Nuclear Malaysia in The News 2015

    International Nuclear Information System (INIS)

    Nuclear was a term that always misunderstands by public as a terrifying term. The nuclear activities around Malaysia was disseminated in newspaper and Malaysian Nuclear Agency as a responsible agency for nuclear for peace were collecting that news and compiled them to make the public aware the benefits of nuclear energy to develop our country. All the news about nuclear were collected using various type of newspaper published in Malaysia such as Utusan Malaysia, Berita Harian, Daily Express, News Straits Time, The Star, Borneo Post and others. This news was compiled according to their main topics such as energy, nuclear in agriculture, education and others. Each year one edition of this report will publish and disseminate it to the other libraries, government agencies, school and others to make the public aware the existence of nuclear activities around their countries.

  1. Nuclear Malaysia in the news 2011

    International Nuclear Information System (INIS)

    Nuclear was a term that always misunderstood by public as a terrifying term. Nuclear activities around Malaysia were disseminated in newspaper and Malaysian Nuclear Agency as a responsible agency were collecting that news and compiled them. The purpose for this compilation were to make the public aware the benefits of nuclear energy and all the activities regarding nuclear surround them. All the news about nuclear technology were collected using various type of newspaper published in Malaysia such as Utusan Malaysia, Berita Harian, Daily Express, News Straits Time, The Star, Borneo Post and others. This news was compiled according to their main topics such as energy, nuclear in agriculture, education and others. Each year one edition of this report will publish and disseminate it to the other libraries, government agencies, school and others to make the public aware the existence of nuclear activities around their countries.

  2. The shifting cross-media news landscape

    DEFF Research Database (Denmark)

    Schrøder, Kim Christian; Steeg Larsen, Bent

    2010-01-01

    and lifestyles. Theoretically the study is anchored in Habermas’s notion of the public sphere, and its recent reconceptualizations in theories of ‘cultural citizenship’, 'civic agency' and 'public connection'. The project operationalizes these theories through the concept of users' perceived “worthwhileness......” of news media, a user-anchored concept which incorporates the different functionalities of the situational cross-media use of news by citizen/consumers in everyday life. Empirically the article presents the findings of a large-scale survey that traces the imminent challenges facing players in the news...... market, as a consequence of accelerating divisions between 'overview' and 'depth' news media (across print, broadcasting and the internet). The project is carried out in a partnership of university-based researchers and analysts from one of the major newspaper publishers in Denmark, and presents...

  3. Nuclear Malaysia in the news 2012

    International Nuclear Information System (INIS)

    Nuclear was a term that always misunderstood by public as a terrifying term. Nuclear activities around Malaysia were disseminated in newspaper and Malaysian Nuclear Agency as a responsible agency were collecting that news and compiled them. The purpose for this compilation were to make the public aware the benefits of nuclear energy and all the activities regarding nuclear surround them. All the news about nuclear technology were collected using various type of newspaper published in Malaysia such as Utusan Malaysia, Berita Harian, Daily Express, News Straits Time, The Star, Borneo Post and others. This news was compiled according to their main topics such as energy, nuclear in agriculture, education and others. Each year one edition of this report will publish and disseminate it to the other libraries, government agencies, school and others to make the public aware the existence of nuclear activities around their countries.

  4. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  5. Mapping the International: Global and Local Salience and News-Links Between Countries in Popular News Sites Worldwide

    Directory of Open Access Journals (Sweden)

    Elad Segev

    2010-01-01

    Full Text Available What countries get more online news attention around the world? The following paper compares 35 popular news sites in 10 different languages in order to assess the salience of countries in different news topic, their level of self-occupation, their news-links with other countries and their network configuration during a period of six months between February and July 2009. Based on special text-mining tools developed by the author for this purposes, it offers new indices, measurements, and techniques to portray the world perceived by news sites in different countries. Supporting previous observations on newspapers and traditional media, findings indicate that there is a strong correlation between the economic power of a country and its online news salience. The U.S. is by far the most salient country in popular news sites around the world. Middle-Eastern countries receive particularly high attention in world news, Asian countries in business and technology news and European countries in cultural news. Countries with higher political, economic, or social instabilities tend to be more self-occupied in their news. The networks of news-links within different countries display three different structures: centralized networks presented by American and French news sites, two-hub networks presented by most European and Asian news sites, and decentralized networks presented by Middle-Eastern news sites. The implications of these findings are discussed.

  6. News media consumption among immigrants in Europe

    DEFF Research Database (Denmark)

    Christiansen, Connie Carøe

    2004-01-01

    In recent years, especially with the advent of Digital Broadcasting Technology, transnational media has become central in the consumption of news by immigrant populations. This has received some attention as a factor associated with lack of integration into their new societies. The present articl...... international news than is currently the national television channels, are also part of the picture. A diaspora perspective transforms the prospect presented by observers and journalists, worried about integration processes, and prompts considerations that immigrants are also emigrants....

  7. STOCK TREND PREDICTION USING NEWS SENTIMENT ANALYSIS

    Directory of Open Access Journals (Sweden)

    Kalyani Joshi

    2016-06-01

    Full Text Available Efficient Market Hypothesis is the popular theory about stock prediction. With its failure much research has been carried in the area of prediction of stocks. This project is about taking non quantifiable data such as financial news articles about a company and predicting its future stock trend with news sentiment classification. Assuming that news articles have impact on stock market, this is an attempt to study relationship between news and stock trend. To show this, we created three different classification models which depict polarity of news articles being positive or negative. Observations show that RF and SVM perform well in all types of testing. Naïve Bayes gives good result but not compared to the other two. Experiments are conducted to evaluate various aspects of the proposed model and encouraging results are obtained in all of the experiments. The accuracy of the prediction model is more than 80% and in comparison with news random labelling with 50% of accuracy; the model has increased the accuracy by 30%.

  8. Focal Points on Constructing News Stories

    Directory of Open Access Journals (Sweden)

    Elena Yuryevna Ilyinova

    2015-11-01

    Full Text Available The issues stated in the article line with the current interest to pragmatic value of news releases in modern media. The news is thought to be a verbalized focal reflection of some event that was chosen by media professionals for setting the current information agenda. Having generated the opinions on the newsworthiness the authors present a set of values that may be used for measurement of relevance and clarity of an event reflection in the news content with frequency, clarity, predictability, unexpectedness, amplitude, cultural proximity, elite nations, elite people, personification, negativity among them. The novelty of the research is that the newsworthiness is checked with the focus to lexical (thematic representation of the news in a diachronic approach: the empirical base of the research was taken from the archives of UK national and local media sources (18–20th cent. and implied comparison of lexical means that reflected an event itself and some values of human interest potential in the news stories written in defined periods. The article states the trend for dynamics in the way the event is reflected in the news stories – the information core of the story is merged with detailed reporting parts, and their content is conditioned by social and moral values.

  9. New York Times Current News Physics Applications

    Science.gov (United States)

    Cise, John

    2010-03-01

    Since 2007 I have been using NYTimes current News articles rich in graphics and physics variables for developing edited one page web (http://CisePhysics.homestead.com/files/NYT.htm) physics questions based on current events in the news. The NYTimes home page listed above contains currently ten pages with about 40 one page current edited News related physics articles per page containing: rich graphics, graphic editions by the author, edited articles, introduction to a question, questions, and answers. I use these web pages to introduce new physics concepts to students with current applications of concepts in the news. I also use these one page physics applications as pop quizzes and extra credit for students. As news happens(e.g. the 2010 Vancouver Olympics) I find the physics applications in the NYTimes articles and generate applications and questions. These new one page applications with questions are added to the home page: http://CisePhysics.homestead.com/files/NYT.htm The newest pages start with page 10 and work back in time to 9, 8, etc. The ten web pages with about 40 news articles per page are arranged in the traditional manner: vectors, kinematics, projectiles, Newton, Work & Energy, properties of matter, fluids, temperature, heat, waves, and sound. This site is listed as a resource in AAPT's Compadre site.

  10. News Portrayal of Cancer: Content Analysis of Threat and Efficacy by Cancer Type and Comparison with Incidence and Mortality in Korea.

    Science.gov (United States)

    Shim, Minsun; Kim, Yong-Chan; Kye, Su Yeon; Park, Keeho

    2016-08-01

    How the news media cover cancer may have profound significance for cancer prevention and control; however, little is known about the actual content of cancer news coverage in Korea. This research thus aimed to examine news portrayal of specific cancer types with respect to threat and efficacy, and to investigate whether news portrayal corresponds to actual cancer statistics. A content analysis of 1,138 cancer news stories was conducted, using a representative sample from 23 news outlets (television, newspapers, and other news media) in Korea over a 5-year period from 2008 to 2012. Cancer incidence and mortality rates were obtained from the Korean Statistical Information Service. Results suggest that threat was most prominent in news stories on pancreatic cancer (with 87% of the articles containing threat information with specific details), followed by liver (80%) and lung cancers (70%), and least in stomach cancer (41%). Efficacy information with details was conveyed most often in articles on colorectal (54%), skin (54%), and liver (50%) cancers, and least in thyroid cancer (17%). In terms of discrepancies between news portrayal and actual statistics, the threat of pancreatic and liver cancers was overreported, whereas the threat of stomach and prostate cancers was underreported. Efficacy information regarding cervical and colorectal cancers was overrepresented in the news relative to cancer statistics; efficacy of lung and thyroid cancers was underreported. Findings provide important implications for medical professionals to understand news information about particular cancers as a basis for public (mis)perception, and to communicate effectively about cancer risk with the public and patients. PMID:27478333

  11. A Blind Angle? News Sources, Gender and Ethnicity in Danish TV News

    DEFF Research Database (Denmark)

    Fiig, Christina

    The paper will present and discuss a framework for grasping some of the democratic consequences of biased TV news programs. In line with Jürgen Habermas, one can ask what consequences it has for a democratic public sphere that the national TV news landscape is biased in term of source diversity...

  12. News reported on 30 November 1993 by the Middle East News Agency

    International Nuclear Information System (INIS)

    The document reproduces a letter dated 27 December 1993 from the Alternate Resident Representative of Iraq to the IAEA including in an annex the news reported on 30 November 1993 by the Middle East News Agency concerning the detection of nuclear radiations in Iraqi military equipment left behind by the Iraqi army during the war for Kuwait liberation

  13. Television News and Sexist Language: A Study of Television News Effects.

    Science.gov (United States)

    Gebhardt, Randall E.; Harless, James D.

    To test the hypothesis that use of sexist language in television newscasts cultivates images of women as immature, frivolous, or incompetent, two television news anchors (one male, one female) were asked to tape versions of a news story involving a 28-year-old female lottery winner. In one version, each anchor referred to this female as "woman,"…

  14. News From Nowhere: Sources of International News in the Pacific Islands.

    Science.gov (United States)

    Richstad, Jim; Nnaemeka, Tony

    A study was undertaken to examine the sources of international news in the Pacific Island press in the light of J. Galtung's structural theory of imperialism and to explore the relationship between the remoteness and isolation of the Pacific press and its sources of news. The Galtungian concepts of center-periphery and dominance-dependency were…

  15. The Virtuous All-News Radio Journalist: Perceptions of News Directors.

    Science.gov (United States)

    Wulfemeyer, K. Tim; McFadden, Lori L.

    To date, most of the scholarly research and critical articles about ethics in journalism have dealt with newspapers and television rather than with radio. To help fill this gap, a study surveyed a segment of the radio news community to determine some of the attitudes, values, and beliefs of news directors concerning ethics in their workplace.…

  16. Top medical news stories 2015

    Directory of Open Access Journals (Sweden)

    Robbins RA

    2015-12-01

    Full Text Available No abstract available. Article truncated after 150 words. Here is our list of the top seven medical news stories for 2015 with special emphasis on the Southwest. 7. Wearable health devices: A wave of wearable computing devices such as Fitbit and UP wristbands have people keeping track of how much they sit, stand, walk, climb stairs and calories they consume (1. These fitness-tracking devices herald a series of devices that will detect and monitor serious diseases. However, these so-called medical-grade wearables require approval from the U.S. Food and Drug Administration, a regulatory hurdle avoided by the fitness-tracking devices which will likely slow their introduction. 6. Caitlyn Jenner: Caitlyn Jenner became the most famous transgender woman in the world following an interview published in Vanity Fair (2. The Vanity Fair website saw 11.6 million visits curious about the former Olympic athlete. Though Jenner publicly shared her gender identity, many transgender Americans do not-12% of gender non-conforming adults said they ...

  17. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  18. Wordplay in English Online News Headlines

    Directory of Open Access Journals (Sweden)

    Roya Monsefi

    2016-03-01

    Full Text Available Within the endless stream of information available on the news media market, news headline language is characterised by several linguistic, pragmatic, rhetorical and functional features that distinguish it from other varieties of language that are not specialised. In the present study, the rhetorical features of English news headlines, through wordplay investigation, using a sample of 100 headlines were studied. Wordplay is investigated because it leads to the persuasiveness of message that is sometimes so subtle that the readers might not even recognise it. A taxonomy of wordplays was constructed according to Leigh’s (1994 model which made it possible to access a comprehensive checklist. The way the persuasive element, i.e. wordplay, was presented for the English headline readers was examined using the descriptive method and in light of textual rhetorical analysis. The outcome of the study suggests that English news headlines are likely to contain one or more clearly defined wordplay. The most frequent wordplay is that of tropes or more specifically metonymy. However, there are some wordplays such as polysyndeton, anadiplosis, antimetabole, epistrophe and polyptoton that are absent in English headlines. The majority of unused categories fall under the category of schemes.Keywords: wordplay, news headlines, schemes, tropes, rhetoric

  19. Modeling news dissemination on nuclear issues

    Energy Technology Data Exchange (ETDEWEB)

    Reis Junior, Jose S.B.; Barroso, Antonio C.O.; Menezes, Mario O., E-mail: jsbrj@ime.usp.b, E-mail: barroso@ipen.b, E-mail: mario@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    Using a modified epidemiological model, the dissemination of news by media agents after the occurrence of large scale disasters was studied. A modified compartmented model was developed in a previous paper presented at INAC 2007. There it used to study to the Chernobyl's nuclear accident (1986) and the Concorde airplane crash (2000). Now the model has been applied to a larger and more diverse group of events - nuclear, non-nuclear and naturally caused disasters. To be comprehensive, old and recent events from various regions of the world were selected. A more robust news repository was used, and improved search techniques were developed to ensure that the scripts would not count false positive news. The same model was used but with improved non-linear embedded simulation optimization algorithms to generate the parameters of interest for our model. Individual parameters and some specific combination of them allow some interesting perceptions on how the nature of the accident / disaster gives rise to different profiles of growth and decay of the news. In our studies events involving nuclear causes generate news repercussion with more explosive / robust surge profiles and longer decaying tails than those of other natures. As a consequence of these differences, public opinion and policy makers are also much more sensitive to some issues than to others. The model, through its epidemiological parameters, shows in quantitative manner how 'nervous' the media content generators are with respect to nuclear installations and how resilient this negative feelings about nuclear is. (author)

  20. Modeling news dissemination on nuclear issues

    International Nuclear Information System (INIS)

    Using a modified epidemiological model, the dissemination of news by media agents after the occurrence of large scale disasters was studied. A modified compartmented model was developed in a previous paper presented at INAC 2007. There it used to study to the Chernobyl's nuclear accident (1986) and the Concorde airplane crash (2000). Now the model has been applied to a larger and more diverse group of events - nuclear, non-nuclear and naturally caused disasters. To be comprehensive, old and recent events from various regions of the world were selected. A more robust news repository was used, and improved search techniques were developed to ensure that the scripts would not count false positive news. The same model was used but with improved non-linear embedded simulation optimization algorithms to generate the parameters of interest for our model. Individual parameters and some specific combination of them allow some interesting perceptions on how the nature of the accident / disaster gives rise to different profiles of growth and decay of the news. In our studies events involving nuclear causes generate news repercussion with more explosive / robust surge profiles and longer decaying tails than those of other natures. As a consequence of these differences, public opinion and policy makers are also much more sensitive to some issues than to others. The model, through its epidemiological parameters, shows in quantitative manner how 'nervous' the media content generators are with respect to nuclear installations and how resilient this negative feelings about nuclear is. (author)

  1. Measuring the Interestingness of News Articles

    Energy Technology Data Exchange (ETDEWEB)

    Pon, R K; Cardenas, A F; Buttler, D J

    2007-09-24

    An explosive growth of online news has taken place. Users are inundated with thousands of news articles, only some of which are interesting. A system to filter out uninteresting articles would aid users that need to read and analyze many articles daily, such as financial analysts and government officials. The most obvious approach for reducing the amount of information overload is to learn keywords of interest for a user (Carreira et al., 2004). Although filtering articles based on keywords removes many irrelevant articles, there are still many uninteresting articles that are highly relevant to keyword searches. A relevant article may not be interesting for various reasons, such as the article's age or if it discusses an event that the user has already read about in other articles. Although it has been shown that collaborative filtering can aid in personalized recommendation systems (Wang et al., 2006), a large number of users is needed. In a limited user environment, such as a small group of analysts monitoring news events, collaborative filtering would be ineffective. The definition of what makes an article interesting--or its 'interestingness'--varies from user to user and is continually evolving, calling for adaptable user personalization. Furthermore, due to the nature of news, most articles are uninteresting since many are similar or report events outside the scope of an individual's concerns. There has been much work in news recommendation systems, but none have yet addressed the question of what makes an article interesting.

  2. Warning: safety risk with some Apple AC Wall Plug Adapters

    CERN Multimedia

    CERN IT department

    2016-01-01

    Dear Mac and iOS Users, Apple has determined that some of its two prong Apple AC wall plug adapters may break and create a risk of electrical shock.   CERN users can now exchange their affected Apple wall plug adapters at the Service Desk. To find out if your adapter is affected and for any further information concerning the procedure to follow to exchange it, please check the following URL: https://cern.service-now.com/service-portal/view-outage.do?n=OTG0028639.

  3. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  4. Television News Uses: A Cross-National Comparison.

    Science.gov (United States)

    Levy, Mark R.

    1978-01-01

    Reports that a classification of television news uses and gratifications based on research in Leeds, England, did not adequately encompass the functions of television news for a United States audience. (GW)

  5. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  6. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  7. [Influence of the news media].

    Science.gov (United States)

    Camarena Luna, R

    1991-01-01

    Newspapers, in addition to news, also cover topics of permanent interest to their readers. One such topic is sexuality. The appearance of the incurable sexually transmitted disease AIDS obliges a reconsideration of the complex and contradictory concept of sexuality. Sexuality is not often spoken of openly; rather, it is secret, hidden, and referred to obliquely. Sexuality is the manifestation and satisfaction of the sexual impulses common to all individuals. Sexuality is determined by anatomic and physiologic aspects and also by the knowledge, experiences, values, and norms internalized by the individual living in a social group. Messages about sexual conduct are constantly being received. This social part of sexuality supported by customs and morals is the part that is directly influenced by communications media. An important objective of the media is to create awareness and mold opinions. Mexico's large national circulation newspapers present different points of view about sexuality. Newspapers that continually critique homosexual practices and those that demonstrate implicit approval of pornographic videos by advertising them both present attitudes without providing opportunities to reason, compare, or support opinions. Sexuality is usually referred to indirectly and superficially in the press. Sex education may be mentioned but not the erotic implications of sexuality, and acceptance or opposition to use of condoms may be discussed without mention of psychological barriers to their use. The national press is not prepared to propose new attitudes toward sexuality in the age of AIDS. Only 1 national newspaper in Mexico regularly provides information on AIDS including aspects related to sexual pleasure and responsibility and safer sex. The majority continue with their pre-AIDS coverage of sexuality, using it to arouse interest but providing little depth. Newspapers should provide more extensive coverage on sexuality and its modifications due to AIDS, a reality

  8. On the Strategies for Translating English News Headlines

    Institute of Scientific and Technical Information of China (English)

    Wang Chao

    2016-01-01

    A good headline can not only attract readers' attention and trigger their desire to read, but also help them grasp the main points. Thus, news headlines act as guides for readers to choose the information they need. Headlines play a peculiar and essential role in news reporting. In order to understand the headline well, it's better for us to know something about the features and translations of English news headlines. In this paper, the strategies of translation of English news headlines are introduced.

  9. From everyday communicative figurations to rigorous audience news repertoires

    DEFF Research Database (Denmark)

    Kobbernagel, Christian; Schrøder, Kim Christian

    2016-01-01

    repertoires from the ensemble of old and new media available. This article presents an innovative mixed-method approach with considerable explanatory power to the exploration of patterns of news media consumption. This approach tailors Q-methodology in the direction of a qualitative study of news consumption...... of six audience news repertoires in Denmark, also preserves the qualitative thickness of the participants’ verbal accounts of the communicative figurations of their day-in-the-life with the news media...

  10. Effective Mechanism for Social Recommendation of News

    CERN Document Server

    Wei, Dong; Cimini, Giulio; Wu, Pei; Liu, Weiping; Zhang, Yi-Cheng

    2011-01-01

    Recommendation systems represent an important tool for news distribution on the Internet. In this work we modify a recently proposed social recommendation model in order to deal with no explicit ratings of users on news. The model consists of a network of users which continually adapts in order to achieve an efficient news traffic. To optimize network's topology we propose different stochastic algorithms that are scalable with respect to the network's size. Agent-based simulations reveal the features and the performance of these algorithms. To overcome the resultant drawbacks of each method we introduce two improved algorithms and show that they can optimize network's topology almost as fast and effectively as other not-scalable methods that make use of much more information.

  11. A Comparative Study of News Sources in Sino-English News Reports Re-lated to Nobel Winner Mo Yan

    Institute of Scientific and Technical Information of China (English)

    徐莺

    2014-01-01

    News, by no means a neutral vehicle, is in reality ideologically driven and controlled by news values to which the use of news sources is of great help. Geis once argued that the single most important power of the press is its capacity to say what the important issues are at any particular time and to determine whose voices will be heard on any given issue (Geis, 1987:10). News sources may tell readers something, but it may also mislead readers since people cannot think about and make sense out of news events without imposing a bias on the news. It is, therefore, worth our attention and effort to understand how news source works, how it affects readers' perceptions of news events, how it is produced, how it is shaped by values and ideology.

  12. The Significance of Vague Language in Political News in

    Institute of Scientific and Technical Information of China (English)

    孙璐璐

    2015-01-01

    Political News always reports the facts happening in the country's political life, which mainly including the guidelines, this paper aims to analyze the application of Vague Language in political news in magazine in details. In this way, to help the readers understand and appreciate the political news better.

  13. Affective priming during the processing of news articles

    NARCIS (Netherlands)

    S.E. Baumgartner; W. Wirth

    2012-01-01

    The present study investigates the role of affective priming during the processing of news articles. It is assumed that the valence of the affective response to a news article will influence the processing of subsequent news articles. More specifically, it is hypothesized that participants who read

  14. A Study of Metaphor Translation Strategies in News English

    Institute of Scientific and Technical Information of China (English)

    王晶虹

    2014-01-01

    With the metaphors in News English as data,this dissertation aims at making a breakthrough in news English translation.Based on the CIT which gives comprehensive and insightful explanation to the metaphors in news English,the author proposes two strategies applied in the metaphor translationin this area.

  15. A Study of Metaphor Translation Strategies in News English

    Institute of Scientific and Technical Information of China (English)

    王晶虹

    2014-01-01

    With the metaphors in News English as data, this dissertation aims at making a breakthrough in news English translation. Based on the CIT which gives comprehensive and insightful explanation to the metaphors in news English, the author proposes two strategies applied in the metaphor translation in this area.

  16. Network Television Evening News Coverage of Infectious Disease Events.

    Science.gov (United States)

    Greenberg, Michael; Wartenberg, Daniel

    1990-01-01

    Examines coverage of several infectious diseases and teenage suicide to see whether television news favors covering illness where it clusters or when it occurs near major news centers where it is easier to cover. Finds that television news did go to where the illness broke out but tended to favor reporting urban over rural suicides. (RS)

  17. College Students' News Gratifications, Media Use, and Current Events Knowledge.

    Science.gov (United States)

    Vincent, Richard C.; Basil, Michael D.

    1997-01-01

    Results of testing uses and gratifications theory with college students show students' media use and surveillance needs increase college year. Demographic differences and gratifications sought drive news media use. Surveillance needs result in increased use of all news media, whereas entertainment needs result in television news and CNN viewing.…

  18. The E-C Translation of Vocabularies in Sports News

    Institute of Scientific and Technical Information of China (English)

    何琳琳

    2014-01-01

    In recent years, many world top level sports events take place in China. The exchange in sports field between China and international society adds more significance to the E-C translation of sports news. This paper analyses the lexical features of sports news and then explains some difficulties in the translation of the words of sports news.

  19. Are news media substitutes? Gratifications, contents, and uses

    NARCIS (Netherlands)

    R. van der Wurff

    2011-01-01

    Internet is generally expected to have one of two effects on traditional news media: It displaces them, or it forces them into distinct market niches. A shared assumption underlying both expectations is that news media displacement, or substitution, is a function of the degree to which news media ar

  20. News for the '90s: A Question of Values.

    Science.gov (United States)

    Silver, Rosalind, Ed.; Thoman, Elizabeth, Ed.

    1990-01-01

    This special issue of "Media & Values" gives a perspective on how news is changing, what is missing in the news, and how to spot bias and misinformation in news coverage, both print and electronic. Articles examine the impact of computer imaging on the credibility of photographs and the issue of privacy--just how far should journalists go to get a…

  1. 7 CFR 500.9 - Photographs for news or advertising.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Photographs for news or advertising. 500.9 Section 500... for news or advertising. Photographs for news purposes may be taken at the USNA without prior permission. Photographs for advertising and other commercial purposes may be taken, but only with the...

  2. News Media, Crime and Fear of Violence

    OpenAIRE

    Mirka Smolej

    2011-01-01

    Finland witnessed a surge in crime news reporting during the 1990s. At the same time, there was a significant rise in the levels of fear of crime reported by surveys. This research examines whether and how the two phenomena: news media and fear of violence were associated with each other. The dissertation consists of five sub-studies and a summary article. The first sub-study is a review of crime reporting trends in Finland, in which I have reviewed prior research and used existing Finni...

  3. 2006 Top 10 China RE Scientific News

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Note:Hosted by China Rare Earth Information Center and National RE Information Net and sponsored by Chinese RE Society Information Specialty Committee,China RE Society Technology εt Economy Specialty Committee,Northern RE Industry Productivity Promotion Center,and principal medias in China RE industry such as publications "China RE Information" and "Chinese Rare Earths" and China RE Website,2006 Top 10 China Rare Earth Scientific News,which were selected from 100 pieces of candidate rare earth scientific news nationwide,were announced recently.

  4. News from the biological stain commission

    DEFF Research Database (Denmark)

    Kiernan, J.A.; Lyon, Hans Oluf

    2008-01-01

    In the three earlier editions of News from the Biological Stain Commission (BSC), under the heading of "Regulatory affairs," the BSC's International Affairs Committee reported on the work of Technical Committee 212, Clinical Laboratory Testing and in Vitro Diagnostic Test Systems of the Internati......In the three earlier editions of News from the Biological Stain Commission (BSC), under the heading of "Regulatory affairs," the BSC's International Affairs Committee reported on the work of Technical Committee 212, Clinical Laboratory Testing and in Vitro Diagnostic Test Systems...

  5. A Critical Discourse Analysis of News Reports

    Institute of Scientific and Technical Information of China (English)

    SHEN Ke-lin

    2014-01-01

    Critical discourse analysis studies the relations between discourse, power, dominance, etc. and the position of the analyst. News report, which is a sociopolitical and official discourse, is often greatly affected by power or dominant ideologies and it affects people’s ideologies and attitudes. The comparative study of two pieces of news report on the same event respectively from China Daily and Times New York shows that ideology and power relationship are hidden in the public discourses and serve their purpose of forming people’s ideology.

  6. Robust anchorperson detection for TV news segmentation

    Science.gov (United States)

    Lu, Ko-Yen; Chang, Min-Kuan; Yeh, Chia-Hung; Shih, Maverick

    2006-10-01

    In this paper, we proposed a scheme for TV news segmentation via exploring the efficient visual features. The proposed scheme can be divided into three parts, such as shot change detection based on skin color; probable anchorperson shot detection and anchorperson detection. According to experimental results, our proposed method can efficiently decompose TV news into anchorperson shots and report shots. Compared to the traditional face detection methods, the proposed method can robustly exclude the non-anchorperson shots in report shots such as the interview scenes. Experimental results are given to demonstrate the feasibility and efficiency of the proposed technique.

  7. SSTI Clark ACS Technology Demonstrations

    OpenAIRE

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  8. Apuntes de Acústica

    OpenAIRE

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  9. Energy saving in ac generators

    Science.gov (United States)

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  10. [Delivering bad news in a Swiss internal medicine ward: a medical and nurse partnership].

    Science.gov (United States)

    Castioni, J; Teike Lüthi, F; Boretti, S Moser; Vollenweider, P

    2015-11-01

    Delivering bad news to a patient has a major impact for patients, their relatives and caregivers. The way this information is delivered can affect the way the patient sees his disease and potentially how he adheres to its treatment. To improve this communication with the patient the service of internal medicine at the Swiss university hospital of Lausanne set up a process including the coordination between all involved caregivers, and to break the bad news in a setting including a medical and nurse partnership. It also underscores that the resident in charge of the patient remains the coordinator of delivering new information. Moreover, the service provides communication tools to the caregivers to improve the communication skills.

  11. Context-Aware Browsing for Hyper-Local News Data (CABHLND

    Directory of Open Access Journals (Sweden)

    Dr. Yousef Ibrahim Daradkeh

    2012-07-01

    Full Text Available This paper describes a new model for delivering hyper-local data to mobile subscribers. Our model uses any exiting or especially created Wi-Fi hot spot as presence sensor that can open access for some user-generated content. In our approach we can describe hyper local data as info snippets that are valid (relevant for mobile subscribers being at this moment nearby some Wi-Fi access point. And an appropriate mobile service (customized browser can discover that information to mobile users. Service builds on the fly dynamic web pages and lets mobile subscribers to browse hyper-local data only. As the possible use-cases we can mention for example delivering news and deals in malls, news feeds for office centers and campuses, Smart City projects, personal classifieds etc.

  12. News in an age of competition: The case of sensationalism in Dutch television news, 1995-2001

    NARCIS (Netherlands)

    Hendriks Vettehen, P.G.J.; Nuijten, C.M.; Beentjes, J.W.J.

    2005-01-01

    Trends in sensationalism in Dutch television news were investigated through a content analysis of 3 Dutch TV news programs in 1995 and 2001, a period when the competition between Dutch TV news programs increased. Indicators of sensationalism were derived from 4 categories: tabloid packaging, basic n

  13. News from the Library: PressDisplay on mobile devices!

    CERN Document Server

    CERN Library

    2013-01-01

    You are probably already using PressDisplay to read newspapers online, but for those of you who are not yet aware of this service, PressDisplay is an online portal where you can browse and read online articles from more than 1,900 newspapers from 95 countries, as soon as they are published.   Whether you are an experienced user or a beginner, we have good news concerning PressDisplay: our license now permits you to download complete newspaper issues to your mobile devices and read them offline wherever you like. To do that, you have to use the mobile app PressReader. Instructions on how to install the PressReader app are available here: For Ipad For Android smartphone For Android tablet For Windows 8 devices For BlackBerry Playbook For Android eReader Your feedback is welcome! Please contact us by e-mail.

  14. President Ilves gives interview to Russian Interfax news service

    Index Scriptorium Estoniae

    2006-01-01

    President Toomas Hendrik Ilvese intervjuust Venemaa agentuurile Interfax. Küsimused puudutasid Eesti-Vene suhteid, piirilepingut, venelaste olukorda Eestis, Tallinnas asuva Teise maailmasõja mälestusmärgi teisaldamise võimalust

  15. Theme-rheme Analysis of English News Headlines

    Institute of Scientific and Technical Information of China (English)

    吴玉玲

    2013-01-01

    As a special type of writing, news report has attracted more and more attention in different countries. Many people have developed an interest in reading English news, which provides them with timely information about important happenings around the world. Under the frame work of Systemic-Functional Grammar, based on English news headlines, the theme-rheme structure of English headlines is systemically analyzed in this thesis. Some detailed researches are made to investigate the influence of the Theme-rheme Structure in English news headlines. Then the news headline as well as its contents could be understood and enjoyed while reading newspaper.

  16. Natural gas news; Gaz actualites

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1998-12-01

    This brochure is a compilation of practical information concerning the Gaz de France group: organization chart, daughter companies, services, economical activity, natural gas market, trade, regulations etc. A list of partners, directions, centres, groups, associations and other various organisms in relation with Gaz de France company is given. (J.S.)

  17. INVISIBLE GIANTS IN BROADCAST JOURNALISM: news agencies and the global news ecosystem

    OpenAIRE

    Maria Cleidejane Esperidião

    2011-01-01

    Key actors of the global informational web, the international television news agencies are not often covered in the communications field in Brazil. This paper aims to understand the dynamics established between these transnational companies and their subscribers (world television stations). It attempts to clarify how these western-led news agency companies operate within the flow of communication. It intends to identify production processes (assessment, collection, treatment and radial distri...

  18. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  19. Covering Adoption: General Depictions in Broadcast News

    Science.gov (United States)

    Kline, Susan L.; Karel, Amanda I.; Chatterjee, Karishma

    2006-01-01

    Using theories of stigma (Goffman, 1963) and media frames (Iyengar, 1991), 292 news stories pertaining to adoption that appeared on major broadcast networks between 2001 and 2004 were analyzed. Media coverage of adoptees contained more problematic than positive depictions. Although birth parents were not always depicted, adoptive parent and…

  20. Soviet Cybernetics: Recent News Items, Number Thirteen.

    Science.gov (United States)

    Holland, Wade B.

    An issue of "Soviet Cybernetics: Recent News Items" consists of English translations of the leading recent Soviet contributions to the study of cybernetics. Articles deal with cybernetics in the 21st Century; the Soviet State Committee on Science and Technology; economic reforms in Rudnev's ministry; an interview with Rudnev; Dnepr-2; Dnepr-2…

  1. The Spatiotemporal Dynamics of Digital News Audiences

    DEFF Research Database (Denmark)

    Peters, Chris

    2016-01-01

    The changing patterns of news consumption in a digital era bring about new configurations between audiences, information, the devices upon which they consume it and the different (mobile) places and (shiftable) times where and when this is possible. This chapter highlights the need to consider th...... challenges the conventional routines and symbolic power of journalism as a place where, metaphorically, people can come together....

  2. How to work through the news media

    International Nuclear Information System (INIS)

    There are essentially four steps that anyone must follow if the objective is to communicate a message through the news media: 1) Understand media (adversarial relationship, code of ethics, importance of First Amendment); 2) Redefine the relationship (become acquainted with reporter, save steps for the reporter); 3) Communicate clearly; and 4) Use alternatives when appropriate. These four steps are discussed

  3. Spaces and Places of News Consumption

    DEFF Research Database (Denmark)

    Peters, Chris

    2016-01-01

    to the news. This chapter outlines the importance of space and place when it comes to audiences/users of journalism and the gradual recognition of this in digital journalism studies, with an eye to highlighting pertinent research trajectories. It first explores how the everyday digital geographies...

  4. Triggering the News, Setting the Agenda

    NARCIS (Netherlands)

    Broersma, Marcel; Graham, Todd

    2014-01-01

    This paper both theoretically and empirically explores how people formerly known as sources use Twitter to strategically generate news coverage and to set the public agenda. Based on a large scale content analysis (2007-2013) of newspaper coverage in both tabloids and broadsheets in the UK and the N

  5. Analysis of textual Cohesion in News Report

    Institute of Scientific and Technical Information of China (English)

    刘盛兰

    2014-01-01

    Cohesion embodies the non-structural resources in English discourse and indicates the latent continuity existing in the text.On the basis of cohesion theory,this paper analyzes textual cohesion of the selected news reports form BBC website,in order to explore the way of structuring the text and realizing the meaning of the text.

  6. System for Information Extraction from News Sites

    OpenAIRE

    Stefanov, Tihomir

    2015-01-01

    The present paper deals with a system for crawling and content extraction from news sites. The system of web crawlers extracts textual and graphic information and checks for multimedia content availability. A part of the programming code and the database have been presented.

  7. The News Media as a Political Institution

    DEFF Research Database (Denmark)

    Ørsten, Mark; Allern, Sigurd

    2011-01-01

    On the basis of Scandinavian journalism research this article discusses the changing political roles of news organizations and journalists after the fall of the party press and the dissolution of broadcasting as a state-controlled monopoly. Given these institutional changes, we ask the following:...

  8. The Best of Chem 13 News

    Science.gov (United States)

    Thorsen, Kathy

    1999-07-01

    This column is designed to give JCE readers a few highlights from Chem 13 News, a monthly publication for chemistry educators from the University of Waterloo in Ontario, Canada, and provides annotations describing a particular activity or a variety of sources from which new and creative ideas can be extracted.

  9. News Values and the Vividness of Information.

    Science.gov (United States)

    Kennamer, J. David

    1988-01-01

    Claims that the long list of traditionally accepted news values can be replaced with a single concept, vividness, and that vivid information may not be the best information. Blames much of the alleged deficiencies associated with journalistic practice such as sensationalism and preoccupation with conflict on the journalistic practice of writing to…

  10. News from the Biological Stain Commission

    DEFF Research Database (Denmark)

    Lyon, H O; Kiernan, J A

    2008-01-01

    In the three earlier editions of News from the Biological Stain Commission (BSC), under the heading of "Regulatory affairs," the BSC's International Affairs Committee reported on the work of Technical Committee 212, Clinical Laboratory Testing and in Vitro Diagnostic Test Systems of the Internati...

  11. Marine environment news. Vol. 2, no. 2

    International Nuclear Information System (INIS)

    This issue of the Newsletter carries articles on Tracers to reveal Global Role of Southern Oceans in Climate Change, a Technical Cooperation project on contamination in Mediterranean Sea and an article Marine Environment Laboratory (MEL) and Harmful Algal Blooms: nuclear methods serving seafood toxicity management. News items on training, personnel and intercomparison exercise are also covered

  12. News "Speed Dating" for Scientists and Journalists: Conveying geoscience news in haiku-short form

    Science.gov (United States)

    Dybas, C. L.

    2006-12-01

    As Rachel Carson wrote in her 1956 book, The Sense of Wonder, it's important for everyone to develop an appreciation of "land, sea and sky." One of the best ways of getting the word out to the public about these realms is through the media. How do scientists capture the interest of the press in a society with a seemingly shorter and shorter attention span? Studies show that as the amount of scientific jargon and number of complex concepts in a news story increase, "filter-feeding" by the public of that news declines. When scientific jargon/complex concepts are few, the public "consumes" much more news. These results also apply to news story headlines: shorter headlines get the most interest. Based on these findings, one organization has started an experiment in "scientific speed dating": giving presenters three minutes to discuss results. They may have discovered something: news coverage of the research has been excellent. In today's world, conveying news about the geosciences in haiku-short form may be the best way of relating the wonders of land, sea and sky.

  13. Exploring the Interactions of Storylines from Informative News Events

    Institute of Scientific and Technical Information of China (English)

    胡珀; 黄民烈; 朱小燕

    2014-01-01

    Today’s news readers can be easily overwhelmed by the numerous news articles online. To cope with information overload, online news media publishes timelines for continuously developing news topics. However, the timeline summary does not show the relationship of storylines, and is not intuitive for readers to comprehend the development of a complex news topic. In this paper, we study a novel problem of exploring the interactions of storylines in a news topic. An interaction of two storylines is signified by informative news events that play a key role in both storylines. Storyline interactions can indicate key phases of a news topic, and reveal the latent connections among various aspects of the story. We address the coherence between news articles which is not considered in traditional similarity-based methods, and discover salient storyline interactions to form a clear, global picture of the news topic. User preference can be naturally integrated into our method to generate query-specific results. Comprehensive experiments on ten news topics show the effectiveness of our method over alternative approaches.

  14. Automatic indexing of news video for content-based retrieval

    Science.gov (United States)

    Yang, Myung-Sup; Yoo, Cheol-Jung; Chang, Ok-Bae

    1998-06-01

    Since it is impossible to automatically parse a general video, we investigated an integrated solution for the content-based news video indexing and the retrieval. Thus, a specific structural video such as news video is parsed, because it is included both temporal and spatial characteristics that the news event with an anchor-person is iteratively appeared, a news icon and a caption are involved in some frame, respectively. To extract automatically the key frames by using the structured knowledge of news, the model used in this paper is consisted of the news event segmentation, caption recognition and search browser module. The following are three main modules represented in this paper: (1) The news event segmentation module (NESM) for both the recognition and the division of an anchor-person shot. (2) The caption recognition module (CRM) for the detection of the caption-frames in a news event, the extraction of their caption region in the frame by using split-merge method, and the recognition of the region as a text with OCR software. 3) The search browser module (SBM) for the display of the list of news events and news captions, which are included in selected news event. However, the SBM can be caused various searching mechanisms.

  15. On the Cohesion of English Entertainment News Discourse

    Institute of Scientific and Technical Information of China (English)

    XU Wen

    2013-01-01

    With the rapid development of entertainment news, entertainment news has gained more and more attention in recent years. While previous studies have been mainly conducted from the perspective of journalism, the present study focuses on the co-hesion strategies of the selected news discourse from the linguistic point of view. Cohesion is an important linguistic concept pro-posed by Halliday. This paper will analyze the news discourse from China Daily quantitatively and qualitatively. It is found that in the entertainment news discourse grammatical cohesive devices are commonly used. The present study attempts to analyze the co-hesive features of English entertainment news, so as to help readers improve the efficiency in English news reading.

  16. Cohesiveness in financial news and its relation to market volatility.

    Science.gov (United States)

    Piškorec, Matija; Antulov-Fantulin, Nino; Novak, Petra Kralj; Mozetič, Igor; Grčar, Miha; Vodenska, Irena; Smuc, Tomislav

    2014-01-01

    Motivated by recent financial crises, significant research efforts have been put into studying contagion effects and herding behaviour in financial markets. Much less has been said regarding the influence of financial news on financial markets. We propose a novel measure of collective behaviour based on financial news on the Web, the News Cohesiveness Index (NCI), and we demonstrate that the index can be used as a financial market volatility indicator. We evaluate the NCI using financial documents from large Web news sources on a daily basis from October 2011 to July 2013 and analyse the interplay between financial markets and finance-related news. We hypothesise that strong cohesion in financial news reflects movements in the financial markets. Our results indicate that cohesiveness in financial news is highly correlated with and driven by volatility in financial markets.

  17. Adaptation Strategies of Translating English News Lead——From the Perspective of Discourse Differences

    Institute of Scientific and Technical Information of China (English)

    杨清华

    2009-01-01

    Despite the common ground of outlining the news story and attracting reader's attention,the English News lead differs largely from the Chinese counterpart in terms of the news structures and news elements.Based on Eugene Nida's Functional Equivalence Theory and the analysis of the discourse differences between English and Chinese,three corresponding adaptation strategies of news translation can be summarized--omitting news elements,restructuring news information,and rearranging the attributions.

  18. Content-Based Hierarchical Analysis of News Video Using Audio and Visual Information

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    A schema for content-based analysis of broadcast news video is presented. First, we separate commercials from news using audiovisual features. Then, we automatically organize news programs into a content hierarchy at various levels of abstraction via effective integration of video, audio, and text data available from the news programs. Based on these news video structure and content analysis technologies, a TV news video Library is generated, from which users can retrieve definite news story according to their demands.

  19. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  20. News regarding Mobility at CERN

    CERN Document Server

    2016-01-01

    CERN Bikes CERN owns a fleet of more than 500 bikes, managed by the Mobility Centre (bdg. 6167). Members of CERN personnel (MPE and MPA) can use these free of charge during work-related activities at CERN (a security deposit is requested). Between 1st of June to 30th September anyone, except Summer Students, who wish to benefit from this service shall pay 1 CHF per day. As from the 1st of August, the CERN bike rental requests are done via the Service Now (SNOW) Portal. For more information, please consult: http://cern.ch/bike-rental.   CERN Cars More than 60 vehicles are available for rent by members of personnel (MPE and MPA) at the Mobility Center (bdg. 6167). As from the 5th of September you can submit reservation requests via the new EDH Car Rental Request document. As a reminder, the Terms of Use are the following: Operational Circular n° 4 (rev.1), governing the use of CERN vehicles;   Any use of the service must be authorised by the concerned Head of Department or Team Leader...

  1. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  2. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  3. Improved Tribological Performance of Amorphous Carbon (a-C Coating by ZrO2 Nanoparticles

    Directory of Open Access Journals (Sweden)

    Jinzhu Tang

    2016-09-01

    Full Text Available Nanomaterials, such as Graphene, h-BN nanoparticles and MoS2 nanotubes, have shown their ability in improving the tribological performance of amorphous carbon (a-C coatings. In the current study, the effectiveness of ZrO2 nanoparticles (ZrO2-NPs in lubricating the self-mated nonhydrogenated a-C contacts was investigated in boundary lubrication regime. The results showed that 13% less friction and 50% less wear compared to the base oil were achieved by employing ZrO2-NPs in the base oil in self-mated a-C contacts. Via analyzing the ZrO2-NPs and the worn a-C surface after tests, it was found that the improved lubrication by ZrO2-NPs was based on “polishing effects”, which is a new phenomenon observed between a-C and nanoparticles. Under the “polishing effect”, micro-plateaus with extremely smooth surface and uniform height were produced on the analyzed a-C surface. The resulting topography of the a-C coating is suitable for ZrO2-NPs to act as nano-bearings between rubbing surfaces. Especially, the ZrO2-NPs exhibited excellent mechanical and chemical stability, even under the severe service condition, suggesting that the combination of nonhydrogenated a-C coating with ZrO2-NPs is an effective, long lasting and environment-friendly lubrication solution.

  4. An overview of the ALMA Common Software (ACS) .

    Science.gov (United States)

    Di Marcantonio, P.; Cirami, R.; Caproni, A.; Chiozzi, G.; Jeram, B.; Sommer, H.; Harrington, S.; Zagar, K.; Plesko, M.; Sekoranja, M.

    The ALMA Common Software (ACS) is an application framework designed to provide a common and homogeneous software architecture and infrastructure, spanning the end to end needs of an Astronomical observatory, from the Telescope Control system to high-level data flow management. ACS offers, at the lower level, several basic services needed for object-oriented distributed computing like transparent remote object invocation, object deployment and location, distributed error, alarm handling, logging and events. On top of this it provides an application architecture based on the Component/Container paradigm that fosters sharing and reusing of software components. Although developed for the ALMA project, ACS is now used by several other projects worldwide, among which the Italian Sardinia Radio Telescope (SRT). Besides, there is an active community that shares ideas, concepts and actual software components. Major drivers for this diffusion were the choice of adopting the LGPL public license and the adoption of CORBA, a free but reliable and widely used middleware software. In this paper we present an overview of the main features of ACS, emphasizing in particular the role of INAF-OAT in this project.

  5. Container-component model and XML in ALMA ACS

    Science.gov (United States)

    Sommer, Heiko; Chiozzi, Gianluca; Zagar, Klemen; Voelter, Markus

    2004-09-01

    ALMA software, from high-level data flow applications down to instrument control, is built using the ACS framework. To meet the challenges of developing distributed software in distributed teams, ACS offers a container/component model that integrates the use of XML transfer objects. ACS containers are built on top of CORBA and are available for C++, Java, and Python, so that ALMA software can be written as components in any of these languages. The containers perform technical aspects of the software system, while components can focus on the implementation of functional requirements. Like Web services, components can use XML to exchange structured data by value. For Java components, the container seamlessly integrates the use of XML binding classes, which are Java classes that encapsulate access to XML data through type-safe methods. Binding classes are generated from XML schemas, allowing the Java compiler to enforce compliance of application code with the XML schemas. This presentation will explain the capabilities of the ACS container/component model, and how it relates to other middleware technologies that are popular in industry.

  6. Science versus News: On the Cutting Edge

    Science.gov (United States)

    Kinney, A. L.; French, V.; Villard, R.; Maran, S. P.

    1998-12-01

    This session is to aid communication between scientists and journalists, to motivate astronomers to be active in communicating their science to the public via the press, and to help both astronomers and journalists to understand the constraints under which the other group is operating. The session consists of two talks of about 20 minutes, followed by a panel discussion. The first talk is "What Makes a Topic News?" This segment, by Miles O'Brien of CNN News, takes the AAS audiences behind the scenes in the world of producing science news stories. --- What drives selection of assignments? How does the science reporter convince their editor to cover a story? What factors about television producing help and also hurt getting science subjects across to the public? The second talk is "Public Knowledge on Science: The Growing Gap Between Scientists and the Taxpayer." This presentation by Jon Miller, a public opinion expert will emphasize the problems scientists and society, face in communicating to the public. --- What does the public know about science and scientific method? How much translation is required to communicate with the public to engage their interest without unacceptable compromise of scientific accuracy? The final segment is a panel of both science journalists and astronomers moderated by Steve Maran. Together they will tackle a question that gets to the heart of the Science-Vs-News controversies, "When Should Results Go Public?" Published too soon, science is called "hype"; Published too late, it is no longer "news." Should all results be peer reviewed first, and is that a satisfactory prerequisite? Do scientists take self-serving advantage of the public interest by making announcements before results appear in journals? How do we address the public desire to experience science unfolding and to see real-time data such as planetary science missions? The panelists are Dr. David Helfand, from Columbia University, Dr. Bruce Margon, from the University of

  7. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  8. How to take advantage of tablets: effects of news structure on recall and comprehension

    NARCIS (Netherlands)

    A. van Cauwenberge; L. d'Haenens; H. Beentjes

    2015-01-01

    In light of the growing use of tablets for news reading and mobile news consumption behaviors, this study examined whether an innovative way of structuring news on the tablet that mimics mobile news behaviors reinforced attention for, and learning from, news. Specifically, it was theorized that the

  9. La crisis nuclear de Corea del Norte: Sky News o Fox News

    Directory of Open Access Journals (Sweden)

    Pablo Rodríguez

    2014-01-01

    Full Text Available En este artículo analizamos, desde la teoría del framing, la información ofre - cida por los dos canales de noticias 24 horas del grupo News Corporation, Sky News y Fox News, con relación a la crisis nuclear de Corea del Norte en el periodo 9 -23 de abril de 2013. Nos centramos en aspectos como la “foxificación”, la presencia de expertos militares en los bloques de noti - cias y los encuadres informativos. En el caso de Sky News, la información se ofrece desde el prisma de los sucesos a nivel nacional debido al tiempo dedicado a la polémica con el documental del programa “Panorama” de la BBC. El tratamiento de la crisis nuclear en Fox News se traduce en constantes críticas a las políticas militares llevadas a cabo por Corea, la exalta - ción patriótica de los Estados Unidos poniendo el acento sobre el sistema defensivo y todo ello rodeado de una crítica feroz a la Administración Oba - ma por no promover una intervención militar en el conflicto.

  10. Substance Abuse and Mental Health Services Administration. March/April 2008

    Science.gov (United States)

    Goodman, Deborah, Ed.

    2008-01-01

    "SAMHSA News" is the national newsletter of the Substance Abuse and Mental Health Services Administration. Published six times a year (bimonthly) by SAMHSA's Office of Communications, SAMHSA News contains information about the latest substance abuse and mental health treatment and prevention practices, recent statistics on mental health and…

  11. 22 CFR 212.35 - Schedule of fees and method of payment for services rendered.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Schedule of fees and method of payment for services rendered. 212.35 Section 212.35 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PUBLIC...) Representative of the news media refers to any person actively gathering news for an entity that is organized...

  12. Recommendations for how to communicate bad news

    Directory of Open Access Journals (Sweden)

    Beatriz Villa López

    2007-11-01

    Full Text Available The communication, along with the control of the symptoms and the emotional support are the basic instruments that are used in the daily development of our profession. To be little capable at the time of notifying bad news can generate an added suffering unnecessary in the person who receives the new and a deterioration in the relation professional-patient.In many occasions, at the time of approaching these situations, the professional of the health usually feels anguish, fear and restlessness, this is because during is scared and restlessness this happens because during his stage of studies in the faculty the student has received a formation based on the binomial health-disease from a totally biological perspective forgetting the abilities communication.Supported in different bibliographical sources, this article tries to analyze the factors that influence when communicating the bad news and, to suggest some preventatives ideas on how giving them trying to prevent the burnout syndrome.

  13. ASTONISHING IMAGES: TV news and accountability processes

    Directory of Open Access Journals (Sweden)

    Braulio B. Neves

    2011-02-01

    Full Text Available Several scholars acknowledge the important role that journalism
    has in promoting accountability. Precisely how television news
    images contribute to triggering accountability dynamics, however, remains virtually unexplored. With this in mind, this study aims at a theoretical specification regarding the potential of video images to provoke public debates supporting accountability. Taking into consideration a case of extreme police violence - “Favela Naval Event”, which occurred in Diadema, São Paulo, Brazil - the authors analyze how TV news constructs the denunciation of police brutality and shapes controversies regarding attribution of responsibilities. Several dimensions of accountability are addressed in a range of competitive contexts that underscore the debate concerning the
    meaning of such scandalous images. This study challenges the
    common sense view that images degenerate the public sphere.

  14. Consumer Confidence, News and Consumption Stimulation

    OpenAIRE

    Guo, Xinqiang; Xu, Zhiwei

    2009-01-01

    In the Chinese urban data, there is a stronger relationship between consumer behavior (measured by consumption income ratio or cy ratio) and consumer confidence (measured by Consumer Confidence Index or CCI), which implies expectation about the future plays an important role in domestic demand. In our paper, a structural VAR method (based on Beaudry&Portier 2006 AER) is employed to identify the news shock about three markets including housing, education and medical care. We also extract the c...

  15. Volume, Volatility and Public News Announcements

    OpenAIRE

    Bollerslev, Tim; Li, Jia; Xue, Yuan

    2016-01-01

    We provide new empirical evidence for the way in which financial markets process information. Our results are based on high-frequency intraday data along with new econometric techniques for making inference on the relationship between trading intensity and spot volatility around public news announcements. Consistent with the predictions derived from a theoretical model in which investors agree to disagree, our estimates for the intraday volume-volatility elasticity around the most important n...

  16. Volume, Volatility and Public News Announcements

    DEFF Research Database (Denmark)

    Bollerslev, Tim; Li, Jia; Xue, Yuan

    We provide new empirical evidence for the way in which financial markets process information. Our results are based on high-frequency intraday data along with new econometric techniques for making inference on the relationship between trading intensity and spot volatility around public news...... with measures of disagreements in beliefs, economic uncertainty, and textual-based sentiment, further highlighting the key role played by differences-of-opinion....

  17. Stock Prices, News, and Economic Fluctuations: Comment

    OpenAIRE

    André Kurmann; Elmar Mertens

    2014-01-01

    Beaudry and Portier (American Economoc Review, 2006) propose an identification scheme to study the effects of news shocks about future productivity in Vector Error Correction Models (VECM). This comment shows that their methodology does not have a unique solution, when applied to their VECMs with more than two variables. The problem arises from the interplay of cointegration assumptions and long-run restrictions imposed by Beaudry and Portier (2006).

  18. Breaking Bad News to Togolese Patients.

    Science.gov (United States)

    Kpanake, Lonzozou; Sorum, Paul Clay; Mullet, Etienne

    2016-11-01

    The aim of this study was to map Togolese people's positions regarding the breaking of bad news to elderly patients. Two hundred eleven participants who had in the past received bad medical news were presented with 72 vignettes depicting communication of bad news to elderly female patients and asked to indicate the acceptability of the physician's conduct in each case. The vignettes were all combinations of five factors: (a) the severity of the disease, (b) the patient's wishes about disclosure, (c) the level of social support during hospitalization, (d) the patient's psychological robustness, and (e) the physician's decision about how to communicate the bad news. Five qualitatively different positions were found. Two percent of the participants preferred that the physician always tell the full truth to both the patient and her relatives, 8% preferred that the truth be told depending on the physician's perception of the situation, 15% preferred that the physician tell the truth but understood that in some cases nondisclosure to the patient was not inappropriate, 33% preferred that the physician tell the full truth to the relatives but not as much information to the patient, and 42% preferred that the physician tell the full truth to the relatives only. These findings present a challenge to European physicians taking care of African patients living in Europe or working in African hospitals, and to African physicians trained in Europe and now working in their home countries. If these physicians respect the imperative of always telling the truth directly to their patients, their behavior may trigger anger and considerable misunderstanding among African patients and their families.

  19. ASTONISHING IMAGES: TV news and accountability processes

    OpenAIRE

    Braulio B. Neves; Rousiley C. M. Maia

    2011-01-01

    Several scholars acknowledge the important role that journalism
    has in promoting accountability. Precisely how television news
    images contribute to triggering accountability dynamics, however, remains virtually unexplored. With this in mind, this study aims at a theoretical specification regarding the potential of video images to provoke public debates supporting accountability. Taking into consideration a case of extreme police violence - “Favela Naval Event&a...

  20. There is nothing new about Old News

    Institute of Scientific and Technical Information of China (English)

    Jacob; Fabricius

    2007-01-01

    There are 4,000 holes in the road in Blackburn,Lancashire,or one twenty-sixth of a hole per person,according to a council survey.If Blackburn is typical,there are two million holes in Britains roads,and 300,000 in London. This was what John Lennon read in Daily Mails Far and Near column on 17 January 1967.Lennon transformed the news into the last verse of the song A Day In A Life,

  1. Live Blogging Science News: The Rosetta Mission

    Science.gov (United States)

    Clark, S.

    2016-03-01

    When one of the world's most popular online news websites decides to cover a space science event live, you know that something big is brewing. Stuart Clark reports on how live blogging can be used for science reporting and how an idea that was triggered by his observations during the Rosetta flyby of the asteroid Lutetia and the landing of the Curiosity rover on Mars led to him live blogging two of Rosetta's most memorable occasions for The Guardian newspaper.

  2. Social News Sites as Democratic Media

    DEFF Research Database (Denmark)

    Szabo, András

    This thesis presents an empirical analysis and normative theoretical evaluation of Reddit, a social news website, focusing on its coverage of the 2012 US presidential election campaign. It explores the site's structural features and organization, and evaluates its coverage by standards derived from...... three different ideal concepts of democracy. In all three theoretical settings, the study finds Reddit's performance lacking, while also identifying praiseworthy aspects of the site's operation. The thesis concludes by putting the mostly disappointing results into broader historical and technological...

  3. Arctic Warming as News - Perils and Possibilities

    Science.gov (United States)

    Revkin, A. C.

    2015-12-01

    A science journalist in his 30th year covering human-driven climate change, including on three Arctic reporting trips, reflects on successes and setbacks as news media, environmentalists and Arctic communities have tried to convey the significance of polar change to a public for which the ends of the Earth will always largely be a place of the imagination.Novel challenges are arising in the 24/7 online media environment, as when a paper by a veteran climate scientist proposing a mechanism for abrupt sea-level rise became a big news story before it was accepted by the open-review journal to which it had been submitted. New science is digging in on possible connections between changing Arctic sea ice and snow conditions and disruptive winter weather in more temperate northern latitudes, offering a potential link between this distant region and the lives of ordinary citizens. As cutting-edge research, such work gets substantial media attention. But, as with all new areas of inquiry, uncertainty dominates - creating the potential for distracting the public and policymakers from the many aspects of anthropogenic climate change that are firmly established - but, in a way, boring because of that.With the challenges, there are unprecedented opportunities for conveying Arctic science. In some cases, researchers on expeditions are partnering with media, offering both scientists and news outlets fresh ways to convey the story of Arctic change in an era of resource constraints.Innovative uses of crittercams, webcams, and satellite observations offer educators and interested citizens a way to track and appreciate Arctic change. But more can be done to engage the public directly without the news media as an intermediary, particularly if polar scientists or their institutions test some of the established practices honed by more experienced communicators at NASA.

  4. Bad news: delivery, dialogue, and dilemmas.

    Science.gov (United States)

    Quill, T E; Townsend, P

    1991-03-01

    The narrative from a real patient encounter is used to illustrate the powerful effect that delivering bad news can have on both patient and physician. The meaning of bad news to the patient may be quite different than the medical or the personal meaning to the physician. Differences in perception must be explored and understood before the common ground necessary for joint decision making is established. Initial patient responses can be divided into three categories: (1) basic psychophysiologic (fight-flight or conservation-withdrawal), (2) cognitive, and (3) affective. Responses vary considerably depending on the meaning of the diagnosis to the patient, the degree of immediate threat, and the patient's previous experience with illness. Desired outcomes of the initial meeting include (1) minimizing aloneness and isolation for both patient and physician; (2) achieving a common perception of the problem; (3) giving information tailored to the immediate needs of the patient; (4) addressing immediate medical needs, including the risk of suicide; (5) responding to immediate discomforts; and (6) ensuring a basic plan for follow-up. Though all clinicians deliver bad news, few have had formal training or open exploration of the profound potential impact of the experience. PMID:2001128

  5. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  6. Audiovisual Webjournalism: An analysis of news on UOL News and on TV UERJ Online

    Directory of Open Access Journals (Sweden)

    Leila Nogueira

    2008-06-01

    Full Text Available This work shows the development of audiovisual webjournalism on the Brazilian Internet. This paper, based on the analysis of UOL News on UOL TV – pioneer format on commercial web television - and of UERJ Online TV – first on-line university television in Brazil - investigates the changes in the gathering, production and dissemination processes of audiovisual news when it starts to be transmitted through the web. Reflections of authors such as Herreros (2003, Manovich (2001 and Gosciola (2003 are used to discuss the construction of audiovisual narrative on the web. To comprehend the current changes in today’s webjournalism, we draw on the concepts developed by Fidler (1997; Bolter and Grusin (1998; Machado (2000; Mattos (2002 and Palacios (2003. We may conclude that the organization of narrative elements in cyberspace makes for the efficiency of journalistic messages, while establishing the basis of a particular language for audiovisual news on the Internet.

  7. Measuring the complexity of viewers' television news interpretation: Differentiation

    OpenAIRE

    Schaap, G.J.; Konig, R.P.; Renckstorf, K.; Wester, F.P.J.

    2005-01-01

    If television news viewers are conceived as active audience members, their interpretations should be a crucial factor in the study of the ‘effects’ of television news. Here, viewers’ interpretations are understood as subjective (re)constructions of a news item. In a previous contribution, we argued that interpretations can vary both within and between viewers in regard to the level of complexity. Complexity is the degree to which interpretations are a) differentiated, and b) integrated. In th...

  8. News and financial intermediation in aggregate and sectoral fluctuations

    OpenAIRE

    Görtz, Christoph; Tsoukalas, John

    2011-01-01

    We estimate a two-sector DSGE model with financial intermediaries—a-la Gertler and Karadi (2011) and Gertler and Kiyotaki (2010)—and quantify the importance of news shocks in accounting for aggregate and sectoral fluctuations. Our results indicate a significant role of financial market news as a predictive force behind fluctuations. Specifically, news about the value of assets held by financial intermediaries, reflected one to two years in advance in corporate bond markets, generate countercy...

  9. A Cognitive Study of Metaphor Chunks in News English

    Institute of Scientific and Technical Information of China (English)

    栗蔷薇; 吕丽静

    2011-01-01

    This paper aims to demonstrate the pervasiveness of metaphor chunks in News English and introduce effective ways of understanding themcorrectly from the perspective of cognitive linguistics.Considering the difficulty in making out the accurate meaning of metaphor chunks in News Eng-lish,some translation strategies have also been proposed in hopes that it will benefit readers in their understanding and appreciation of News English.

  10. Entity-Specific Sentiment Classification of Yahoo News Comments

    OpenAIRE

    Biyani, Prakhar; Caragea, Cornelia; Bhamidipati, Narayan

    2015-01-01

    Sentiment classification is widely used for product reviews and in online social media such as forums, Twitter, and blogs. However, the problem of classifying the sentiment of user comments on news sites has not been addressed yet. News sites cover a wide range of domains including politics, sports, technology, and entertainment, in contrast to other online social sites such as forums and review sites, which are specific to a particular domain. A user associated with a news site is likely to ...

  11. News Shocks and Labor Market Dynamics in Matching Models

    OpenAIRE

    Francesco Zanetti; Konstantinos Theodoridis

    2015-01-01

    We enrich a baseline RBC model with search and matching frictions on the labor market and real frictions that are helpful in accounting for the response of macroeconomic aggregates to shocks. The analysis allows shocks to have an unanticipated and a news (i.e. anticipated) component. The Bayesian estimation of the model reveals that the model which includes news shocks on macroeconomic aggregates produces a remarkable fit of the data. News shocks in stationary and non-stationary TFP, investme...

  12. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  13. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  14. ac electroosmosis in rectangular microchannels.

    Science.gov (United States)

    Campisi, Michele; Accoto, Dino; Dario, Paolo

    2005-11-22

    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  15. Latest news from the Tiles

    CERN Multimedia

    Costanzo, D

    The Tile hadronic calorimeter will be installed in the central region of ATLAS with an inner radius of 2.28 m, an outer radius of 4.25 m, a total length of about 12 m and a weight of about 2300 tons. The calorimeter is mechanically divided in one central barrel and two extended barrels, with a gap in between for the services of the internal part of ATLAS. The construction of the calorimeter is advanced, and installation in the ATLAS pit is foreseen to start in December 2003. After mechanical assembly the modules are instrumented with all the optical components. Scintillating tiles are inserted into the slots, and the read-out Wave Length Shifting fibers are coupled to scintillators and bundled to achieve the quasi-projective cell geometry of the calorimeter. The final modules are stored in bldg 185, shown in the first photo, and in bldg 175 at CERN. The barrel modules are mechanically assembled in Dubna and then transported to CERN to be optically instrumented, while the extended barrels are constructed in t...

  16. A Study of Rhetorical Features of English News Headlines

    Institute of Scientific and Technical Information of China (English)

    CHEN Jin-yan

    2016-01-01

    As is known to all, headlines serve as a summary and advertisement for the main idea of the news so as to make the reader have a better understanding. Therefore, to some degree, we can say that the headline is the soul of a news report. Rheto-ric, in all kinds of writing in all kinds of languages, can be applied and make an efficient effect. As for an English news headline, it is usually formed with certain rhetorical device to embody its soul and to appeal to more readers. This paper is to introduce and discuss the rhetorical features of the news headlines with examples and analysis.

  17. "Be prepared for bad news": Framing Terrorism in Norwegian News Media

    OpenAIRE

    Rabe, Ingvild Knævelsrud

    2015-01-01

    Title: Be prepared for bad news : Framing Terrorism in Norwegian News Media Author: Ingvild Knævelsrud Rabe Supervisor: Sveinung Sandberg Place: Department of Criminology and the Sociology of Law: Faculty of Law, University of Oslo Submission date: 08.05.2015 How are acts of terrorism framed in Norwegian newspapers? This thesis seeks to answer this question in a comparative case study on the coverage of two terrorist attacks that took place in 2013. The case study is based on 1121 newspaper ...

  18. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  19. An analysis of news flow on the nation's nurse shortage.

    Science.gov (United States)

    Kalisch, B J; Kalisch, P A; Clinton, J

    1981-09-01

    Using data from national newspaper clipping services, this article analyzes characteristics of 1978 news coverage of the nation's nurse shortage. Based on a content analysis of nearly 3,000 newspaper articles, findings revealed that 14 per cent of the articles mentioned problems of nurse supply. Articles on nurse shortage were most frequent in the Pacific, Mid-Atlantic and South-Atlantic states and occurred least in the West-North Central and East-South Central states. Articles mentioning nurse shortage were more frequently placed on page 1, associated with clinical nursing in hospital settings and explained as the result of maldistribution of nurses, poor salaries, deficient working conditions and lack of job satisfaction. The reading public was confronted with three major consequences of current and continued shortages in nursing: 1) decline in the availability and diversity of health services; 2) erosion in the quality of care offered the public and jeopardized patient welfare; and 3) escalating health care costs. Solutions to the nurse shortage appear to be closely tied to further expansion of the issue among the public, the initiation of remedial governmental action and timely relocation of scarce resources within the health care industry. PMID:7289679

  20. DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-05-01

    Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.

  1. The role of admission control in assuring multiple services quality

    OpenAIRE

    Carvalho, Paulo; Lima, Solange; Freitas, Vasco

    2006-01-01

    Considering that network overprovisioning by itself is not always an attainable and everlasting solution, Admission Control (AC) mechanisms are recommended to keep network load controlled and assure the required service quality levels. This article debates the role of AC in multiservice IP networks, providing an overview and discussion of current and representative AC approaches, highlighting their main characteristics, pros and cons regarding the management of network services quality. I...

  2. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  3. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  4. Short term dynamic aperture with AC dipoles

    CERN Document Server

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department

    2015-01-01

    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  5. "Chemistry Is in the News": Taxonomy of Authentic News Media-Based Learning Activities. Research Report

    Science.gov (United States)

    Glaser, Rainer E.; Carson, Kathleen M.

    2005-01-01

    A brief history is given of approaches that aim at achieving a connectedness of the content of organic chemistry courses to real world issues. Recently, such approaches have relied more and more on online media resources, the tools of the Internet and the World Wide Web. We propose a six-level taxonomy of 'authentic news media-based learning…

  6. And Now, The Rest of the News: Volatility and Firm Specific News Arrival

    DEFF Research Database (Denmark)

    Engle, Robert F.; Hansen, Martin Klint; Lunde, Asger

    Starting with the advent of the event study methodology, the puzzle of how public information relates to changes in asset prices has unraveled gradually. Using a sample of 28 large US companies, we investigate how more than 3 million firm specific news items are related to firm specific stock...

  7. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette;

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  8. Displaying fairness while delivering bad news: Testing the effectiveness of organizational bad news training in the layoff context.

    Science.gov (United States)

    Richter, Manuela; König, Cornelius J; Koppermann, Christopher; Schilling, Michael

    2016-06-01

    Although giving bad news at work is a stressful experience, managers are often underprepared for this challenging task. As a solution, we introduce organizational bad news training that integrates (a) principles of delivering bad news from the context of health care (i.e., bad news delivery component), and (b) principles of organizational justice theory (i.e., fairness component). We argue that both the formal and fair delivery of bad news at work can be enhanced with the help of training to mitigate distress both for the messenger and the recipient. We tested the effectiveness of training for the delivery of a layoff as a typical bad news event at work. In 2 studies, we compared the performance of a training group (receiving both components of training) with that of a control group (Study 1, Study 2) and a basics group (receiving the bad news delivery component only; Study 2) during a simulated dismissal notification meeting. In general, the results supported our hypotheses: Training improved the formal delivery of bad news and predicted indicators of procedural fairness during the conversation in both studies. In Study 2, we also considered layoff victims' negativity after the layoff and found that training significantly reduced negative responses. This relationship was fully mediated by layoff victims' fairness perceptions. Despite preparation, however, giving bad news remained a challenging task in both studies. In summary, we recommend that organizations provide managers with organizational bad news training in order to promote professional and fair bad news conversations at work. (PsycINFO Database Record PMID:26882444

  9. A Functional Conceptualization of Understanding Science in the News

    Science.gov (United States)

    Anderson, Megan M.

    2012-01-01

    The idea that the public should have the capacity for understanding science in the news has been embraced by scientists, educators, and policymakers alike. An oft-cited goal of contemporary science education, in fact, is to enhance students' understanding of science in the news. But what exactly does it "mean" to understand science…

  10. Children's Expectations for Television Entertainment vs. Television News Events.

    Science.gov (United States)

    Reitzes, Katherine A.; White, Mary Alice

    1982-01-01

    Found that sixth- and eighth-grade children (1) predicted a greater proportion of positive outcomes for television entertainment events than for television news events and (2) rated news events as more likely to happen in everyday life than entertainment events. Concluded that children can discriminate between the two facets of television reality.…

  11. A Multi-Dimensional Approach to Measuring News Media Literacy

    Science.gov (United States)

    Vraga, Emily; Tully, Melissa; Kotcher, John E.; Smithson, Anne-Bennett; Broeckelman-Post, Melissa

    2015-01-01

    Measuring news media literacy is important in order for it to thrive in a variety of educational and civic contexts. This research builds on existing measures of news media literacy and two new scales are presented that measure self-perceived media literacy (SPML) and perceptions of the value of media literacy (VML). Research with a larger sample…

  12. Automated Detection of Financial Events in News Text

    NARCIS (Netherlands)

    F.P. Hogenboom (Frederik)

    2014-01-01

    markdownabstractToday’s financial markets are inextricably linked with financial events like acquisitions, profit announcements, or product launches. Information extracted from news messages that report on such events could hence be beneficial for financial decision making. The ubiquity of news, how

  13. A School News Bureau: PR Training at High School Level

    Science.gov (United States)

    Sullivan, Dolores P.

    1978-01-01

    Describes how a high school journalism teacher established a student news bureau to channel information about schools in the school system to the local media; lists advantages of the news bureau to its staff members and to the school system. (GW)

  14. Determining Citizens’ Opinions About Stories in the News Media

    Directory of Open Access Journals (Sweden)

    Timo Wandhöfer

    2012-12-01

    Full Text Available We describe a method whereby a governmental policy maker can discover citizens’ reaction to news stories. This is particularly relevant in the political world, where governments’ policy statements are reported by the news media and discussed by citizens. The work here addresses two main questions: whereabouts are citizens discussing a news story, and what are they saying? Our strategy to answer the first question is to find news articles pertaining to the policy statements, then perform internet searches for references to the news articles’ headlines and URLs. We have created a software tool that schedules repeating Google searches for the news articles and collects the results in a database, enabling the user to aggregate and analyse them to produce ranked tables of sites that reference the news articles. Using data mining techniques we can analyse data so that resultant ranking reflects an overall aggregate score, taking into account multiple datasets, and this shows the most relevant places on the internet where the story is discussed. To answer the second question, we introduce the WeGov toolbox as a tool for analysing citizens’ comments and behaviour pertaining to news stories.  We first use the tool for identifying social network discussions, using different strategies for Facebook and Twitter. We apply different analysis components to analyse the data to distil the essence of the social network users’ comments, to determine influential users and identify important comments.

  15. Positive Organizational Behavior: A Buffer for Bad News

    Science.gov (United States)

    French, Sandra L.; Holden, Tracey Quigley

    2012-01-01

    Most communication research on bad news messages focuses on crisis communication, where attention is often limited to image repair strategies. The authors argue that a key indicator of an organization's effectiveness in communicating "bad news" messages is its organizational culture. Developing an organizational culture that values positive…

  16. The quality of political news in a changing media environment

    NARCIS (Netherlands)

    C.A. Jacobi

    2016-01-01

    What do ongoing changes in the media environment, notably the perceived popularization of news and the shift towards individualized online media, mean for political news quality, both in terms of what it is, as well as how we measure it? This dissertation firstly argues, based on a literature review

  17. News from the Biological Stain Commission No. 11

    DEFF Research Database (Denmark)

    Lyon, H O; Horobin, R W

    2012-01-01

    The 11th issue of News from the Biological Stain Commission (BSC) provides our first impressions of the REACH and ECHA programs. We intend to give a more thorough account of what these important programs actually mean in later editions of News from the Biological Stain Commission. Under the heading...

  18. Teaching the Scientific Method Using Current News Articles

    Science.gov (United States)

    Palmer, Laura K.; Mahan, Carolyn G.

    2013-01-01

    We describe a short (less than 50 minutes) activity using news articles from sources such as "Science Daily" to teach students the steps of the scientific method and the difference between primary and secondary literature sources. The flexibility in choosing news articles to examine allowed us to tailor the activity to the specific interests of…

  19. Segmenting Broadcast News Audiences in the New Media Environment.

    Science.gov (United States)

    Wicks, Robert H.

    1989-01-01

    Examines the "benefit segmentation model," a marketing strategy for local news media which is capable of sorting consumers into discrete segments interested in similar salient product attributes or benefits. Concludes that benefit segmentation may provide a means by which news programmers may respond to their audience. (RS)

  20. Some Uses-and-Gratifications of Television News Audiences.

    Science.gov (United States)

    Towers, Wayne M.

    Fourteen statements relating to the surveillance, diversion, and social interaction uses of media were drawn from a review of uses and gratification research and applied to the viewing of local and national early evening news and nighttime local news television programs. A telephone survey of 543 adults elicited information concerning demographics…

  1. News for a Teen Market: The Lessons of Channel One.

    Science.gov (United States)

    Hoynes, William

    1998-01-01

    Describes the types of stories that Channel One covers and the characteristics and configuration of its news sources. Focusing mostly on anchor personalities and politicians, Channel One news serves as a promotional vehicle for itself and youth culture, providing a friendly environment for controversial product advertisements. Such dramatic and…

  2. Benchmarking News Recommendations in a Living Lab

    OpenAIRE

    Hopfgartner, Frank; Kille, Benjamin; Lommatzsch, Andreas; Plumbaum, Till; Brodt, Torben; Heintz, Tobias

    2014-01-01

    Most user-centric studies of information access systems in literature suffer from unrealistic settings or limited numbers of users who participate in the study. In order to address this issue, the idea of a living lab has been promoted. Living labs allow us to evaluate research hypotheses using a large number of users who satisfy their information need in a real context. In this paper, we introduce a living lab on news recommendation in real time. The living lab has first been organized as Ne...

  3. Social Media as a News Platform

    OpenAIRE

    Liu, Guanjun

    2014-01-01

    Since the birth of social media, we’ve seen a dramatic transformation of how news is produced and consumed and how we interact with it. The main drivers are the rapid development of technology and a boom in the number of social media users. For example the Pope interacts with his followers on Twitter; the newly elected Iranian president, Hassan Rouhani, opened his Facebook profile to the public, and 2013 Russian meteor explosion went viral on YouTube with millions of hits. Thus it is conceiva...

  4. Publicity, news content, and cultural debate

    DEFF Research Database (Denmark)

    Nørgaard Kristensen, Nete; From, Unni

    2015-01-01

    Taking our point of departure in mediatization theory (Hjarvard, 2013; Lundby, 2009; Schulz, 2004), we analyse the interwoven communicative forms of the film industry and the printed press as they are expressed in the coverage of three blockbusters in Danish newspapers – Ben-Hur (1959/62); Batman...... Forever (1995) and Sex and the City (2008). The article argues that blockbusters are not only predestined media coverage due to increasingly professional com-munication strategies. Blockbusters also carry both ‘publicist’ and media commercial news value – for many of the same reasons: These movies may...

  5. Defragmenting the effect of major news announcements on financial markets

    Directory of Open Access Journals (Sweden)

    Ikhlaas Gurrib

    2014-04-01

    Full Text Available The issue of High Frequency Trading (HFT and its impact on financial markets is hitting the headlines hard nowadays. This paper looks at the effects of three major news announcements on two major currency pairs namely the Australian dollar against the US dollar and the Euro against the US dollar. The three major news announcements are the cash rate from the Reserve Bank of Australia, the minimum bid rate from European Central Bank (ECB and the official bank rate from the Bank of England.  A one minute data interval analysis is used over a time period of four years.  Findings suggest the effects of the specific news under analysis to be insignificant for a trader to benefit from the fluctuations in the two major currency markets. The use of other macroeconomic news or higher frequency data is warranted to defragment the effects of major news announcements further.

  6. 78 FR 10611 - Service Contract Inventory for Fiscal Year (FY) 2012

    Science.gov (United States)

    2013-02-14

    .../servicecontractinventory.html . A service contract inventory is a tool for assisting an agency in better understanding how.../news/fedregister . To use PDF you must have Adobe Acrobat Reader, which is available free at this...

  7. 76 FR 5567 - Service Contract Inventory for Fiscal Year (FY) 2010

    Science.gov (United States)

    2011-02-01

    .../servicecontractinventory.html . A service contract inventory is a tool for assisting an agency in better understanding how....ed.gov/news/fedregister . To use PDF you must have Adobe Acrobat Reader, which is available free...

  8. Radio News Source Preference by Residents of UYO Urban, Nigeria

    Directory of Open Access Journals (Sweden)

    CHARLES OBOT

    2013-09-01

    Full Text Available Exposure to broadcast news by audience members is part of human information processing.  Radio is believed to be a major source of news on many local and national issues for many people in many countries. But it was uncertain whether the assumption was tenable in Nigeria. Selectivity plays significant role in audience members’ exposure to broadcast news.  The study set out to investigate which radio station(s residents of Uyo residents tune to for news on important local and national issues. It also studied what factors influence their choice of radio station for news on socio-political crises in Nigeria. The findings showed that majority of the respondents prefer foreign radio stations – Voice of America (VOA and British Broadcasting Corporation (BBC for news on socio-political crises in Nigeria. The survey also revealed that media credibility exerted great influence on audience exposure to broadcast news and choice of broadcast medium for news. It is the submission of this work that the continuous presentation of one-sided point of view, whether in government-controlled media or privately-owned ones not only makes the audience hold their news content suspect but also makes such mass medium to rank low in terms of perceived credibility. One of the implications of that situation is that mass mobilization through such media would be difficult to achieve.  Consequently, it is the submission of this research that if broadcast media in Nigeria are to be reckoned trustworthy and reliable, diverse and balanced views on all issues in the news should always be presented.

  9. On the Application of News Grammatical Cohesion in Discourse%On the Application of News Grammatical Cohesion in Discourse

    Institute of Scientific and Technical Information of China (English)

    郭恒达

    2011-01-01

    A discourse is the combination of various sentences. These sentences are supposed to be not only cohesive in construction, but coherent in semantics. With the theory of cohesion this paper analyzes how they are applied in a news discourse in order to help readers and learners gain deeper understanding of a news discourse.

  10. Coverage of Alzheimer's disease from 1984 to 2008 in television news and information talk shows in the United States: an analysis of news framing.

    Science.gov (United States)

    Kang, Seok; Gearhart, Sherice; Bae, Hyuhn-Suhck

    2010-12-01

    This study examined 1371 TV news transcripts on Alzheimer's disease (AD) from 6 TV news networks during a 25-year period (1984-2008) employing the news framing perspective. Issues, sources, and episodic-thematic news about AD derived from the news framing perspective were analyzed. Results revealed that AD issues, such as treatments, personal stories, celebrities, and policy increased over time, whereas other issues including facts, causes, signs, and diagnosis received relatively limited news attention. Correlation analyses among episodic-thematic frames, issues, and sources found that episodic-thematic frames were positively linked with such issues as personal stories and policy and sources, including patients and politicians. The results suggest that although TV news covers episodic frames more than thematic ones, both frames can interact with each other to influence personal and social news about AD. Particularly, the role of celebrity affecting AD news at both individual and social levels is salient.

  11. Network television news coverage of environmental risks

    Energy Technology Data Exchange (ETDEWEB)

    Greenberg, M.R.; Sandman, P.M.; Sachsman, D.V.; Salomone, K.L.

    1989-03-01

    Despite the criticisms that surround television coverage of environmental risk, there have been relatively few attempts to measure what and whom television shows. Most research has focused analysis on a few weeks of coverage of major stories like the gas leak at Bhopal, the Three Mile Island nuclear accident, or the Mount St. Helen's eruption. To advance the research into television coverage of environmental risk, an analysis has been made of all environmental risk coverage by the network nightly news broadcasts for a period of more than two years. Researchers have analyzed all environmental risk coverage-564 stories in 26 months-presented on ABC, CBS, and NBC's evening news broadcasts from January 1984 through February 1986. The quantitative information from the 564 stories was balanced by a more qualitative analysis of the television coverage of two case studies-the dioxin contamination in Times Beach, Missouri, and the suspected methyl isocyanate emissions from the Union Carbide plant in Institute, West Virginia. Both qualitative and quantitative data contributed to the analysis of the role played by experts and environmental advocacy sources in coverage of environmental risk and to the suggestions for increasing that role.

  12. Australian news media framing of medical tourism in low- and middle-income countries: a content review

    OpenAIRE

    Imison, Michelle; Schweinsberg, Stephen

    2013-01-01

    Background Medical tourism – travel across international borders for health care – appears to be growing globally, with patients from high-income nations increasingly visiting low- and middle-income countries to access such services. This paper analyses Australian television and newspaper news and current affairs coverage to examine how medical tourism and these destinations for the practice are represented to media audiences. Methods Electronic copies of Australian television (n = 66) and ne...

  13. Taking Science to the Marketplace: Examples of Science Service's Presentation of Chemistry during the 1930s

    OpenAIRE

    Marcel C. LaFollette

    2006-01-01

    During the 1930s, Science Service, a not-for-profit independent news organization, promulgated an approach to popularizing science which favored audience preferences over scientific agendas and attended to industry as well as academic research interests. Stories about chemistry and chemists harmonized well with Science Service's emphasis on research utility and relevance. This article describes examples from syndicated news reports, radio broadcasts, a newspaper series called 'Fabrics of the ...

  14. Speaking of meta: Questioning the internet as homogeneous and global news medium

    OpenAIRE

    Opgenhaffen, Michaël

    2007-01-01

    In 1996, Morris and Ogan wrote ‘the Internet as mass medium’, on of the most important articles in the early stages of the Internet. This paper proposed a conceptualisation of the internet as a mass medium that is comprised of multiple sites and services which are the components of the medium. This way of viewing the internet as a multifaceted mass medium helps us to study the consumption and effects of the online media. Especially with regard to online news, this meta-approach is important. ...

  15. A Comparison of Career Attitudes of News-Editorial and Ad-PR Students.

    Science.gov (United States)

    Smith, Ron F.

    1987-01-01

    Assesses the attitudes that news-editorial students have toward careers in public relations and advertising and the attitudes that public relations-advertising students have toward news careers. Finds that news-ed students saw careers in public relations as being less useful to society and having less prestige in the community than their careers.…

  16. Characterization of AcMNPV with a deletion of ac69 gene

    Directory of Open Access Journals (Sweden)

    Jianhao Ke

    2011-07-01

    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  17. Stealth Advertising: The Commercialization of Television News Broadcasts in Canada

    Directory of Open Access Journals (Sweden)

    Gennadiy Chernov

    2010-01-01

    Full Text Available This two-phase study deals with the phenomenon of “stealth advertising” in Canada. This concept refers to the encroachment of commercially tinted messages into broadcast news segments. Different theories of commercial speech were used as a theoretical framework. The study combined mixed methods, content analysis and in-depth interviews. The first phase concentrated on the frequency and actual time spent airing commercially influenced messages in television newscast segments. The sample consisted of eight randomly selected English-language markets across Canada including news stations affiliated with CBC, CTV and Global. Seventy-five newscasts were recorded and content-analyzed. The analysis demonstrated that private television stations used more explicit and aggressive stealth advertising than publicly owned ones. In subsequent interviews, the news directors and sales managers of some of these stations denied that they yield to outside commercial pressures but admitted they may include messages with commercial content if these have public interest value. In the second phase thirty-nine newscasts of a news station affiliated with Global were recorded and content-analyzed, showing high numbers of commercially influenced messages and corroborating previous research findings. Subsequent interviews showed some news decision-makers accept the inclusion of commercially tinted news segments, thus eroding the divide between editorial and commercial contents. This study is intended to contribute to the empirical basis for pursuing the question of corruption of news by surreptitious commercial content.

  18. Using Multimedia to Bring Science News to the Public

    Science.gov (United States)

    O'Riordan, C.; Stein, B.; Lorditch, E. M.

    2015-12-01

    Creative partnerships between scientists and journalists open new opportunities to bring the excitement of scientific discoveries to wider audiences. Research tells us that the majority of the general public now gets more science and technology news from the Internet than from TV sources (2014 NSF Science and Engineering Indicators). In order to reach these audiences news organizations must embrace multiple forms of multimedia. We will review recent research on how the new multimedia landscape is changing the way that science news is consumed and how news organizations are changing the way they deliver news. News programs like Inside Science, and other examples of new partnerships that deliver research news to journalists, teachers, students, and the general public will be examined. We will describe examples of successful collaborations including an article by a former Newsweek science reporter entitled "My 1975 'Cooling World' Story Doesn't Make Today's Climate Scientists Wrong," which got reprinted in Slate, RealClearScience, and mentioned in Factcheck.org and USA Today.

  19. The Impact of Power on Translation of News Stories

    Directory of Open Access Journals (Sweden)

    Javad Azodi

    2015-05-01

    Full Text Available Translation has always undergone the impact of various metalinguistic factors which impose their impact during the process of translation and rendering its final linguistic product. News stories or better to say political discourses are among those linguistic materials that more than other textual materials undergo the impact of factors such as ideology. Not being aware of such discursive practices leads the so-called translator to suffice to linguistic substitutions without observing imbedded intentions. For the purpose of this study through a qualitative type of research and based on critical discourse analysis (CDA approach for textual analysis and following Tymoczko’s concept of power (2002 in translation this study aimed to scrutinize the impact of power on Persian translations of different pieces of news stories in English in 2012. The corpus consists of some pieces of English news stories in worldwide news agencies (namely, Reuters, Washington Post, New York Post, and Forbes about Iran’s nuclear program. Results of the study showed that ideology is the very important stimulus which can control and direct the purpose of the news stories being translated from English to Persian and reveal its impact in a desired way as news stories for target audience.Keywords: Power, Translation, Political Discourse, News Translation

  20. From Adaptation to Appropriation: Framing the World Through News Translation

    Directory of Open Access Journals (Sweden)

    Valdeón Roberto A.

    2014-02-01

    Full Text Available Terminological issues are problematic in the analysis of translation processes in news production. In the 1980s, Stetting coined the term “transediting”, which has been widely used in the translation studies literature, but “translation” itself becomes contentious in communication studies, a discipline closely related to news translation research. Only a few communication scholars have specifically dealt with the linguistic and cultural transformations of source texts, but they tend to regard translation as word-for-word transfer, unusual news production. More productive for the study of news translation seems to be the application of the concept of framing, widely used in communication studies. Framing considers the linguistic and paralinguistic elements of news texts in the promotion of certain organizing ideas that the target audience can identify with. In news translation, this entails the adaptation of a text for the target readership, a process can lead to appropriation of source material. Two examples are mentioned to illustrate this point: the appropriation of the US Department of State cables by the Wikileak organisation, and the pro-Romanian slogans produced by the Gandul newspaper as a response to Britain’s anti-immigration campaigns. The final section relates news adaptation to adaptation of other text types, such as literary and historical works.

  1. 17 CFR 242.505 - Exclusion for news media.

    Science.gov (United States)

    2010-04-01

    ...) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Ac... registered with the Commission as a broker or dealer or investment adviser. Regulation NMS—Regulation of...

  2. Approach for Developing Scientific News Aggregators Using ATOM Feeds

    Directory of Open Access Journals (Sweden)

    Farha Shaikh

    2012-09-01

    Full Text Available Scientists want to stay connected with everything that is new and innovative in the world, so they constantly read and analyze several online scientific resources such as magazines and journals. A user needs to do a lot of searching through on the web to locate the articles which are important to their interest. The idea of a news aggregator is not new to scientific world. A news aggregator is a software application, which periodically reads several sources and displays them on a separate page such as Google news. The information is stored in XML format. A scientific news aggregator helps in structuring online resources into useful contents. These contents are automatically fetched from several online resources available on the Internet and categorized on a separate page. Mostly, RSS feeds are used to done this job. Atom feeds are more detailed and having advance feature than RSS feeds, helps to improve the performance of scientific news aggregator by giving more updated information. A modern view of an aggregator offers a friendly user interface for users by merging the news content. We are working on an interesting approach for the design and implementation of news aggregators which will collect and aggregate data from the web to acquire unstructured information and transform it into data that could be understood and dynamically processed. The proposed approach will combine various mechanisms in order to connect to the data sources specified, identify the categories of articles, extract the corresponding pieces of news and automatically place them into the knowledge database and automatically extract the new pieces of information in the knowledge base and display them on the Science News section

  3. Language use depending on news frame and immigrant origin.

    Science.gov (United States)

    Fernández, Itziar; Igartua, Juan-José; Moral, Félix; Palacios, Elena; Acosta, Tania; Muñoz, Dolores

    2013-01-01

    The purpose of this study was to analyze the effect of the media on individuals' specific language use in relation to a news story on immigration: the influence of the news frame and group cue. Abstraction, complexity of language use, and negative affective language were evaluated. The 523 participants were randomly distributed to each of the four experimental conditions: news frame (crime versus economic contribution) by group cue (geographical origin of the immigrants involved: Moroccans versus Latin Americans). Through content analysis of the ideas and reflections that arose after the participants read the different news stories, using the Linguistic Category Model (LCM; Semin & Fiedler, 1991) to measure abstract language and the Linguistic Inquiry and Word Count (LIWC; Pennebaker, Booth, & Francis, 2007) to analyze complex language and negative affective language, it emerged that abstract language and negative affective language were more frequent in the participants assigned to the news frame on crime. Complex language was more commonly used when the news frame referred to the economic contribution of immigrants. Regression analyses showed the mediating role of attitude to immigration in the effects of news frame on negative affective language. The bootstrap method was used to assess the magnitude of the indirect effect. A significant mediator effect was also found through structural equation modeling. Analyses of covariance showed one interaction between news frame and group cue: Among those who read the news story in a frame linking immigration to crime and Moroccan origin, abstract language was more characteristic. The results are discussed from the theoretical perspective of framing. PMID:23113573

  4. Need identification for educational services in Albania

    OpenAIRE

    Bakrrugji, Simon

    2016-01-01

    This commissioned research-based thesis aimed at identifying the need for educational services in Albania. The results produced herein were accomplished through secondary and primary research. Secondary research was collected from a variety of sources published by international government agencies, and ministries and newspaper agencies in the country researched. These publications consisted of online reports, press releases, and news articles which described the need for educational services ...

  5. Marine environment news Vol. 3, no. 2, December 2005

    International Nuclear Information System (INIS)

    This issue is MEL's fifth Marine Environment News. Over the last 6 months MEL's programmes have been subjected to detailed evaluation first by an External Expert Panel that scrutinised our 5 year outputs and reported to the Director General, then by IAEA's Standing Advisory Group on Nuclear Application (SAGNA) which looked at our future marine programmes and challenges. Overall, both panels commended MEL for the volume, quality and relevance of MEL's outputs including our research findings, peer reviewed publications, training expertise and services to Member States. They also welcomed our decision to integrate our studies and services on non-nuclear contaminants with nuclear and isotopic projects, thereby providing Member States with value-added information on sources, fluxes and fates of contaminants in the coastal environment. They re-iterated previous recommendations for regular budget support to stabilise and re-launch a strategy for new extra budgetary partnerships. The reviews also welcomed the consolidation of MEL's carbonbased projects into a new Subprogramme H3 Ocean Climate Coupling and Carbon Cycling (OC4) for 2006-2007. (See our Website for New Subprogrammes). The Philippines Nuclear Research Institute (PNRI) was officially designated as an IAEA Collaborating Centre for their work on Harmful Algal Blooms (HABs). We plan joint research on tracking the food-chain mobility, impact and fate of HABs biotoxins using radiolabelled analogues. We were pleased to offer support to HSH Prince Albert II's Centenary Expedition to Spitzbergen and so contribute in a modest but symbolic way to the Centenary legacy of Oceanography in Monaco

  6. A Critical Discourse Analysis of English News Reports

    Institute of Scientific and Technical Information of China (English)

    PI Ya-xin

    2016-01-01

    Critical discourse analysis (CDA) can help people better understand the subjective view and the hidden ideology in a news discourse. Based on M.A.K. Halliday’s theory of transitivity and classification, this essay analyzes 3 reports from The New York Times and finds that despite how news reports may seem objective, every report contains the author’s own opinion he/she tries to convince the readers. Special attention needs to be paid when we come across news discourse and we shouldn’t let the hidden ideology in the reports manipulate our own viewpoint toward this world.

  7. NEWS: the near-infrared Echelle for wideband spectroscopy

    CERN Document Server

    Veyette, Mark; Hall, Zachary; Taylor, Brian; Ye, Jimmy

    2016-01-01

    We present an updated optical and mechanical design of NEWS: the Near-infrared Echelle for Wide-band Spectroscopy (formerly called HiJaK: the High-resolution J, H and K spectrometer), a compact, high-resolution, near-infrared spectrometer for 5-meter class telescopes. NEWS provides a spectral resolution of 60,000 and covers the full 0.8-2.5 micron range in 5 modes. We adopt a compact, lightweight, monolithic design and developed NEWS to be mounted to the instrument cube at the Cassegrain focus of the the new 4.3-meter Discovery Channel Telescope.

  8. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  9. Deregulation or democracy? New media, news, neoliberalism and the public interest

    OpenAIRE

    Fenton, Natalie

    2011-01-01

    This article began from the premise that news media are in crisis. The crisis is being managed by closing papers or shedding staff. Drawing on extensive empirical research the paper argues that these cuts are having a devastating effect on the quality of the news. The cuts are being delivered to news so that shareholder profits remain in an increasingly deregulated news environment. This is having a particularly negative impact on local news. While new technology is opening up new spaces for ...

  10. News trustworthiness and verification in China: The tension of dual media channels

    OpenAIRE

    Wang, Yiran; Mark, Gloria

    2016-01-01

    From 2006 to 2013, the increasing use of social media in China has provided a stage for citizens to report news and to vocalize viewpoints. News information circulated on social media at times contradicted the highly curated official news sources. In this study, we conducted two online surveys to explore 1) the level of trust that Chinese Internet users place on news from social media versus official media; and, 2) whether and how Chinese Internet users verify news from citizen sources. We fo...

  11. National Fuel Cell Bus Program: Accelerated Testing Evaluation Report and Appendices, Alameda-Contra Costa Transit District (AC Transit)

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2009-01-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 through October 2008. Evaluation results include implementation experience, fueling station operation, fuel cell bus operations at Golden Gate Transit, and evaluation results at AC Transit (bus usage, availability, fuel economy, maintenance costs, and roadcalls).

  12. Social Media Guidelines and the News Paradigm

    DEFF Research Database (Denmark)

    Blumell, Lindsey; Hellmueller, Lea; Etter, Michael

    Social network use continues to increase in the majority of regions around the world, with a global increase of 17.6% in 2012, and another projected 12.6% in 2014 (digital.org, 2014). Social media have also been incorporated into daily routines of American journalists, with 53.8% reporting...... that they use microblogs like Twitter on a regular basis to both gather and disseminate information (Willnat & Weaver, 2014). The aim of this study is to investigate how social media, more specifically, social media guidelines, implemented at the organizational level intercede with journalism practices...... and if these guidelines challenge the news paradigm. While using social media have been a “loop-hole” of sorts to disseminating political information in countries that have strong censorship (the Arab Spring being a premiere example, Eltantawy & Wiest, 2011; Lotan, Graeff, Ananny, Gaffney, & Pearce, 2011), journalists...

  13. Improving News Ranking by Community Tweets

    CERN Document Server

    Shuai, Xin; Bollen, Johan

    2012-01-01

    Users frequently express their information needs by means of short and general queries that are difficult for ranking algorithms to interpret correctly. However, users' social contexts can offer important additional information about their information needs which can be leveraged by ranking algorithms to provide augmented, personalized results. Existing methods mostly rely on users' individual behavioral data such as clickstream and log data, but as a result suffer from data sparsity and privacy issues. Here, we propose a Community Tweets Voting Model (CTVM) to re-rank Google and Yahoo news search results on the basis of open, large-scale Twitter community data. Experimental results show that CTVM outperforms baseline rankings from Google and Yahoo for certain online communities. We propose an application scenario of CTVM and provide an agenda for further research.

  14. NEWS: Nuclear Emulsions for WIMP Search

    Science.gov (United States)

    Di Marco, Natalia; NEWS Collaboration

    2016-05-01

    In the field of direct Dark Matter search a different and promising approach is the directionality: the observation of the incoming apparent direction of WIMPs would in fact provide a new and unambiguous signature. The NEWS project is a very innovative approach for a high sensitivity experiment aiming at the directional detection of WIMPs: the detector is based on a novel emulsion technology called NIT (Nano Imaging Trackers) acting both as target and tracking device. In this paper we illustrate the features of a NIT-based detector and the newly developed read-out systems allowing to reach a spatial resolution of the order of 10 nm. We present the background studies and the experimental design. Finally we report about the time schedule of the experiment and the expected sensitivity for DM searches.

  15. A tale of two news reports

    Directory of Open Access Journals (Sweden)

    Robbins RA

    2015-03-01

    Full Text Available No abstract available. Article truncated at 150 words. On Wednesday, February 25, 2015 two new stories aired, one on National Public Radio (NPR that I heard riding home that afternoon and the other later in the evening on the CBS Evening News with Scott Pelley. Both stories were on the Department of Veterans Affairs (VA but I was struck by the contrasting style of the two reports. The first story was an NPR report on back injuries in nurses (1. According to the report nurses suffer more back injuries than almost any other occupation — and they get those injuries mainly from doing the everyday tasks of lifting and moving patients. The report stated that the VA has invested over $200 million in protecting nurses predominately by providing lifts and other devices for moving patients. VA hospitals across the country have reduced nursing injuries from moving patients by an average of 40 percent since the program started. The reduction ...

  16. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.;

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  17. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  18. Peace Journalism and the news production process

    Directory of Open Access Journals (Sweden)

    Burkhard Bläsi

    2004-07-01

    Full Text Available In recent years various models of „peace journalism“ or „constructive conflict coverage“ have been proposed. These models suggest alternative ways of conflict reporting in order to contribute to processes of de-escalation, peacebuilding and reconciliation instead of escalating, exaggerating or neglecting conflicts. However, these models will remain irrelevant for the practical work of journalists unless they are connected to the reality of today’s media. Therefore it is of great importance to also direct our attention to the news production process. At the same time, studying the factors that influence the production of journalistic reporting in times of conflict and war means learning about the actual preconditions for any effort of constructive conflict coverage. Based on qualitative expert interviews with German journalists, this paper presents a model of the production process of conflict coverage. According to this model, the production process can be described as a complex interaction of six factors: (1 structural aspects of the media, (2 conflict situation on-site, (3 personal features of the individual journalist, (4 the political climate, (5 lobbies, (6 the audience. After presenting the general model and the discussion of its limitations and possible benefits, the influence of the „political climate“ factor is explored in more detail and illustrated with the experience of German journalists in the aftermath of 9/11. The author argues that peace journalism can only attract the critical number of journalists needed for a noticeable change in conflict coverage, if there are realizable suggestions for how to meet the obstacles journalists face in their daily work. The model of influencing factors affecting conflict coverage could be a good starting point for this undertaking, as it enables us, on the one hand, to systematize and specify attempts to implement peace journalism and, on the other hand, to develop a more

  19. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    OpenAIRE

    Marian GAICEANU; Emil ROSU

    2003-01-01

    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  20. International news production in post-Soviet Ukraine: Where is the ‘center’?

    Directory of Open Access Journals (Sweden)

    Natalya Ryabinska

    2012-11-01

    Full Text Available This paper focuses on the geography of news sources and news flows, which are involved in international news production in Ukraine. It seeks answers to the following questions: which sources – Western-based media and global news agencies or their competitors from other parts of the world (first of all from Russia – are preferred in the making of international news in Ukraine? What are the possible reasons of this preference? How does information on foreign affairs created by abroad news producers reach Ukrainian newsrooms? The analysis is based on interviews with 35 media experts and news producers at major Ukrainian broadcasting organizations, as well as from print and online media. The interviewees ― editors-in-chief, heads of international news’ departments, foreign correspondents ― were asked about the process of international news production in their editorial offices, the human and technical resources allocated for foreign news coverage, the professional standards of international journalism, as well as the main sources of foreign news and criteria of their selection involved in the news making process. An important finding of the presented research is the conclusion about indirect, or circuitous movement of foreign news from international news agencies to the Ukrainian media. Because of the peculiarities of Ukrainian news production described in the paper, news from Reuters or Associated Press regularly reaches Ukrainian editorial offices after it has been processed by Russian newsmakers.