
Sample records for acs news service

  1. NewsFinder: Automating an AI News Service


    Eckroth, Joshua; The Ohio State University; Dong, Liang; Clemson University; Smith, Reid G.; Marathon Oil Corporation; Buchanan, Bruce G.; University of Pittsburgh


    NewsFinder automates the steps involved in finding, selecting, categorizing, and publishing news stories that meet relevance criteria for the Artificial Intelligence community. The software combines a broad search of online news sources with topic-specific trained models and heuristics. Since August 2010, the program has been used to operate the AI in the News service that is part of the AAAI AITopics website.

  2. 26 CFR 49.4253-2 - Exemption for news services. (United States)


    ... collection of news for the public press or radio or television broadcasting or in the dissemination of news through the public press or by means of radio or television broadcasting; or (2) In the collection or..., press association, radio or television news broadcasting agency, or news ticker service, to any...

  3. Summer Food Service Program. Nourishing News. Volume 3, Issue 8 (United States)

    Idaho State Department of Education, 2009


    The primary goal of the Summer Food Service Program (SFSP) is to provide nutritious meals to children in low-income areas when school is not in session. This issue of "Nourishing News" focuses on SFSPs. The articles contained in this issue are: (1) Is Your Summer Food Program Financially Fit? (Jean Zaske); (2) Keeping the "Bugs" Away: An Ounce of…

  4. 75 FR 28231 - Cotton Classification and Market News Service: Notice of Request for an Extension and Revision of... (United States)


    ... Agricultural Marketing Service Cotton Classification and Market News Service: Notice of Request for an... the currently approved information collection Cotton Classification and Market News Service. DATES... submit written comments concerning this proposal to Shethir Riva, Chief, Research and Promotion,...

  5. News from the Library: Scientific Information Service - service interruption

    CERN Multimedia


    Techniques de l'Ingénieur has been part of the selection of databases offered by the Scientific Information Service for the last five years.   Unfortunately, as a consequence of budget reductions, and after careful consideration of all available options, we have to end this subscription. It will be still possible to purchase access to individual chapters via the Library services.  Furthermore, we are considering ending our subscriptions to Web of Science and Springer Materials (the Landolt-Börnstein database) during the course of 2015. We thank you for your understanding and welcome your feedback to

  6. ENS NucNet: the rapid worldwide nuclear news service

    International Nuclear Information System (INIS)

    NucNet is now a global fax-based network which circulates nuclear news and information of public interest in a language that the public can easily understand. NucNet aims for a balanced picture of nuclear to reach the public via nuclear communicators and the media, through a rapid flow of accurate information. (author)

  7. NEWS

    Institute of Scientific and Technical Information of China (English)


    The consumer clothing prices rose 3.3% in January February 9,National Bureau of Statistics data show that in January,the national consumer price level rose by 4.5% year-on-year,consumer prices rose by 5.5%,prices of services rose by 2.2%; national consumer price level rose 1.5% month-on-month,consumer prices rose by 1.8%, prices of services rose by 0.8%. It is estimated that among the 4.5% year-on-year increase of comsumer prices of January, there are approximately 3.0% caused by the price

  8. Servicios Relacionados. 2nd Edicion. NICHCY News Digest (Related Services. 2nd Edition. NICHCY News Digest). (United States)

    Mattson, Beverly

    This publication, written in Spanish, examines the requirement under the Individuals with Disabilities Education Act (IDEA) that mandates that all children with disabilities have available to them special education and related services designed to meet their unique needs and prepare them for employment and independent living. It investigates what…

  9. 78 FR 52129 - Cotton Classification and Market News Service: Notice of Request for an Extension and Revision of... (United States)


    ... Agricultural Marketing Service Cotton Classification and Market News Service: Notice of Request for an Extension and Revision of a Currently Approved Information Collection AGENCY: Agricultural Marketing Service... of 1995 (44 U.S.C. Chapter 35), this notice announces the Agricultural Marketing Service's...

  10. News from the Library: Two new online services available at CERN: thank you for your feedback!

    CERN Multimedia

    CERN Library


    The Library has activated two different new online services, as a result of very successful trial periods and thanks to your positive feedback and strong support: PressDisplay and Nucleonica.   PressDisplay is an online portal where one can browse and read online articles from more than 1,900 newspapers from 95 countries, as soon as they are published. Le Monde, International Herald Tribune and many more titles are available in their original layout including text and images. Thanks to RSS feeds, users can directly receive news from their favorite newspapers, but articles can also be printed and sent via email. Based on the very positive feedback we got from the community, the CERN Library has activated a one-year subscription to PressDisplay, and a wealth of information is now available at everyone's fingertips at CERN. In addition to that, the latest Library news about Nucleonica, the nuclide and isotope database derived from the Karlsruhe Nuclide Chart, generated so much interest ...

  11. The IAEA's WorldAtom Internet site: International news and information services

    International Nuclear Information System (INIS)

    The International Atomic Energy Agency (IAEA) provides news and public information services via the Internet through its WorldAtom home page. The page is accessible at Following are brief highlights of the items available on the site by clicking Press Centre, Reference Centre, or other links: Daily Press Review: Summaries of selected news items pertaining to global nuclear developments and the IAEA's work are provided each day, drawing upon a wide range of global media sources. IAEA NewsBriefs: Regularly featured are updates about IAEA activities related to areas of safety, technology transfer, and nuclear safeguards. Meetings and training courses: News about IAEA-sponsored symposia, seminars, and other meetings, as well as information about international meetings on atomic energy sponsored by other organizations, are updated on a daily basis. Press releases and statements: All IAEA press releases and media advisories since 1995 are accessible on the site. Topical and feature pages: In-depth coverage and links to information resources within and outside the IAEA are regularly given to selected topics of high international interest involving the IAEA. IAEA publications: listings and overviews of IAEA technical reports, safety standards, and other publications are updated as they are issued. Scientific and technical information: WorldAtom includes links (Reference Centre) to the International Nuclear Information System, IAEA's extensive bibliographic database of references and resources, to the nuclear database, and to departmental pages at IAEA that focus on IAEA programs and activities. IAEA documents: Electronic versions of official IAEA documents are added as they are issued. These documents include the texts and status lists of international conventions under IAEA auspices; IAEA information circulars to member states; IAEA annual reports (since 1995); and background reports and documents for the IAEA General Conference related to

  12. The IAEA's WorldAtom Internet site: International news and information services

    Energy Technology Data Exchange (ETDEWEB)

    Kyd, D.R.


    The International Atomic Energy Agency (IAEA) provides news and public information services via the Internet through its WorldAtom home page. The page is accessible at Following are brief highlights of the items available on the site by clicking Press Centre, Reference Centre, or other links: Daily Press Review: Summaries of selected news items pertaining to global nuclear developments and the IAEA's work are provided each day, drawing upon a wide range of global media sources. IAEA NewsBriefs: Regularly featured are updates about IAEA activities related to areas of safety, technology transfer, and nuclear safeguards. Meetings and training courses: News about IAEA-sponsored symposia, seminars, and other meetings, as well as information about international meetings on atomic energy sponsored by other organizations, are updated on a daily basis. Press releases and statements: All IAEA press releases and media advisories since 1995 are accessible on the site. Topical and feature pages: In-depth coverage and links to information resources within and outside the IAEA are regularly given to selected topics of high international interest involving the IAEA. IAEA publications: listings and overviews of IAEA technical reports, safety standards, and other publications are updated as they are issued. Scientific and technical information: WorldAtom includes links (Reference Centre) to the International Nuclear Information System, IAEA's extensive bibliographic database of references and resources, to the nuclear database, and to departmental pages at IAEA that focus on IAEA programs and activities. IAEA documents: Electronic versions of official IAEA documents are added as they are issued. These documents include the texts and status lists of international conventions under IAEA auspices; IAEA information circulars to member states; IAEA annual reports (since 1995); and background reports and documents for the IAEA General Conference related

  13. Supporting User Generated Content for Mobile News Services: A Case Study

    Directory of Open Access Journals (Sweden)

    Christos K. Georgiadis


    Full Text Available Web 2.0 applications encourage users to contribute to the production of richer content. In this context, our work mainly focuses on providing mobile users the ability to share content and to support user generated content production. Specifically, in our case study, features both for a mobile Web and for a mobile native application are implemented, capable of providing news services enriched with indicative social networking elements. The results of our work are largely related to the understanding of the required proper solutions, based on the investigation of serious technical challenges: the XML‐RPC library for the Android platform is exploited, as well as a specific Backend Joomla! component is built (Rsstoa to handle consistently external content sources, such as feeds and multipart emails.

  14. News & Announcements (United States)


    News from Journal House National Chemistry Week (NCW) Celebrating Chemistry and Art is the theme of NCW 2001, to be held November 4-10, 2001. As you make plans for participating in the celebrations in your area, keep in mind that JCE is developing special materials on this theme, which will appear in our October issue: Classroom Activities, a comprehensive Illustrated Resource Paper, Report from Online, specially written brief articles illustrated in color, articles related to the theme, and CLIPs (Chemical Laboratory Information Profiles). Awards Announced Passer Award Passer Award recipients from the April 1 closing date are: George Bennett, Millikin University, Decatur, IL Daniel Berger, Bluffton College, Bluffton, OH Karen Dunlap, Sierra College, Rocklin, CA Myung-Hoon Kim, Georgia Perimeter College, Dunwoody, GA Cheryl Longfellow, Philadelphia University, Philadelphia, PA Jerry Maas, Oakton Community College, Des Plaines, IL Tim Royappa, University of West Florida, Pensacola, FL Visiting Scientist Award, Western Connecticut Section Diane Bunce, The Catholic University of America, has been selected as the 2001 Visiting Scientist of the Western Connecticut Section of the ACS. The award, presented annually since 1967, brings an outstanding chemical educator to visit high schools in Fairfield County, CT. In May, Bunce visited three high schools, Christian Heritage School, Fairfield High School, and Greenwich High School, where she interacted with teachers and students and presented lectures and demonstrations to several chemistry classes. She was also keynote speaker at the ACS local section's Education Night. The awardee is selected by a committee of university and high school teachers, industrial chemists, and the previous Visiting Scientist; there is an honorarium of 1500 plus expenses. Welch Award Roger D. Kornberg, a professor of structural biology at the Stanford University School of Medicine, received the 2001 Welch Award for his discovery of the nucleosome

  15. Research News (United States)

    Research News - National Multiple Sclerosis Society Skip to navigation Skip to content Menu Navigation National Multiple Sclerosis ... Email Home Research Research News & Progress Research News Research News Share Smaller Text Larger Text Print Read ...

  16. ENS NucNet: Europe's nuclear news service open to the world

    International Nuclear Information System (INIS)

    NucNet is a Europewide network which circulates nuclear news and information that the public should be informed of, written in a language that the public can easily understand. NucNet is aiming for a balanced picture of nuclear to reach the public via the media, through rapid flow of accurate information. (author)

  17. 7 CFR 28.904 - Market news. (United States)


    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Market news. 28.904 Section 28.904 Agriculture..., TESTING, AND STANDARDS Cotton Classification and Market News Service for Producers Classification and Market News Services § 28.904 Market news. The Director shall cause to be distributed to producers...

  18. Towards Simpler Custom and OpenSearch Services for Voluminous NEWS Merged A-Train Data (Invited) (United States)

    Hua, H.; Fetzer, E.; Braverman, A. J.; Lewis, S.; Henderson, M. L.; Guillaume, A.; Lee, S.; de La Torre Juarez, M.; Dang, H. T.


    To simplify access to large and complex satellite data sets for climate analysis and model verification, we developed web services that is used to study long-term and global-scale trends in climate, water and energy cycle, and weather variability. A related NASA Energy and Water Cycle Study (NEWS) task has created a merged NEWS Level 2 data from multiple instruments in NASA’s A-Train constellation of satellites. We used this data to enable creation of climatologies that include correlation between observed temperature, water vapor and cloud properties from the A-Train sensors. Instead of imposing on the user an often rigid and limiting web-based analysis environment, we recognize the need for simple and well-designed services so that users can perform analysis in their own familiar computing environments. Custom on-demand services were developed to improve data accessibility of voluminous multi-sensor data. Services enabling geospatial, geographical, and multi-sensor parameter subsets of the data, as well a custom time-averaged Level 3 service will be presented. We will also show how a Level 3Q data reduction approach can be used to help “browse” the voluminous multi-sensor Level 2 data. An OpenSearch capability with full text + space + time search of data products will also be presented as an approach to facilitated interoperability with other data systems. We will present our experiences for improving user usability as well as strategies for facilitating interoperability with other data systems.

  19. What leads to readers’ satisfaction with the mobile news apps service? An investigation into the roles of content originality and user experience

    Institute of Scientific and Technical Information of China (English)

    Wenjing; HE; Xiaoyu; CHEN; Yichen; LI; Yueyi; QIU


    Purpose: This study aims to explore whether content originality and user experience have positive effects on online news readers’ satisfaction with the mobile apps service.Design/methodology/approach: Data was collected via a Web-based survey. Data analysis of this study can be divided into two stages. In the first stage, a descriptive statistical analysis was conducted based on a sample of 612 respondents. In the second stage, the correlation among content originality, user experience and satisfaction was analyzed based on a sample of 377 mobile news apps users. Findings: Results of the first stage showed that social media and mobile news apps were the most important tools for users to access news, and different types of media were playing complementary roles in information transmission. Users held a positive attitude toward their mobile news reading experience and they described news they read on mobile apps with such words as "interesting", "instant", "positive", "profound", and "ironic". Results of the second stage confirmed our hypothesis that content originality and user experience both had positive impacts on user satisfaction.Research limitations: The questionnaires were distributed entirely online, so the sample may not be representative of the general population being studied and thus undermine the reliability and generalization of the findings to some extent. Moreover, this study adopted only one method(survey) and more methods such as interviews can be used to improve the accuracy of the results.Practical implications: The findings of this study can not only provide insights into a better understanding of users’ mobile reading behavior, but also help mobile information service providers attract more users.Originality/value: This is one of the first studies to explore the effects of content originality and user experience on online news readers’ satisfaction with the mobile apps service.

  20. 75 FR 41522 - Novell, Inc., Including On-Site Leased Workers From Affiliated Computer Services, Inc., (ACS... (United States)


    ... in the Federal Register on December 11, 2009 (74 FR 6599). At the request of the State Agency, the... related to research, design and technical support for the production of computer software. The company... Computer Services, Inc., (ACS), Provo, UT; Amended Certification Regarding Eligibility To Apply for...

  1. ENS NucNet: Europe's nuclear news service open to the world

    International Nuclear Information System (INIS)

    NucNcet is a Europe-wide network which circulates nuclear news and informations that the public should be informed of, written in a language that the public can easily understand. NucNet is aiming for a balanced picture of nuclear to reach the public via the media, through a rapid flow of accurate information. All nuclear countries in Eastern and Western Europe, including the Soviet Union, participate in NucNet. Within each country, all sources of nuclear information, such as utilities, nuclear power plants, the fuel cycle industry, safety authorities and waste organisations, are directly linked to the ENS NucNet central office in Berne. Using faxes, they supply central office with all information about nuclear energy which is of interest to the public. This is done in various languages. The central office chooses the most important information, and edits it in English before distributing the material through the system, using the most up-to-date computer-fax equipment. (orig.)

  2. News and Features Updates from (United States)

    General Services Administration — Stay on top of important government news and information with the Updates: News and Features RSS feed. We'll update this feed when we add news and featured...

  3. News & Announcements (United States)


    . Works well. Activity:CD Light: An Introduction to Spectroscopy. J. Chem. Educ. 1998, 75, 1568A (December 1998). Workshop?yes Booth?yes, with colored plastic onlynot solutions Notes:Can be difficult to measure and cut cardboard for spectroscope. Pre-made spectroscopes and partially constructed ones to show method could be provided. Needs good light source to work well. Activity:Cleaning Up with Chemistry: Investigating the Action of Zeolite in Laundry Detergent. J. Chem. Educ. 1999, 76, 1461A (October 1999). Workshop?yes Booth?could demonstrate tubes of soapy water with and without zeolite Notes:Need access to water. Quick and easy. More information about JCE Classroom Activities is available on JCE Online at: Here you will find the notes described above and a list of all published Classroom Activities. The site is updated regularly. Awards Announced United Nations Environment Program The United Nations Environment Program (UNEP) has selected Mario J. Molina, professor of earth, atmosphere, and planetary sciences at Massachusetts Institute of Technology, as the winner of the 1999 UNEP Sasakawa Environment Prize. The prize, worth $200,000, is for his outstanding global contributions in the field of atmospheric chemistry. ACS Northeastern Section The Northeastern Section of the American Chemical Society has awarded the Henry A. Hill Award to Morton Z. Hoffman, professor of chemistry at Boston University. The award is given annually to a member of the section for outstanding service. Award Deadlines Mettler-Toledo Thermal Analysis Education Grant Mettler-Toledo has established a grant to honor Edith A. Turi of the Polymer Research Institute, Polytechnic University, Brooklyn, NY, for her lifelong contribution to the cause of thermal analysis education. The grant will be awarded on an annual basis to not-for-profit organizations in North America that confer degrees up to the Ph. D. level and provide or intend to provide

  4. Auricular tachycardia: therapeutic and pathophysiologic news concepts: literature review and casuistic Service presentation

    International Nuclear Information System (INIS)

    The auricular tachycardia are the supraventricular tachycardias whose origin mechanism and maintenance is located at level exclusively auricular. It show diagnostic and therapeutics difficulties.The inadequate handling can cause commitment of the ventricular function and to commit the predict vital.The pharmacological treatment, is more used is few effective.The ablation for catheter with radiofrequency is a new weapon transcendent therapy for the resolution of a significant group of these patients. A review of the concept of auricular tachycardias, it upgrades its classification and the mechanisms pathophysiologic.It describes the techniques of ablation for catheter in these arrhythmias and their results are revised in the literature. In the end it presents the casuistry of the Service in the treatment of the auricular tachycardias focal s,incision ales and atrial flutter by means of ablation for catheter with radiofrequency

  5. News of CanalUGR tracked on Google News, Yahoo! News and Bing News


    Herrero-Solana, V??ctor; Arboledas M??rquez, Luis; Leger??n-??lvarez, Elisa


    Dataset contains 613 news of CanalUGR (University of Granada Communication Office) tracked on the main online news aggregators (Google News, Yahoo! News and Bing News). We include: number in CanalUGR, media, country, type.

  6. NEWS: Institute news (United States)


    Department of Physics and Astronomy at the University of Leeds. Physics at Work Exhibition: 12-14 September, University of Cambridge The year 2000 Exhibition will be the 16th organized by Brenda Jennison. The exhibition will be held at the Cavendish Laboratory and further details can be obtained from Brenda at the University (tel: 01223 332888, fax: 01223 332894 or e-mail: News on GNVQ science The Institute of Physics and the Royal Society of Chemistry are currently financing the compilation of a directory of resources to assist teachers in identifying and selecting suitable materials for teaching the new GNVQ science specifications. Work on the first part of the directory will soon be completed and it is hoped to publish the material in both print and electronic forms before the end of the summer term. This first part covers resources - all evaluated by practising GNVQ teachers - supporting the teaching of the compulsory units for Advanced GNVQ Science. A small team comprising a physics teacher, a chemistry teacher and a biology teacher, all involved with GNVQ programmes and led by Dr Ken Gadd, has carried out the work. They have established a network of teachers around the country to help with the evaluation of curriculum materials. The next part of the project will be to examine the feasibility of providing a similar listing for the optional units at this level. Future development, depending on the availability of funds, will extend the project to Intermediate level programmes in science, including the Part One, once its structure has been agreed at QCA. Further information about the Directory and the next phase of development will be available in the autumn. Activities Physics on Stage The future of science, technology and the ensuing wealth creation potential for Britain will depend on the quality of science education in schools today. Yet the numbers studying physics, which underpins science and engineering, are falling. This problem is currently

  7. News & Announcements (United States)


    /TD/TDhome.html. This site also has links to JCE guidelines for prospective authors. Volunteers should contact Vitz by the medium of their preference: Ed Vitz, Editor, Tested Demonstrations, Journal of Chemical Education, Department of Chemistry, Kutztown University, Kutztown, PA 19530; phone: 610/683-4443; fax: 610/683-1352; email: Awards Announced ACS Regional Awards in High School Chemistry Teaching The American Chemical Society has announced winners of regional awards in high school chemistry teaching for 1999. Winners have demonstrated excellence in teaching, exceptional ability to challenge and inspire students, extracurricular work, and willingness to keep up to date in the field. The award consists of two certificates (one for the recipient, the other for display at the recipient's school) and a cash prize of 1,000. Thomas W. Adams, Indiana Academy for Science, Mathematics & Humanities at Ball State University, Muncie, Indiana: Central Region Arthur J. Crumm, Barstow School, Kansas City, Missouri: Midwest Region Esther H. Freeman, Tabb High School, Yorktown, Virginia: Southeast Region Joan A. Laredo-Liddell, St. Barnabas High School, Bronx, New York: Middle Atlantic Region, 1998 David T. Lee, Mountain Lakes High School, Mountain Lakes, New Jersey: Middle Atlantic Region, 1999 Diane Coley McGann, Santa Ana High School, Santa Ana, California: Western Region William J. Pilotte, Newington High School, Newington, Connecticut: Northeast Region Judith C. Seydel, Idaho Falls High School, Idaho Falls, Idaho: Northwest Region Brenda A. Wolpa, Canyon Del Oro High School, Tucson, Arizona: Southwest/Rocky Mountain Region NSF Distinguished Public Service Award As a part of its celebration in 2000 of its half-century in existence, the National Science Foundation has announced the recipient of its Distinguished Public Service Award. Samuel P. Massie, U.S. Naval Academy, Annapolis, Maryland (Emeritus) 1999 Ford Foundation Fellowships The National Academies have announced the

  8. National Park Service - SRI - Soil Survey Geographic (SSURGO) for National Park Service Units (A-C TEST) (United States)

    National Park Service, Department of the Interior — This data set was developed in conjunction with the U.S. Department of Agriculture, Natural Resources Conservation Service, and meets the standards and...

  9. L’Union européenne et les négociations de l’Accord sur le commerce des services (ACS) - Trade in Services Agreement (TiSA)


    Guillenteguy, Laura; Ghio, Clara


    Depuis 2013, 22 États ainsi que l’Union européenne négocient un accord plurilatéral portant sur le commerce des services : l’Accord sur le Commerce des Services (ACS). Cet accord vise la libéralisation renforcée et multisectorielle du commerce international des services. Cet article éclaire les principales caractéristiques du futur accord, au regard notamment de l’Accord commercial sur le commerce des Services (AGCS), précédemment conclu dans le cadre de l’OMC. L’ACS constitue une solution de...

  10. Young people’s news orientations and uses of traditional and new media for news

    NARCIS (Netherlands)

    A. van Cauwenberge; L. d'Haenens; H. Beentjes


    This article reports on Flemish college students’ news orientations and their uses of traditional and new media for news within a public service media environment. We used five homogeneous focus groups that covered variation in news media use. The analysis of the focus groups revealed major differen

  11. No news is good news?

    CERN Multimedia

    Peter Schmid

    I'm retired and living back home in Austria. But I am still excited about ATLAS and I try to follow the progress of the project as closely as I can. The ATLAS e-news are an excellent source of information. Appearing now every month they provide a broad, solid view of what is going on. But I'm greedy; I'd love to be "on-line". When the first End-Cap Toroid moved from hall 180 to the pit I was frustrated. I knew that it was happening but I could only get first pictures and reports a few days later. In the meantime the ECT was lowered into the cavern; no information on this available nowhere up to the this issue of the e-news. Here is my dream: an "ATLAS news ticker", i.e. a web page with the news appearing on the day they happen; just one line of information, possibly with a reference to a picture, a person or a report. My idea isn't new. On the ATLAS web-site for the public we have a window "latest news". But I was disappointed when, until a week ago, the latest news dated from December 2006 !!! Can't we do...

  12. CERN television news

    CERN Document Server


    CERN events brought right to your desktop by the new video bulletin.   CERN now has its very own news broadcast , or rather 'webcast', with a host of special reports and even a star presenter. From today onwards, just go to the Bulletin's web page, click on the 'video news' link and sit back and enjoy the latest news about CERN, presented in images by Wendy Korda. The ten-minute newscast in both French and English, the Organization's two official languages, presents interviews, pictures of experiments and computer-generated graphics, bringing you right up to date with some of the Laboratory's latest stories. The show concludes with a selection of the best snapshots taken by the CERN Photo Lab. So every one or two months CERN's Audio-Video Service (ETT/DH) will be putting together a video news report that you can watch on your own desktop computer. Daniel Boileau, Patrick Gilbert de Vautibault and Jacques Fichet, the Service's three technicians, came up with the idea of producing this regular feat...

  13. Virginia Tech Mobile delivers news to cell phones, PDAs


    Lazenby, Jenna


    Virginia Tech Mobile-a new service that delivers the latest Virginia Tech news and information to cellular phones or personal digital assistants (PDAs)-is now available to anyone interested in the latest news from Virginia Tech.

  14. Crise dos serviços de saúde no cotidiano da mídia impressa The news about the health service crisis in the newspaper

    Directory of Open Access Journals (Sweden)

    Vera Sonia Mincoff Menegon


    Full Text Available Apoiando-nos na perspectiva da Psicologia Social, acatamos o pressuposto de que a mídia é um importante espaço de difusão de informações, atuando como co-produtora de sentidos e de subjetividades no cotidiano das pessoas. Assim, a partir da análise de notícias, publicadas em jornais de Campo Grande, MS, tendo como tema serviços de saúde e, mais especificamente, notícias sobre um período de crise nesses serviços, problematizamos o posicionamento do hospital como lócus privilegiado no cuidado com a saúde e as formas verticais de negociação. A ruptura com essa associação e a abertura ao diálogo é um grande desafio para que o Sistema Único de Saúde (SUS se constitua em um sistema público, pautado pelos eixos da integralidade e da humanização na atenção à saúde que, no debate atual, formatam propostas defendidas pela Saúde Coletiva e outras áreas que atuam na saúde, entre eles a Psicologia.From the perspective of Social Psychology, we agree on the assumption that news media is an important space to propagate information, acting as a co-producer of meanings and of subjectivities in people's everyday lives. Therefore, based on the analysis of newspaper news, published in local newspapers of Campo Grande , MS, and having as their subject health service, more specifically news about the crisis in this kind of service, we critically consider the positioning of hospitals as the privileged locus for health care as well as the vertical forms of negotiation. The rupture with this association and the opening for dialogue conveys a great challenge for the Sistema Única de Sáude - SUS (Brazil's public health care system so that it can be constituted as a public system, based on universal health care and humanization of health care attention which, under current debate, forms the proposals defended by Collective Health and other fields of knowledge involved in health care, including Psychology.

  15. AAAI News


    Clancey, William J.; Fehling, Michael; Russell, Stuart; Fikes, Richard E.; Stickel, Mark; Bledsoe, Woody; Korm, Richard E.; Thompson, William B.; Barstow, David R.


    Fall news from the Association for the Advancement of Artificial Intelligence, including reports on the Knowledge System Development Tools and Languages workshop, the workshop on AI and Limited Rationality, the Artificial Intelligence and Software Engineering workshop, the workshop on Robot Navigation, the Planning and Search Summary workshop, and the workshop on Representation and Compilation in High-Performance Theorem Proving.

  16. Online news

    DEFF Research Database (Denmark)

    Hjarvard, Stig; Kammer, Aske Søndergaard


    decades, these features have come under pressure due to – among other things – the spread of digital media. In this article, we explore two current structural economic challenges to legacy newspaper organizations in Denmark. The first challenge regards the implementation of subscription on news websites...

  17. 17 CFR 242.505 - Exclusion for news media. (United States)


    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exclusion for news media. 242.505 Section 242.505 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED...-Analyst Certification § 242.505 Exclusion for news media. No provision of this Regulation AC shall...

  18. Good News is No News

    NARCIS (Netherlands)

    D.J.C. van Dijk (Dick)


    textabstractNews plays a crucial role in determining prices in financial markets. In an efficient market, current prices fully and correctly reflect all available information, such that only truly new information leads to price adjustment. This lecture shows that using high-frequency data makes it p

  19. News of the world

    International Nuclear Information System (INIS)

    This article reviews some news on nuclear topics from around the world, among which we have noticed: - 1093 tons of spent fuel were processed by Cogema-La-Hague in 2003, - Finland has decided to build an underground facility for the definitive disposal of radioactive wastes, - NRC (American nuclear regulatory commission) has issued a project for new regulations concerning the packaging and transport of radioactive materials, - according to a study edited by the European agency for the environment (AEE) the measures taken or planned to be taken in the European Union will not be sufficient to comply with the Kyoto agreement (concerning the reduction of CO2 emissions), - in France the consumption of electricity got a sharp increase in 2003: +3,9% and reached 467,3 TWh, - Brazil, which owns large reserves of uranium, has decided to produce enriched uranium (by means of the ultracentrifugation technique). (A.C.)

  20. ACS Booklet Focuses on Chemical News (United States)

    Chemical and Engineering News, 1976


    Discusses the 1976 edition of "What's Happening in Chemistry," a booklet summarizing newsworthy events in chemical research, available from the American Chemical Society. The booklet is primarily for writers, editors, and broadcasters; its aim is to generate more articles in the media about chemists and chemistry. (MLH)

  1. VillageSoup: Sustaining News in a Rural Setting


    Sara Majka; Bill Densmore; Norman Sims


    In rural Camden, Maine, Richard Anderson has found a formula for sustainable news coverage in an age when the Internet seems to be killing the news business. He began by starting an online-only news site for the community in 1996, an ambitious and early web presence. By specializing in quick, hard news, community service, citizen involvement, and community leadership, Anderson built an audience for his VillageSoup website. But the community had a moribund weekly newspaper that soaked up much ...

  2. News & Announcements (United States)


    that new technologies are having on the nation's campuses in the context of student learning and ways to achieve this learning cost-effectively. The Program has three areas of work: the Pew Grant Program in Course Redesign; the Pew Symposia in Learning and Technology; the Pew Learning and Technology Program Newsletter. The Pew Learning and Technology Program is coordinated by the newly created Center for Academic Transformation at Rensselaer Polytechnic Institute led by its executive director, Carol A. Twigg. The Center's mission is to serve as a source of expertise and support for those in and around higher education who wish to transform their academic practices to make them more accessible, more effective, and more productive by taking advantage of the capabilities of information technology. For further information, see the Center Web site at or contact Abbie Basile at or 518/276-8323. Materials Available Outstanding Science Trade Books for Children The 1999 list of Outstanding Trade Books for Children, a cooperative project between NSTA and the Children's Book Council, has been published recently. Published annually for more than 20 years, the list of outstanding trade books is intended to help educators, librarians, parents, and others interested in science education to promote science through reading. The books are geared for children in grades K-8. This 1999 list is available through the NSTA Web site at, or through NSTA's Fax on Demand service (888/400-NSTA); when prompted, select number 842 to receive a faxed copy of the trade book list. ACS Pamphlet on Global Climate Change and Fact Sheet on Chemical Weapons Global Climate Change, an updated pamphlet that replaces the 1990 version, presents an overview of the factors that influence climate and describes the basis of recent public concerns. The pamphlet explains in clear, concise language what scientists know and don't know about the greenhouse effect. The

  3. NewsNet


    Maffei, Lucia


    NewsNet wants to highlight the opening of a “unified law portal” as part of the plan for the E-government ( signed by the Ministers Council. The outlined overview shows from one side the creation of service portals that allow people and industries to obtain easily information on laws, and from the other the creation of helpdesks where asking the Administrations on the basis of the electronic identity card and the digital s...

  4. News; Actualites

    Energy Technology Data Exchange (ETDEWEB)



    The main news of the LPG industry from February to May 2005 are gathered in the first part. 8 articles are then gathered in this data-sheet, they deal with: 1) the French 'Charte de l'environnement': environment is now taken into account in the French fundamental Law 2) the French Prime Minister sets the targets for the National Council for Sustainable Development 3) the French government's policy for State environment-friendly items purchasing 4) Primagaz and Butagaz receive awards at the ENEO exhibition in Lyon 5) a French decree on pressure equipment, concerning among others, the role of controlling bodies on LPG tanks requalification 6) BP launches its chemical branch Innovene, in view of selling it this year 7) the French gas congress and exhibition 8) Favex, distributor in France of the US Mosquito Magnet System, launches a campaign. (O.M.)

  5. Language, News and Volatility


    Byström, Hans


    I use Google News TM to study the relation between news volumes and stock market volatilities. More than nine million stock market-related news stories in English and (Mandarin) Chinese are collected and the dynamics of the news volume and the stock market volatility is compared in both the Anglophone world and the Sinophone world. I find that the stock market volatility and the number of publicly available global news stories are strongly linked to each other in both languages. Contemporaneo...

  6. News Service Sales Research based on C & R tree%基于分类回归树的新闻服务营销研究

    Institute of Scientific and Technical Information of China (English)



    The Classification and Regression Tree node (Classification And Regression Tree,CART) in Data Mining techniques is a tree-based classification and prediction method that uses recursive partitioning to split the training records into segments with similar output field values. In this paper, it is applied to a marketing study which is to find the potential customers having the intentions to buy an online interactive news service. Through using the existing customer data as training samples, a classification and regression model is established, which can be used to predict future data and help the companies better carry out different marketing strategies for different types of customers.%数据挖掘技术中的分类和回归树(Classification And Regression Tree,CART)节点是一种基于树的分类预测方法,使用递归分区来将训练记录分割类似的输出字段值。文章将C&R树应用于市场营销研究,目标是寻找意愿接受互动新闻服务并购买的潜在客户。通过使用已有的客户数据作为训练样本,建立了一个分类回归模型,可以用于未来数据的预测,从而有助于企业更好地针对不同类型的客户进行不同的营销策略。

  7. RGN news

    International Nuclear Information System (INIS)

    A.C. Lacoste, the head of DSIN, has remembered that no severe events occurred in 1998 concerning nuclear facilities. He has shown some concerns about weaknesses in the nuclear transport field. After the incident that happened at the Tricastin power plant, EdF has launched a plan whose purpose is to improve the cleanliness of radioactive transports and the organisation of radiation protection. The CES (economic and social council) has expressed its opinion about the French nuclear program. This program has secured the energy independence of France and the protection of the environment by reducing the consumption of fossil fuels. The CES advices the government to continue this program and to take a prompt decision about the EPR project (European pressurized water reactor) in order to launch the building of a prototype. COGEMA has signed a contract with the DOE (American department of energy) in order to settle a mixed-oxide fuel fabrication plant in the Usa. Framatome has announced a sharp rise of its activities in the connector field following the takeover on Berg electronics in October 1998, as for the energy sector, it remains at a satisfactorily level. The fourth marine transport of Japanese vitrified wastes left Cherbourg on February 25, its destination was Mutsu Ogawara and its shipping was made up of 2 casks containing each 20 containers. The packaging is described in the article. (A.C.)

  8. Physics News

    CERN Multimedia

    Gianotti, F.

    In spite of the fact that real data will only come in the year 2006, this is a very busy and interesting time for Physics-related activities. A very short overview of these activities is given in this issue of the ATLAS News Letter, while the various topics will be described in more detail in the next issues. The Physics and Combined Performance groups are working in four main areas: 1) Assess the ATLAS potential for physics, with emphasis on new channels and ideas. Recent examples are Extra-dimensions, invisible Higgs decays, heavy ion physics, the expected potential of a "Super-LHC" running at a luminosity of 10^35, etc.. 2) Improve the understanding of the detector performance and optimise the reconstruction algorithms. Examples of issues in the pipeline are: can we tag charm-jet ? What can we gain in the jet energy resolution by combining the calorimeter and tracker information to reconstruct the jet energy ? 3) Follow detector changes and detector-related issues and monitor the impact on the perform...

  9. Novae news

    CERN Multimedia


    As announced in the previous Bulletin, Novae has opened a new snack bar on the Flagstaff car park, just a few metres from CERN's reception area (Building 33).   Just a few metres from the CERN Reception, the new Novae snack point welcomes visitors and CERNois. Opening hours Currently: Monday to Friday, 8 a.m. to 4 p.m. From September: Monday to Friday, 7:45 a.m. to 5 p.m.; Saturdays from 8 a.m. to 2 p.m. The snack bar selection includes breakfast, starting at 2.70 CHF, cold dishes from 5 CHF, and hot dishes from 6 CHF.   Novae has also installed a 24-hour-a-day food vending machine in the CERN hostel (Building 39) and in Building 13. You can buy pasta and cooked dishes for 6.50 CHF to 8 CHF. In addition, a groceries vending machine has been installed in the main building, just across from the news kiosk. Nearly 60 different items are available around the clock. Finally, Novae has introduced a new payment system in several buildings on the Meyrin site. It accepts credit ca...

  10. RGN news

    International Nuclear Information System (INIS)

    This series of short articles deal with events that occur in France recently. The first article gives the chronology of the events that led to the shutdown of 3 reactors at the Blayais power plant during the storm on December 27-28th, 1999. The second article discusses the taking into account of the flooding risk when designing nuclear power plants. The third article reviews the damage suffered by the power distribution network during the storms of last december. The last article discusses the results of an opinion poll about the main concerns of the population, unemployment comes first. As for nuclear energy, 57% of questioned people think that France has made a realistic choice whereas 22% think that it was a bad choice for the country. (A.C.)

  11. Hot news recommendation system from heterogeneous websites based on bayesian model. (United States)

    Xia, Zhengyou; Xu, Shengwu; Liu, Ningzhong; Zhao, Zhengkang


    The most current news recommendations are suitable for news which comes from a single news website, not for news from different heterogeneous news websites. Previous researches about news recommender systems based on different strategies have been proposed to provide news personalization services for online news readers. However, little research work has been reported on utilizing hundreds of heterogeneous news websites to provide top hot news services for group customers (e.g., government staffs). In this paper, we propose a hot news recommendation model based on Bayesian model, which is from hundreds of different news websites. In the model, we determine whether the news is hot news by calculating the joint probability of the news. We evaluate and compare our proposed recommendation model with the results of human experts on the real data sets. Experimental results demonstrate the reliability and effectiveness of our method. We also implement this model in hot news recommendation system of Hangzhou city government in year 2013, which achieves very good results. PMID:25093207

  12. Personalized News Recommendation: A Review and an Experimental Investigation

    Institute of Scientific and Technical Information of China (English)

    Lei Li; Ding-Ding Wang; Shun-Zhi Zhu; Tao Li


    Online news articles,as a new format of press releases,have sprung up on the Internet.With its convenience and recency,more and more people prefer to read news online instead of reading the paper-format press releases.However,a gigantic amount of news events might be released at a rate of hundreds,even thousands per hour.A challenging problem is how to efficiently select specific news articles from a large corpus of newly-published press releases to recommend to individual readers,where the selected news items should match the reader's reading preference as much as possible.This issue refers to personalized news recommendation.Recently,personalized news recommendation has become a promising research direction as the Internet provides fast access to real-time information from multiple sources around the world.Existing personalized news recommendation systems strive to adapt their services to individual users by virtue of both user and news content information.A variety of techniques have been proposed to tackle personalized news recommendation,including content-based,collaborative filtering systems and hybrid versions of these two.In this paper,we provide a comprehensive investigation of existing personalized news recommenders.We discuss several essential issues underlying the problem of personalized news recommendation,and explore possible solutions for performance improvement.Further,we provide an empirical study on a collection of news articles obtained from various news websites,and evaluate the effect of different factors for personalized news recommendation.We hope our discussion and exploration would provide insights for researchers who are interested in personalized news recommendation.

  13. News search, blogs and feeds a toolkit

    CERN Document Server

    Vage, Lars


    This book is about news search and monitoring. Aimed at professionals with a strategic need of monitoring the surrounding world, users with a need to find the best news sources, monitoring services and news search strategies and techniques will benefit from reading this book. The main purpose is to present a practical handbook with an analysis of readily available tools, blending with passages of a theoretical nature. It is also useful for students at LIS programmes and related information programmes and for librarians and information professionals. The authors aim to aid the reader in reachin

  14. Understanding Health News (United States)

    ... out potential risks. Slide 11 Is It Real Online News? Or Just Advertising? In April 2011, the Federal Trade Commission warned the public about fake online news sites promoting an acai berry “weight-loss” ...

  15. Disease Outbreak News (United States)

    ... and response operations Diseases Biorisk reduction Disease Outbreak News (DONs) Latest DONs 26 August 2016 Middle East ... Disease outbreaks by country RSS feeds Disease outbreak news Announcement: WHO to change the way it reports ...

  16. Chess endgame news


    Haworth, Guy McCrossan


    News that Bourzutschky confirms there is no sub-7-man pawnless zugzwang, and that Bourzutschky and Konoval are generating DTC EGTs with a new program. News also of Kristensen's work on EGTs using OBDDs, Ordered Binary Decision Diagrams.

  17. News/Press Releases (United States)

    Office of Personnel Management — A press release, news release, media release, press statement is written communication directed at members of the news media for the purpose of announcing programs...

  18. National PKU News (United States)

    ... Support Us Contact Us Donors Search for: National PKU News is dedicated to providing up-to-date, ... and information to families and professionals dealing with phenylketonuria (PKU). A non-profit organization, PKU News was ...

  19. Market News Price Dataset (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Real-time price data collected by the Boston Market News Reporter. The NOAA Fisheries' "Fishery Market News" began operations in New York City on February 14, 1938....

  20. News of the world

    International Nuclear Information System (INIS)

    This document gathers short pieces of news from nuclear industry throughout the world. The most relevant are the following. A micro-crack has been detected in the bottom head instrumentation penetration during the ten-yearly inspection of the unit 1 of the Gravelines nuclear power station. Poland is expected before the end of 2012 to launch a bid of tender for the construction of 2 nuclear power plants of 3000 MW each. The cost of this program is estimated to near 23 billions euros. The Spanish government has allowed the 2 reactors of the Asco plant to operate 10 years more. The Russian company 'Atomstroyexport' will supply the 2 nuclear islands of the 2 new reactors at the Tianwan nuclear power plant (China). Russia is going to build the first nuclear power plant in Bangladesh. Areva has recently discovered 12300 tonnes of uranium in central Jordan. The IAEA experts recommend the Japanese Authorities to decontaminate first the inhabited areas contaminated by the Fukushima accident. It is more important to focus on the real radiation dose received by the population than on the contamination levels of the environment. (A.C.)

  1. News of the world

    International Nuclear Information System (INIS)

    This article reviews the latest news concerning nuclear power in the world. The most significant facts are reported below. The Chinese government has decided to build 4 new nuclear units: 2 on the Sanmen site and 2 on the Lingdong site, works will begin before 2005 in order to have the 2 plants operating by 2010. Switzerland has agreed to join the Kyoto protocol and commits itself to reduce its greenhouse gas emissions by 8% (in relation with the 1990 level) between 2008 and 2012. The European parliament has decided the setting up of CO2 release licenses by january 2005 for the European producers of electric power, heating, steel, cement, glass, bricks, paper and cardboard. This decision will anticipate by 3 years the international system which is planned through the Kyoto protocol. The fifth and last experiment of the Phebus international program concerning core melting will focus on boron carbide which is used in the design of PWR control rods, this experiment will be achieved in 2004. (A.C.)

  2. Haberin Geleceği: Gazetelerle İlgili Bilgi Hizmetlerinin Yapılanması ve Kullanımı / The Future of News: Building and Using Information Services in Connection with Newspapers

    Directory of Open Access Journals (Sweden)

    H. İnci Önal


    Full Text Available The purpose of the present research is to specify the current stand and future of information services in providing news. Libraries and archives that collect newspapers, and supply services to let the readers to have quick and easy access to their contents, increase their activities and in conjunction to this, their experience. As an initial step of the present research, by methods of interviewing and administering questionnaires, Ankara branch office responsible of six nationwide distributed daily newspapers were investigated. Data were compiled about the present situation, provided services, problems to be confronted, and work plans. According to the evaluations, it seems that the developments in information technologies would also impose important tasks to librariesin case of disseminating newspaper information.

  3. Science news release and its benefits to your research


    Chang, You-De


    News release to the latest science findings is beneficial to both researchers and their served institutions as well as the public. It will help to set a bridge of communication between researchers, the public and media, and publishers, making the latest research findings well known to the public. World Journal of Gastroenterology has currently freely opened the News Release Service System (WJG-NRSS) for original articles with potential significance and novelty for news release to mass media t...

  4. Translating news from the inner circle : imposing regularity across languages


    Valdeón, Roberto A.


    This paper examines the effects of using certain translational strategies in the construction of news headlines in the Internet Spanish services of Anglophone news media, namely the BBC, the CNN and the Reuters Agency. The introduction presents a succint discussion of news headline structure, questioning Bell’s view that it is fairly regular across languages (1991). Examples from Spanish and English media will establish differences and we will also compare them with the headlines produced in ...

  5. Library news

    CERN Multimedia

    CERN Library


    The CERN Library has been providing electronic access to the "Techniques de l'Ingénieur" database for the past 8 months. As a reminder, this is a multidisciplinary database of over 4000 technical and scientific articles in French, covering a broad range of topics such as mechanical engineering, safety, electronics and the environment. In a few simple steps, you can create your own account, select the types of documents you are interested in and configure your settings so as to receive alerts when articles in your field of activity are published. You can now access this resource from outside CERN using the "remote access to electronic resources" service. Further information is available here. Direct access to the database. Remote access to electronic resources. If you have any questions or comments, don't hesitate to contact us at:

  6. News & Announcements (United States)


    News from Journal House Perspective on JCE Online Recently a reader asked us for a perspective on JCE Onlinehow the chemical education community is receiving it and how the Journal staff itself views it. We share our responses below. Subscriber Numbers How many people subscribe to JCE Online+? As of June 1, 1999, our records show that 13% of individual JCE subscriptions in the USA include JCE Online+. This percentage has increased significantly during the past year- in June 1998 it was approximately 4% and December 1998 about 7%. Almost all subscribers to JCE Online subscribe to print as well. Since JCE Online has only very recently been made available to institutional subscribers, there are no numbers to report. There has been considerable interest in online from libraries. Given that JCE Online+ is a fairly recent subscriber option and that many subscribers have a wait-and-see approach to any new option, we feel that the numbers above are quite high. The steady growth is encouraging. Online Usage How many people visit our Web site? Statistics for the period January 1, 1999, through May 31, 1999, that may be of interest include: Total Pages Served 361,115 Total Visits 138,377 Total Unique Visitors 51,744 Total Repeat Visitors 11,536 Average Visit Length 03:05 Average Requests/Visit 10.8 Average Pages/Visit 2.6 Average Daily Visits 916 Online Rationale and Expectations JCE Online is a very important part of the whole Journal, but we do not expect it to supplant print: online and print are very different media. Usage of JCE Online is growing steadily; our subscribers are realizing what we have learned: it is not possible to deliver the Journal in the print medium alone- print is no longer adequate to accomplish our mission. Examples of things not possible in print include: ·JCE Index to all 76 years of Journal issues, available all the time with responses within seconds. ·Supplementary materials that are important to only a limited number of our subscribers

  7. Who Makes The News?

    DEFF Research Database (Denmark)

    Jørndrup, Hanne; Bentsen, Martine

    As newsroom staff around the world went about their day on 25 March 2015, hundreds of volunteers located in over 100 countries gathered to monitor their news media as part of the Fifth Global Media Monitoring Project (GMMP). The Global Media Monitoring Project (GMMP) is the world’s longest......-running and most extensive research on gender in the news media. It began in 1995 when volunteers in 71 countries around the world monitored women’s presence in their national radio, television and print news. The research revealed that only 17% of news subjects – the people who are interviewed or whom the...... Danish media. In 2010 women made up 31 % of the news subjects compared to the global average of 24 % women. This year the share of women in news has declined to 25% so Denmark is almost on level with the global average....

  8. News from the world

    International Nuclear Information System (INIS)

    This article gathers pieces of news concerning nuclear industry worldwide from which the following ones. Areva invests in its plant of Creuzot in order to be able to produce in France all the parts of the EPR's (European Pressurized Reactor) reactor vessel. Edf and the China Guangdong Nuclear Power Holding Company (CGNPC) have signed an agreement concerning the construction and the operation of 2 EPRs at Taishan. The United-Kingdom government has launched the procedure for determining the sites that will home new nuclear power plants. The nuclear plant of Belene (Bulgaria) will have 2 VVER reactors and will begin producing electricity in 2013. Brazil plans to commission 60 reactor units in 50 years and South-Korea 10 units by 2030. In 2007 Canada was the first uranium extractor in the world with 9462 tonnes while Australia ranked second (8577 tonnes) and Kazakhstan ranked third (6654 tonnes). The construction of the second (in the world) AP1000 reactor has begun in China. The Kaliningrad nuclear power plant is planned to home 2 new reactor units (2*VVER-1200). The American NRC has received 2 demands, one for the construction of an EPR (at Callaway plant) and the other for the construction of 2 AP1000 in Florida. The work concerning the reinforcing of the sarcophagus around the unit 4 of the Chernobyl plant are completed, a system for the draining of rain water has been installed. The installation deep in the mediterranean sea of the Antares neutrino telescope, equipped with about 900 optical modules, was completed in June 2008. (A.C.)

  9. News of the world

    International Nuclear Information System (INIS)

    This document gathers pieces of news from the nuclear industry around the world. The most relevant are the following. EDF has inaugurated a logistic hub for the supply of spare parts for its 58 operating reactors. Russia has opened a new site to store spent fuels from RBMK reactors. This site is located at Zheleznogorsk near Krasnoiarsk in Siberia. The capacity of the La Hague fuel reprocessing plant is 1700 tonnes a year but the plant processes only between 800 and 1000 tones because most of its foreign contracts have come to an end and have not been renewed. In 2012 the plant is expected to process 1003 tonnes for EDF and 12 tonnes for The Netherlands. AREVA has delivered to the CNNC Chinese company 700 fuel assemblies and 800 control rod clusters. The French Institute for Radioprotection and Nuclear Safety (IRSN) said that there was neither health nor environmental hazards on French soil due to the Fukushima accident. The French Academy of Sciences has highlighted the least sanitary impact of nuclear power compared to other energies. The American Nuclear Safety Association has stated that the American nuclear power plants are safe and that the probability of a severe accident is very low. A new study shows an excess of cases of leukemia near nuclear power stations in France. This study rests on very few statistical cases. An opinion survey in the United Kingdom shows that the construction of nuclear power stations is considered as the best investment in infrastructures. EDF has planned to recruit in 2012 about 6000 people essentially in the nuclear sector. The Netherlands government has given its consent for the construction of the high flux reactor Pallas on the Petten site, this reactor will replace the HFR whose lifetime is over 50 years. (A.C.)

  10. Principles of Multimedia News Systems for Business Applications

    Directory of Open Access Journals (Sweden)

    Ioan I. ANDONE


    Full Text Available In the past few years considerable demand for business oriented multimedia information systems has developed. A multimedia information system is one that can create, import, integrate, store, retrieve, edit, and delete two or more types of media materials in digital form, such as audio, image, full-motion video, and text information. Multimedia information systems play a central role in many business activities. They represent a very special class complex computing systems. This paper surveys a special type of multimedia information systems: multimedia news systems. Multimedia news systems deal with architectures to manage complex multimedia news databases, online presentation and distribution services or the integration of several existing services to meta-services using intelligent news retrieval engines. The leading presentation platform in multimedia news presentation is news networks providing television services and Internet content distribution. The primary focus is on advanced multimedia news systems infrastructure, document standards, application architecture and principles for multimedia news on the Web that suggest long-term trends in this increasingly important area.

  11. The news Engine

    DEFF Research Database (Denmark)

    Andersson, Ralf

    The News Engine How a new experiment in newsrooms can change process, product and people.   By Ralf Andersson   In fall 2012, the news department of the Danish Broadcasting Corporation,decided to implement a new workflow called ”The News Engine” - in order to workfaster, more freely, flexible and......: ever-increasingimportant part of the news broadcasting. -      Mediaconvergence/multimedia skills: live reporters now produce for all platforms. -      Cooperation: the ability todeliver accurate information to colleagues and work together, share andcommunicate is becoming increasingly important, since...

  12. Education for a Culture of Peace: The Culture of Peace News Network as a Case Study (United States)

    Adams, David


    The Culture of Peace News Network, an internet news service, is analyzed in the framework of a general approach to education for a culture of peace. Its format reflects the eight program areas for a culture of peace as adopted by the UN General Assembly. Among its other operating principles are universality of news with all cultures and regions of…

  13. Mobile news - a review and model of journalism in an age of mobile media

    DEFF Research Database (Denmark)

    Westlund, Oscar


    -related content and services began to flourish. Accessing mobile news has gained traction in the everyday life of the public. In parallel, legacy news media have in recent years developed news provision, by repurposing or customising journalistic content published for mobile sites and/or applications. This...

  14. "Offline": the 2004 European parliamentary elections on television news in the enlarged Europe

    NARCIS (Netherlands)

    C.H. de Vreese; S.A. Banducci; H.A. Semetko; H.G. Boomgaarden


    We outline the competitive television news market in the enlarged European Union (EU) and demonstrate the continued importance of traditional media, in particular television, in the context of proliferation in choice of news sources, including on-line news services. Drawing upon a content analysis o

  15. "Off-line": the 2004 European parliamentary elections on television news in the enlarged Europe

    NARCIS (Netherlands)

    Vreese, de Claes H.; Banducci, Susan A.; Semetko, Holli A.; Boomgaarden, Hajo G.


    We outline the competitive television news market in the enlarged European Union (EU) and demonstrate the continued importance of traditional media, in particular television, in the context of proliferation in choice of news sources, including on-line news services. Drawing upon a content analysis o

  16. Swisster – a news website for Anglophones

    CERN Multimedia


    Employees of CERN can now sign up for a free account at, an English language website devoted to Swiss news and current affairs. « prev next » The website, which is aimed at English speakers in Switzerland, normally requires an annual subscription of 300 CHF, but has teamed up with sponsors to offer a free subscription for CERN employees. The service provides a daily newsletter containing the main news and other information sent to subscribers every working day. The Swisster website also offers a variety of services such as health, education and food forums called "corners", as well as weather & snow forecasts, blogs and even a TV guide for Anglophones. The editorial team of English-speaking journalists is based in Lausanne, Geneva, Zurich and Neuchatel and covers news for expatriates and English speakers living and working in Switzerland. also has a Saturday morning radio show from 08:30 to 09:30, on Radio Cit�...

  17. Good And Bad News

    Institute of Scientific and Technical Information of China (English)


    <正>A distinguished scientist was participating in a panel discussion on the results of the nation’s future water supply.“Gentlemen,” he said.“I have some good news and bad news for you,Our study shows that by the year 2010 everyone will be drinking recycled sewage from

  18. With News Search Engines (United States)

    Gunn, Holly


    Although there are many news search engines on the Web, finding the news items one wants can be challenging. Choosing appropriate search terms is one of the biggest challenges. Unless one has seen the article that one is seeking, it is often difficult to select words that were used in the headline or text of the article. The limited archives of…

  19. Routinizing Breaking News

    DEFF Research Database (Denmark)

    Hartley, Jannie Møller


    This chapter revisits seminal theoretical categorizations of news proposed three decades earlier by US sociologist Gaye Tuchman. By exploring the definition of ”breaking news” in the contemporary online newsrooms of three Danish news organisations, the author offers us a long overdue re-theorizat...


    Directory of Open Access Journals (Sweden)

    Heloiza G. Herckovitz


    Full Text Available A content analysis of four Brazilian news media portals found that economic news dominated the top headlines with little attention paid to education, the environment and welfare. Other trends included a focus on local events and national news sources, reliance on few sources, mostly official ones, and a low percentage of news that fitted the concept of newsworthiness (a combination of both social significance and deviance concepts. Other findings of a study of 432 top news stories published by UOL, Estadão, iG and Terra during a 15-day period between February and March 2008 indicate that the top portions of the portals’ front pages carry news that lacks story depth, editorial branding, and multimedia applications. The results suggest that online news portals are in their infancy although Brazil has the largest online population of Latin America. This study hopes to shed light on the gatekeeping process in Brazilian news portals. Brazilian media portals have yet to become a significant editorial force able to provide knowledge about social issues and public affairs in a socially responsible fashione.

  1. Good Friends, Bad News

    DEFF Research Database (Denmark)

    Hansen, Lars Kai; Arvidsson, Adam; Nielsen, Finn Årup;

    is different from email in that retweeting does not depend on pre-existing social relations, but often occur among strangers, thus in this respect Twitter may be more similar to traditional news media. We therefore hypothesize that negative news content is more likely to be retweeted, while for non-news tweets...... the NY Times finds a strong link between positive affect and virality, and, based on psychological theories it is concluded that this relation is universally valid. The conclusion appears to be in contrast with classic theory of diffusion in news media emphasizing negative affect as promoting propagation....... In this paper we explore the apparent paradox in a quantitative analysis of information diffusion on Twitter. Twitter is interesting in this context as it has been shown to present both the characteristics social and news media. The basic measure of virality in Twitter is the probability of retweet. Twitter...

  2. Ranking a Stream of News


    Del Corso, Gianna; Gulli, Antonio; Romani, Francesco


    searching on news is one of the most important activity on line. Indeed, Google, Yahoo, MSN and many others have proposed commercial search engines for indexing news feeds. Despite this commercial interest, no academic research has focused on ranking a stream of news and a set of news sources. In this paper, we introduce this problem by proposing a ranking framework which models: (1) the process of news stream generation, (2) the news clustering by topics, and (3) the evolution of news over t...

  3. Breaking News as Radicalisation

    DEFF Research Database (Denmark)

    Hartley, Jannie Møller

    The aim of the paper is to make explicit how the different categories are applied in the online newsroom and thus how new categories can be seen as positioning strategies in the form of radicalisations of already existing categories. Thus field theory provides us with tools to analyse how online...... journalists are using the categorisations to create hierarchies within the journalistic field in order to position themselves as specialists in what Tuchman has called developing news, aiming and striving for what today is know as breaking news and the “exclusive scoop,” as the trademark of online journalism...... in a media environment where immediacy rules (Domingo 2008a). Following this research the primary focus of this paper is the category breaking news and Tuchmans developing news, but as they are all connected the analysis will also draw upon the other categories in Tuchmans typology. The theoretical...

  4. Agency and civic involvement in news production via Facebook commentary

    DEFF Research Database (Denmark)

    Eberholst, Mads Kæmsgaard; Hartley, Jannie Møller

    Social media services such as Facebook, Twitter and Youtube, where users create and share content, has become a large part of most peoples everyday digital life and equally media companies has realised that these services plays a great role in peoples news con-sumption pattern. On these services...

  5. Making Radio Waves: Tune in to These Tips for Getting Your Campus News on the Air. (United States)

    Stubbee, Melinda


    Radio is a relatively simple and effective way to make campus news and information available to the public. Establishing a college radio news service is not difficult, and developing a sound-bite service requires little equipment or expertise, just careful attention to quality and technique. More sophisticated systems can be developed easily. (MSE)

  6. Science news release and its benefits to your research

    Institute of Scientific and Technical Information of China (English)


    News release to the latest science findings is beneficial to both researchers and their served institutions as well as the public. It will help to set a bridge of communication between researchers, the public and media, and publishers, making the latest research findings well known to the public. World Journal of Gastroenterology has currently freely opened the News Release Service System (WJG-NRSS) for original articles with potential significance and novelty for news release to mass media to broaden the findings to the public.

  7. News | Division of Cancer Prevention (United States)

    News about scientific advances in cancer prevention, program activities, and new projects are included here in NCI press releases and fact sheets, articles from the NCI Cancer Bulletin, and Clinical Trial News from the NCI website.

  8. Creative Cycling of News Professionals


    Astrid Gynnild, PhD.


    The theory of creative cycling emerged from my PhD study of news professionals in Norway. The study was carried out according to classic grounded theory principles (Glaser and Strauss 1967, Glaser 1978, 1998, 2001, 2005), and the area of interest was the performance of news journalism in the multimedia age. The theory runs counter to widespread tendencies of industrial age thinking in news media. It emphasizes news professionals’ search for meaning in their daily work, and suggests that their...

  9. Googling the news

    DEFF Research Database (Denmark)

    Ørmen, Jacob


    Search engines provide a window into the changing association between websites and keywords across cultures and countries and over time. As such, they offer journalism and news researchers an opportunity to study how search engines, in this case Google, mediate news events and stories online....... However, search results are not straightforward to study. Since search results are made in the act of searching and will have to be retrieved from Google Search in real-time, there is a range of different ontological and methodological issues related to this data source. This paper addresses these issues...

  10. Automatic Association of News Items. (United States)

    Carrick, Christina; Watters, Carolyn


    Discussion of electronic news delivery systems and the automatic generation of electronic editions focuses on the association of related items of different media type, specifically photos and stories. The goal is to be able to determine to what degree any two news items refer to the same news event. (Author/LRW)

  11. Communications and media services (United States)

    Mcculla, James W.; Kukowski, James F.


    NASA's internal and external communication methods are reviewed. NASA information services for the media, for the public, and for employees are discussed. Consideration is given to electron information distribution, the NASA TV-audio system, the NASA broadcast news service, astronaut appearances, technology and information exhibits, speaker services, and NASA news reports for internal communications. Also, the NASA worldwide electronic mail network is described and trends for future NASA communications and media services are outlined.

  12. What's unusual in online disease outbreak news?

    Directory of Open Access Journals (Sweden)

    Collier Nigel


    Full Text Available Abstract Background Accurate and timely detection of public health events of international concern is necessary to help support risk assessment and response and save lives. Novel event-based methods that use the World Wide Web as a signal source offer potential to extend health surveillance into areas where traditional indicator networks are lacking. In this paper we address the issue of systematically evaluating online health news to support automatic alerting using daily disease-country counts text mined from real world data using BioCaster. For 18 data sets produced by BioCaster, we compare 5 aberration detection algorithms (EARS C2, C3, W2, F-statistic and EWMA for performance against expert moderated ProMED-mail postings. Results We report sensitivity, specificity, positive predictive value (PPV, negative predictive value (NPV, mean alerts/100 days and F1, at 95% confidence interval (CI for 287 ProMED-mail postings on 18 outbreaks across 14 countries over a 366 day period. Results indicate that W2 had the best F1 with a slight benefit for day of week effect over C2. In drill down analysis we indicate issues arising from the granular choice of country-level modeling, sudden drops in reporting due to day of week effects and reporting bias. Automatic alerting has been implemented in BioCaster available from Conclusions Online health news alerts have the potential to enhance manual analytical methods by increasing throughput, timeliness and detection rates. Systematic evaluation of health news aberrations is necessary to push forward our understanding of the complex relationship between news report volumes and case numbers and to select the best performing features and algorithms.

  13. 78 FR 32226 - Poultry Market News Reports; Request for Extension and Revision of the Currently Approved... (United States)


    ... production, purchasing, and sales decisions. LPGMN reports also promote orderly marketing by placing buyers...; ] DEPARTMENT OF AGRICULTURE Agricultural Marketing Service Poultry Market News Reports; Request for Extension...: Agricultural Marketing Service, USDA. ACTION: Request for comments. SUMMARY: In accordance with the...

  14. Veterans' Employment and Training Service (United States)

    ... RSS Email Share Veterans' Employment and Training Service (VETS) Menu About VETS Who We Are & What We ... VETERANS SERVICE PROVIDERS TRANSITIONING SERVICE MEMBERS WOMEN VETERANS VETS NEWS & BLOG September 2, 2016 Veteran Unemployment Continues ...

  15. From Popularity Prediction to Ranking Online News


    Tatar, Alexandru; Antoniadis, Panayotis; Dias De Amorim, Marcelo; Fdida, Serge


    News articles are an engaging type of online content that captures the attention of a significant amount of Internet users. They are particularly enjoyed by mobile users and massively spread through online social platforms. As a result, there is an increased interest in discovering the articles that will become popular among users. This objective falls under the broad scope of content popularity prediction and has direct implications in the development of new services for online advertisement...

  16. News from Academy Bay



    The 25th anniversary of the Galapagos National Park. Fire at the Darwin Research Station. The control of introduced mammals. Good news about the Hood tortoises. The endangered land iguanas. Penguins, cormorants and flamingos in 1984. A workshop on national parks. International conservation award to Secretary Ripley. Visits and events at the Charles Darwin Research Station.

  17. News of the Year. (United States)

    St. Lifer, Evan; Olson, Renee; Milliot, Jim; Bing, Jonathan


    Reviews library news for 1997. Highlights public library budgets, examined by number of patrons served; Internet filters and censorship; librarians and the media; private and government funding sources; outsourcing; expectations for growth in the publishing industry, emphasizing the Asian economic crisis; and new ideas from the next generation of…

  18. BBC Breakfast News


    Swann, David


    Dr David Swann Interviewed on BBC Breakfast News by business correspondent Steph McGovern about his 'Design of the Year' nomination- the ABC Syringe. BBC Breakfast is the UK’s most watched morning programme with an average daily audience of 6.8m.

  19. Spreading the News

    Institute of Scientific and Technical Information of China (English)


    For all the progress in establishing a government news release system in China, the State Council Information Office acknowledges there is still much room for improvement Being a government spokesperson anywhere in the world is no easy job. It is particularly the case in China, where there is legislation in place on government information release. Cai Wu, Minister of the State Council Information Office,

  20. Irish Chemical News


    Roche, James J.; Franklin, Margaret; Hobbs, Patrick; Hodnett, Kieran; Cantwell, Helen; Bradley, Derek; Burke, Mary


    Contents: A Message from the President p.3 -- Editorial p.5 -- Polymorphic Transformations in Pharmaceutical Compounds p.7 -- Navigating the Challenges of Method Validation –with a little help from Eurachem p.24 -- Obituary: Professor Richard Butler NUI Galway, February 10th, 2016 p.30 -- Congress 2016: Chemistry and Society, GMIT p.34 -- Characterisation of Biopharmaceuticals p.40 -- Industry & Business news p.78.

  1. A special broadcast of CERN's Video news

    CERN Multimedia


    A special edition of CERN's video news giving a complete update on the LHC project is to be broadcast in the Main Auditorium. After your lunch make a small detour to the Main Auditorium, where you see the big picture. On 14, 15 and 16 May, between 12:30 and 14:00, a special edition of CERN's video news bulletin will be broadcast in the Main Auditorium. You will have the chance get up-to-date on the LHC project and its experiments. With four years to go before the first collisions in the LHC, the LHC Project Leader Lyn Evans will present a status report on the construction of the accelerator. The spokesmen of the five LHC experiments (ALICE, ATLAS, CMS, LHCb and TOTEM) will explain how the work is going and what the state of play will be in four years' time. This special video news broadcast is the result of collaboration between the CERN Audiovisual Service, the Photo Service and the External communication section. The broadcast will begin with a brand-new programme title sequence. And just as in the real c...


    Blaeser, Susan B; Struck, Christopher J


    American National Standards (ANSI Standards) developed by Accredited Standards Committees S1, S2, S3, S3/SC 1, and S12 in the areas of acoustics, mechanical vibration and shock, bioacoustics, animal bioacoustics, and noise, respectively, are published by the Acoustical Society of America (ASA). In addition to these standards, ASA publishes a catalog of Acoustical American National Standards. To receive a copy of the latest Standards catalog, please contact Susan B. Blaeser.Comments are welcomed on all material in Acoustical Standards News.This Acoustical Standards News section in JASA, as well as the National Catalog of Acoustical Standards and other information on the Standards Program of the Acoustical Society of America, are available via the ASA home page: PMID:27036268

  3. Benchmarking news recommendations: the CLEF NewsREEL use case


    Hopfgartner, Frank; Brodt, Torben; Seiler, Jonas; Kille, Benjamin; Lommatzsch, Andreas; Larson, Martha; Turrin, Roberto; Serény, Andrá


    The CLEF NewsREEL challenge is a campaign-style evaluation lab allowing participants to evaluate and optimize news recommender algorithms. The goal is to create an algorithm that is able to generate news items that users would click, respecting a strict time constraint. The lab challenges participants to compete in either a "living lab" (Task 1) or perform an evaluation that replays recorded streams (Task 2). In this report, we discuss the objectives and challenges of the NewsREEL lab, summar...

  4. NetWorking News

    DEFF Research Database (Denmark)

    Fritsch, Jonas; Iversen, Ole Sejer; Dindler, Christian;

    with adults or children. However there is a need for new methods to support communication and collaboration between designers and children. This article proposes a new method for understandings children’s appropriation of new technology in an interactive workshop setting. The method, which we call...... the Networking News workshop, offers an opportunity to make first hand studies of children’s IT supported social activities in an informal classroom setting....

  5. News of nuclear engineering

    International Nuclear Information System (INIS)

    Data on news of nuclear engineering in Bulgaria, Pakistan, Serbia, USA, South Africa, South Korea and Japan are presented. Problems of reactor safety, construction of new nuclear units at existing sites, highly enriched uranium removal are treated. Companies performing jobs on designing, manufacture of different nuclear reactor components are named. Questions of environment protection, timely information on accidents at NPP and qualified maintenance are discussed

  6. Contact: Releasing the news (United States)

    Pinotti, Roberto

    The problem of mass behavior after man's future contacts with other intelligences in the universe is not only a challenge for social scientists and political leaders all over the world, but also a cultural time bomb as well. In fact, since the impact of CETI (Contact with Extraterrestrial Intelligence) on human civilization, with its different cultures, might cause a serious socio-anthropological shock, a common and predetermined worldwide strategy is necessary in releasing the news after the contact, in order to keep possible manifestations of fear, panic and hysteria under control. An analysis of past studies in this field and of parallel historical situations as analogs suggests a definite "authority crisis" in the public as a direct consequence of an unexpected release of the news, involving a devastating "chain reaction" process (from both the psychological and sociological viewpoints) of anomie and maybe the collapse of today's society. The only way to prevent all this is to prepare the world's public opinion concerning contact before releasing the news, and to develop a long-term strategy through the combined efforts of scientists, political leaders, intelligence agencies and the mass media, in order to create the cultural conditions in which a confrontation with ETI won't affect mankind in a traumatic way. Definite roles and tasks in this multi-level model are suggested.

  7. Networks in the news media

    DEFF Research Database (Denmark)

    Bro, Peter

    When news reporters connect people in a single news story or in a series of coherent news stories they essentially construct networks in the news media. Networks through which social actors are aligned symbolically in written, visible or audible form. These socio-symbolic networks not only copy...... more formal types of social networks, but also complement or even substitute social networking elsewhere, and as such this particular type of social network offers people both inside and outside the news room new potentials - and problems. This article describe the basic vision of networks in the news...... media and discuss the importance of this analytical framework when it comes to understanding prevailing forms and norms in contemporary journalism....

  8. News media old and new

    DEFF Research Database (Denmark)

    Schrøder, Kim Christian


    This article presents and discusses three different approaches to the exploration of the cross-media challenges facing news audiences, as they seek access to, navigate in and make sense of the multitude of news sources across print, broadcasting, online and mobile media platforms. From a modernized...... uses and gratifications perspective, based on the notion of “worthwhileness” as the determinant of people's everyday selections from the “supermarket of news”, the article first reports from a longitudinal survey study in Denmark in which the author's foundational mapping of cross-media news...... consumption in pre-mobile 2008 is compared with replicating mappings carried out in 2011 and 2012, in a collaborative project between academics and news publishers. The analytical interest here focuses on the fluctuations between traditional news media and the surging digital news outlets of the internet and...

  9. News and Announcements (United States)


    1998 ACS Meeting in Boston he suffered a serious fall following a stroke, from which he never recovered. One of his last photographs, taken the previous day at a Journal luncheon, appears on page 1360 of the November 1998 issue. His commentary on his long career in chemistry and education appears on page 1520 of the December 1998 issue. Seaborg was a Nobel laureate, discoverer of elements, scientific advisor to presidents, former chancellor of the University of California, former chairman of the Atomic Energy Commission, chairman of the steering committee of the CHEM Study project, founder of Lawrence Hall of Science, , the list goes on and on. He was at the same time a passionate supporter of education. Seaborg published fourteen articles in the Journal between 1951 and 1998. He was interviewed in 1975 by David Ridgway as part of the Impact series (JCE 1975, 52, 70), and that interview is highly recommended reading (see supplement to this article). He received the 1994 ACS George C. Pimentel Award in Chemical Education; his award address was published in the ACS Division of Chemical Education's CHED Newsletter, Fall 1995. Memorial articles with details of his life and his scientific contributions have appeared in The New York Times (Saturday, February 27, 1999, page 1) and Chemical & Engineering News (March 8, 1999, page 29). But there is also the spirit of the man, what he believed in, what he tried to do, what he hoped he had accomplished. A sense of that can be gained from the excerpts that are reprinted below, taken first from the Impact interview and then from the award address. Ridgway: On reflection, now, out of your many contributions to chemistry, is there one that you feel has had more of an impact than others? Seaborg: The discovery of plutonium would answer that question. The impact there is probably nearly as great as any single chemical discovery. Ridgway: What was the state of the "art" in your field when you first decided to bend your energies in this

  10. Query-free news search


    Henzinger, Monika; Chang, Bay-Wei; Milch, Brian; Brin, Sergey


    Many daily activities present information in the form of a stream of text, and often people can benefit from additional information on the topic discussed. TV broadcast news can be treated as one such stream of text; in this paper we discuss finding news articles on the web that are relevant to news currently being broadcast.We evaluated a variety of algorithms for this problem, looking at the impact of inverse document frequency, stemming, compounds, history, and query length on the re...

  11. An argument-based approach to cope with trust and pluralism in web news reports


    Sagui, Fernando M.; Chesñevar, Carlos Iván; Maguitman, Ana Gabriela; Simari, Guillermo Ricardo


    Due to the huge amount of multi-source news that are available on the Web at any time, it is crucial to provide intelligent mechanisms to select and rank news reports. Over the last few years, a number of approaches based on criteria such as freshness, relevance and viewer profile have been proposed. However, most existing news processing services do not deal with credibility from a qualitative perspective, and do not provide mechanisms to cope with controversial news reports. To fill this ga...

  12. News-Based Group Modeling and Forecasting


    Zhang, Wenbin; Skiena, Steven


    In this paper, we study news group modeling and forecasting methods using quantitative data generated by our large-scale natural language processing (NLP) text analysis system. A news group is a set of news entities, like top U.S. cities, governors, senators, golfers, or movie actors. Our fame distribution analysis of news groups shows that log-normal and power-law distributions generally could describe news groups in many aspects. We use several real news groups including cities, politicians...

  13. PUSHED NEWS: When the news comes to the cellphone

    Directory of Open Access Journals (Sweden)

    Antonio Fidalgo


    Full Text Available Combining two findings of recent surveys on the Internet whichstate that 1 “the Internet will soon surpass all other media as a main source for national and international news” and 2 “the mobile device will be the primary connection tool to the Internet in 2020” leads us to the conclusion that smartphones will soon be the primary source for news access. But if so, how will news come to the Internetconnected cellphones? In accordance with the distinction, already drawn in 1997, between push and pull technologies as two different forms of how content is delivered to the end users, cellphones are characterized as push devices (passive reception, in opposition to computers, classified as pull devices (active reception. The news items that fit cellphones are pushed news. And they will be pushed as SMS, e-mails, tweets and through news aggregators.


    Directory of Open Access Journals (Sweden)

    Allan Bell


    Full Text Available This paper traces the development of news discourse across the 20th century ihrough a case study ofthe coverage of three expeditions to the South Pole: Captain Scott in 1912, Sir Edmund Hillary in 1958, and Peter Hillary in 1999. The way the news about the three expeditions reached New Zealand media serves as a framework and an illustration to examine three related issues: how technology has changed the time and place dimensions of news delivery; the consequent and concomitant shifts in news presentation; and associated changes in how humans have understood time and place. News values remain the same at a broad level across the century, but different in detail. Nationalism is obtrusive, but its focus shifts. In news practice, the deadline and the scoop drive the news in al1 three periods, but the scooping medium shifts from press to radio to television. The lapse between an event and its reporting shrinks exponentially from months to hours to minutes. The design of newspaper front pages changes radically, and news language compresses. There are social impacts, with newsworthy figures receiving closer exposure and the audience being cast in a more voyeuristic role.

  15. Translation in Global News Agencies


    Ben Othman, Zeineb


    The work is divided into two parts. The 1st part is the translation of Chapter One "Power language and translation" and the Chapter Four "Translation in Global News Agencies". The 2nd part is about the characteristics and theories of translation particularly in News Agencies and Institutions as well as the difficulties I found in the translation of a specialized book.

  16. School Violence and the News (United States)

    ... 5 Things to Know About Zika & Pregnancy School Violence and the News KidsHealth > For Parents > School Violence and the News Print A A A Text ... la escuela y las noticias Incidents of school violence are terrible and frightening, but fortunately they are ...

  17. What Turns Events into News? (United States)

    Tukachinsky, Riva


    "The New York Times" is known for its slogan ''All the News That's Fit to Print.'' But how do gatekeepers decide which events meet this criterion? Although some individuals might believe that the news constitutes an undistorted reflection of the social reality, students in communication courses have the…

  18. Getting Out the Good News. (United States)

    Paciancia, David


    A majority of American schools are meeting the challenge of educating children. A New York State district gets out the good news by producing school newsletters and videos, by constant and close contact with the local news media, and by forming ties with local real estate agents. (MLF)

  19. CERN Video News on line

    CERN Document Server


    The latest CERN video news is on line. In this issue : an interview with the Director General and reports on the new home for the DELPHI barrel and the CERN firemen's spectacular training programme. There's also a vintage video news clip from 1954. See: or Bulletin web page

  20. What's APPening to news? A mixed-method audience-centred study on mobile news consumption


    Van Damme, Kristin; Courtois, Cédric; Verbrugge, Karel; De Marez, Lieven


    News is increasingly being consumed on a multitude of media devices, including mobile devices. In recent years, mobile news consumption has permeated individuals’ news consumption repertoires. The main purpose of this study is twofold: (1) gain insight in how mobile news outlets infiltrated the broader news media repertoires of mobile device owners and (2) understand in what circumstances mobile news is consumed within these news media repertoires. The key is to understand how and why this wi...

  1. Climate News Across Media Platforms

    DEFF Research Database (Denmark)

    Eskjær, Mikkel Fugl


    change news on five different media platforms: newspapers, television, radio, web-news and mobile news. It investigates the themes and actors represented in public climate change communication as well as the diverse possibilities of participating in public debates and information sharing. By combining......In a changing media landscape marked by technological, institutional and cultural convergence, comparative and cross-media content analysis represents a valuable analytical tool in mapping the diverse channels of climate change communication. This paper presents a comparative study of climate...... quantitative and qualitative content analysis the paper documents and explores the extent and character of climate change news across different media platforms. The study aims at contributing to the on-going assessment of how news media are addressing climate change at a time when old and new media are...

  2. Early Telegraphic News Dispatches: The Forerunner of the AP. (United States)

    Schwarzlose, Richard A.

    The origin of the Associated Press (AP) lies in the early cooperative news gathering efforts of the editors of several New York newspapers. As early as May 1846, these editors were "pooling" their energies in response to newly developed modes of communication--the wire and wireless telegraph and the trans-oceanic steamship mail services. The…

  3. "I Have Good News and Bad News:" The Effects of Power Imbalances and Physical Distance on News-givers' Use of Blended News Delivery


    Legg, Angela M.


    People dislike giving bad news, and one strategy they use to ease the process is to pair bad news with some good news, a phenomenon called blended news delivery. Often, blended news arrives from people in power positions such as physicians, managers, or teachers. But followers also find themselves needing to give bad news to those in higher power positions. Similarly, people can choose how they deliver bad news, such as in person or over email. The current study brings much needed empirical a...

  4. A Contextual-Bandit Approach to Personalized News Article Recommendation

    CERN Document Server

    Li, Lihong; Langford, John; Schapire, Robert E


    Personalized web services strive to adapt their services (advertisements, news articles, etc) to individual users by making use of both content and user information. Despite a few recent advances, this problem remains challenging for at least two reasons. First, web service is featured with dynamically changing pools of content, rendering traditional collaborative filtering methods inapplicable. Second, the scale of most web services of practical interest calls for solutions that are both fast in learning and computation. In this work, we model personalized recommendation of news articles as a contextual bandit problem, a principled approach in which a learning algorithm sequentially selects articles to serve users based on contextual information about the users and articles, while simultaneously adapting its article-selection strategy based on user-click feedback to maximize total user clicks. The contributions of this work are three-fold. First, we propose a new, general contextual bandit algorithm that is ...

  5. Targeted News in an Intranet


    Chen, Lisan; Schiller Shi, Tingting


    In SharePoint 2013, Microsoft added a social networking function in the personal sites (My Site) of a user. In this version, a personal news feed has been added which shows events regarding subjects the user follows, such as document changes, user updates, tagged posts, and site activities. The purpose of the thesis is to investigate whether or not it is possible to extend the news feed function by adding an independent component as part of My Site, to allow users to follow corporate news by ...

  6. Social Media News: Motivation, Purpose and Usage


    Samaneh Beheshti-Kashi; Baharak Makki


    This paper presents the results of an online survey which was conducted to analyse the use of social web inthe context of daily news. Users’ motivation and habit in the news consumption were focused. Moreover,users’ news behaviour was distinguished in three purposes such news consumption, news production andnews dissemination to find out if the usage has a passive or active character. In a second step it wasquestioned which social software is used for which purpose. In conclusion users apprec...

  7. Time scarcity and the market for news


    Alaoui, Larbi; Germano, Fabrizio


    We develop a theory of news coverage in environments of information abundance that include both new and traditional news media, from online and print newspapers to radio and television. News consumers are time-constrained and browse through news items that are available across competing outlets, choosing which outlets to access and which stories to read or skip. Media firms are aware of consumers? preferences and constraints, and decide on rankings of news items that maximize thei...

  8. Increasing Learning from TV News. (United States)

    Perloff, Richard M.; And Others


    Describes an experiment that manipulated two variables, repetition and pausing for viewer "digestion" of information in a news telecast. Concludes that the use of repetition increased viewers' retention of information, but that pauses did not. (FL)


    Directory of Open Access Journals (Sweden)

    Lluís Mas Manchón


    Full Text Available Rhythm is central to news reading in radio and television programs. This paper proposes a three level structure for rhythm in news discourse. It gives a comprehensive definition of rhythm and types of rhythm. Firstly, the Base Rhythm Structure consists of semantic and pragmatic rhythmic accents, coincident with very specific words. Secondly, these accents are grouped together according to type, frequency and order, thereby configuring three types of “rhythmic units” (the Internal Rhythm Structure: starting, main and end units. A last structure level presents four discursive factors that are very important in integrating the overall time structure of news announcing (the Melodic Rhythm Structure. This integral structure for news announcing rhythm should be further tested in acoustic-experimental studies under the criterion of information transmission efficacy.

  10. Overview of CLEF NewsREEL 2015: News Recommendation Evaluation Lab


    Kille, Benjamin; Lommatzsch, Andreas; Turrin, Roberto; Sereny, Andras; Larson, Martha; Brodt, Torben; Seiler, Jonas; Hopfgartner, Frank


    News reader struggle as they face ever increasing numbers of articles. Digital news portals are becoming more and more popular. They route news items to visitors as soon as they are published. The rapid rate at which new news is published gives rise to a selection problem, since the capacity of new portal videos to absorb news is limited. To address this problem, new portals deploy news recommender systems in order to support their visitors in selecting items to read. This p...

  11. No News in Business Cycles


    Forni, Mario; Gambetti, Luca; Sala, Luca


    This paper uses a structural, large dimensional factor model to evaluate the role of 'news' shocks (shocks with a delayed effect on productivity) in generating the business cycle. We find that (i) existing small-scale VECM models are affected by 'non-fundamentalness' and therefore fail to recover the correct shock and impulse response functions; (ii) news shocks have a limited role in explaining the business cycle; (iii) their effects are in line with what predicted by standard neoclassical t...

  12. The Spirit of Public Service

    DEFF Research Database (Denmark)

    Hassall Thomsen, Line Hassall; Willig, Ida

    cultural production and news work. Through fieldwork and interviews with Danish and British reporters/editors from DR 1, TV 2, BBC 1 and ITV we identify three components of a strong public service spirit present in the journalist’s understanding of the self: mass audience orientation, democratic...... depending on the organisational culture of the news cooperation....

  13. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun


    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  14. New Bulletin: Latest News

    CERN Multimedia


    The paper version of the CERN Bulletin will be published twice a month with effect from 18 April 2005. The electronic version will be updated weekly. This year will see many changes in the Bulletin, designed to make it more economical, more compact and more attractive. From 18 April the paper version of the Bulletin will be published twice monthly, so we shall have to stop calling it the "Weekly". The purpose of this change in publication frequency is to redistribute the resources of the Publications Section of the Communications Group so that it can produce new brochures for the general public. However, so as not to compromise on topicality and communication of information, the Official News and General Information sections, the Pension Fund and training announcements and the seminar schedule will continue to be updated weekly. If you have signed up to be informed of the updates, you will continue to receive a weekly e-mail reminding you that the electronic version of the Bulletin has been updated. Offici...

  15. News from Council

    CERN Document Server


    With this message I would like to share with you some highlights of this week’s Council meetings.   A major topic was the approval of CERN’s Medium Term Plan (MTP) 2017-2021, along with the budget for 2017. In approving the document, Council expressed its very strong support for the research programme the MTP outlines for the coming years.  Another important topic this week was the formal approval of the High Luminosity LHC project, HL-LHC. This comes as extremely good news not only for CERN, but also for particle physics globally. HL-LHC is the top priority of the European Strategy for Particle Physics in its 2013 update, and is part of the 2016 roadmap of the European Strategy Forum on Research Infrastructures, ESFRI. It was also identified as a priority in the US P5 strategy process, and in Japan’s strategic vision for the field. It secures CERN’s future until 2035, and ensures that we will achieve the maximum scientific return on the investment...

  16. Translation Strategies on English Sports News

    Institute of Scientific and Technical Information of China (English)

    张金柱; 冷冰冰


    With the improvement of people's life, sports has become an indispensable part of our life, which promotes sports news. Besides, sports news is one of the most significant way to promote cultural communication and enhance mutual understanding. Thus, sports news has an increasing role in the communication between China and outside world due to its unique advantages. Therefore, sports news translation has great practical and theoretical significance in today's society. with the analysis on the function and characteristics of the sports news, This thesis studies the sports news translation and proposes some practical translation skills.

  17. The Translation of English News Headlines

    Institute of Scientific and Technical Information of China (English)

    Ma Xiaona


    News headline translation is one of the most important types of news translation. As news headline is strongly purposeful, the translation of it must be achieved by some special methods. The history of news headline translation is almost as long as that of newspapers, but it has not been attached enough attention to. In the last twenty years, Chinese scholars of this field have paid much greater attention to news headline translation. Concerned studies of principles of news headline translation have also been made remarkable progress.

  18. News of the world

    International Nuclear Information System (INIS)

    In 1998 the Russian government adopted a development program concerning nuclear energy for the 1998-2005 period, this program was poorly funded. In 2000 the situation changed considerably because Russian nuclear experts stated that the major problems facing the electricity sector could be solved by the use of nuclear energy. Minatom has presented the future of nuclear energy in Russia according to the evolution of the utilization ratio of nuclear plants and the extension of the operating life of a nuclear reactor. According to independent experts, this new program lacks financial support unless sites where important investment had already been made, are chosen. Russia can rely on 12 such sites. Since 1995 the mean utilization ratio of Russian plants has been steadily increasing to reach 72% in 2000 whereas it was as low as 53.2% in 1995. (A.C.)

  19. News and Announcements (United States)


    1999 EAS Awards The Eastern Analytical Symposium (EAS) announces the winners of their 1999 awards, which will be presented during their annual meeting, to be held November 14-19, 1999, at the Garden State Convention Center in Somerset, NJ. ACS Analytical Chemistry Division, Findeis Young Investigator Award David Clemmer, Indiana University EAS Award for Achievements in Separation Science Milton L. Lee, Brigham Young University EAS Award for Achievements in Near-Infrared Spectroscopy Phil Williams, Grain Research Laboratory, Winnipeg, Canada EAS Award for Achievements in Magnetic Resonance Frank A. L. Anet, University of California, Los Angeles (Emeritus) EAS Award for Outstanding Achievements in the Fields of Analytical Chemistry Catherine Fenselau, University of Maryland at College Park Galactic Industries Award for Achievements in Chemometrics Harald Martens, Norwegian University of Science and Technology Proposal Deadlines National Science Foundation Division of Undergraduate Education (DUE) Course, Curriculum, and Laboratory Improvement (CCLI) June 7, 1999 NSF Collaboratives for Excellence in Teacher Preparation (CETP) Preliminary proposals, Track 1 May 1, 1999 Formal proposals, Track 1 September 1, 1999 DUE online 1999 guidelines, NSF 99-53 available at For further information about NSF DUE programs consult the DUE Web site, Program deadlines are at . To contact the DUE Information Center, phone: 703/306-1666; email: The Camille and Henry Dreyfus Foundation, Inc. Camille Dreyfus Teacher-Scholar Awards Program: November 16, 1998 Henry Dreyfus Teacher-Scholar Awards Program: July 1, 1999 New Faculty Awards Program: May 14, 1999 Faculty Start-up Grants for Undergraduate Institutions: May 14, 1999 Scholar/Fellow Program for Undergraduate Institutions: July 1, 1999 Special Grant Program in the Chemical Sciences

  20. Decoding the codes: A content analysis of the news coverage of genetic cloning by three online news sites and three national daily newspapers, 1996 through 1998 (United States)

    Hyde, Jon E.

    This study compared news coverage of genetic cloning research in three online news sites (,, and and three national daily newspapers (The New York Times, The Washington Post, and USA Today). The study involved the analysis of 230 online and print news articles concerning genetic cloning published from 1996 through 1998. Articles were examined with respect to formats, sources, focus, tone, and assessments about the impact of cloning research. Findings indicated that while print news formats remained relatively constant for the duration of this study, online news formats changed significantly with respect to the kinds of media used to represent the news, the layouts used to represent cloning news, and the emphasis placed on audio-visual content. Online stories were as much as 20 to 70% shorter than print stories. More than 50% of the articles appearing online were composed by outside sources (wire services, guest columnists, etc.). By comparison, nearly 90% of the articles published by print newspapers were written "in-house" by science reporters. Online news sites cited fewer sources and cited a smaller variety of sources than the newspapers examined here. In both news outlets, however, the sources most frequently cited were those with vested interests in furthering cloning research. Both online and print news coverage of cloning tends to focus principally on the technical procedures and on the future benefits of cloning. More than 60% of the articles focused on the techniques and technologies of cloning. Less than 25% of the articles focused on social, ethical, or legal issues associated with cloning. Similarly, articles from all six sources (75%) tended to be both positive and future-oriented. Less than 5% of the total articles examined here had a strongly negative or critical tone. Moreover, both online and print news sources increasingly conveyed a strong sense of acceptance about the possibility of human cloning. Data from this study

  1. News on personal dosimetry

    International Nuclear Information System (INIS)

    What is going on in personal monitoring? The DIS-1 dosimeter (Rados/Mirion Technologies), on the market since 2000, is being introduced in the 4th dosimetry service in Switzerland. In Germany, dosimetry services are looking for alternatives to the film dosimeter. They have recently taken the decision for two technical solutions. IEC has published a standard which shall regulate technical requirements for dosimeters world-wide. (orig.)

  2. Society for the History of Psychology News. (United States)

    Lee, Shayna Fox


    Presents the Society for the History of Psychology News column. This column records miscellaneous publication news, announcements, research notes, reviews of books, and conference information, as well as references that support their writings. (PsycINFO Database Record PMID:27100928

  3. The shifting cross-media news landscape

    DEFF Research Database (Denmark)

    Schrøder, Kim Christian; Steeg Larsen, Bent


    market, as a consequence of accelerating divisions between 'overview' and 'depth' news media (across print, broadcasting and the internet). The project is carried out in a partnership of university-based researchers and analysts from one of the major newspaper publishers in Denmark, and presents......The article offers new insights for democracy and for news producers by mapping the use and users of today’s cross-media news landscape, as the everyday consumption of news across the range of available news media and formats is shifting as a result of transformations of technology, culture......” of news media, a user-anchored concept which incorporates the different functionalities of the situational cross-media use of news by citizen/consumers in everyday life. Empirically the article presents the findings of a large-scale survey that traces the imminent challenges facing players in the news...

  4. Application of Economy Principle in News English

    Institute of Scientific and Technical Information of China (English)



    The economy principle of language obtained full manifestation in news English. This paper presents major ways in which people make news English economic, i.e. using short words, abbreviations, affixes, compounds and words with extended meanings and conversions.

  5. Navigating cross-media news use

    DEFF Research Database (Denmark)

    Swart, Joëlle; Peters, Chris; Broersma, Marcel


    distinctive cross-media repertoires, and what makes these compositions meaningful. This article analyzes the value of different platforms, genres and practices in everyday life by mapping patterns of cross-media news use. Combining Q methodology with think-aloud protocols and day-in-the-life-interviews, five...... distinct news media repertoires are identified: 1) regionally-oriented 2) background-oriented 3) digital 4) laid-back and 5) nationally-oriented news use. Our findings indicate that users do not always use what they prefer, nor do they prefer what they use. Moreover, the boundaries they draw between news...... and other information are clearly shifting. Finally, our results show that in a world with a wide range of possibilities to consume news for free, paying for news can be considered an act of civic engagement. We argue that perceived news use and users’ appreciation of news should be studied in...

  6. The shifting cross-media news landscape

    DEFF Research Database (Denmark)

    Schrøder, Kim Christian; Steeg Larsen, Bent


    market, as a consequence of accelerating divisions between 'overview' and 'depth' news media (across print, broadcasting and the internet). The project is carried out in a partnership of university-based researchers and analysts from one of the major newspaper publishers in Denmark, and presents the......The article offers new insights for democracy and for news producers by mapping the use and users of today’s cross-media news landscape, as the everyday consumption of news across the range of available news media and formats is shifting as a result of transformations of technology, culture and...... news media, a user-anchored concept which incorporates the different functionalities of the situational cross-media use of news by citizen/consumers in everyday life. Empirically the article presents the findings of a large-scale survey that traces the imminent challenges facing players in the news...

  7. Users' reading habits in online news portals


    Esiyok, Cagdas; Kille, Benjamin; Jain, Brijnesh Johannes; Hopfgartner, Frank; Albayrak, Sahin


    The aim of this study is to survey reading habits of users of an online news portal. The assumption motivating this study is that insight into the reading habits of users can be helpful to design better news recommendation systems. We estimated the transition probabilities that users who read an article of one news category will move to read an article of another (not necessarily distinct) news category. For this, we analyzed the users' click behavior within plista data set. Key findings are ...

  8. Agency and civic involvement in news production via Facebook commentary

    DEFF Research Database (Denmark)

    Eberholst, Mads Kæmsgaard; Hartley, Jannie Møller

    Social media services such as Facebook, Twitter and Youtube, where users create and share content, has become a large part of most peoples everyday digital life and equally media companies has realised that these services plays a great role in peoples news con-sumption pattern. On these services...... users can contribute to the publication process, in theory broadening the diversity of public debate. This paper explores user involvement on the Facebook pages of Danish mainstream online newspapers in November 2012 and investigate the hypothesises that user interactivity gives audiences greater power...

  9. News from IAEA Headquarters

    International Nuclear Information System (INIS)

    Full text: Two more countries have joined the Agency - Panama and Jordan - bringing IAEA membership up to 96. Mr. Ginige Richard Walter de Silva (Ceylon) has been appointed Director of the Division of Conference and General Services of the Agency. Born in 1911 at Nugegeda, Ceylon, Mr. de Silva obtained his B.Sc. in Physics at London University and his M.A. in Physics and Mathematics at Cambridge University. He has had a long career in the Civil Service, mainly in the administrative, commercial and finance branches of government. Silva took over from Mr. Arthur E. Barrett, Chief of the Conference and Engineering Services, who had been Acting Director of the Division for a long period of time, and who will be leaving the Agency later this year to take up work elsewhere. From the early days of IAEA in 1957, Mr. Barrett has been closely associated with the establishment of the Agency's temporary headquarters in Vienna. He has been in charge of the planning and design of the technical facilities for the various conference installations and responsible for the servicing of all the General Conference sessions since 1958. In fact, Mr. Barrett has played an essential part in the creation of the Vienna Congress Centre in the former Hofburg Imperial Palace. Educated at Cambridge and London Universities, Mr. Barrett has had some 35 years of public service, first in the BBC in London and subsequently with the United Nations in New York. (author)

  10. An Economic Theory of News Selection. (United States)

    McManus, John

    Over the years, journalists, social scientists, and government commissions have defined news in a variety of ways, but their definitions consistently lack the notion that, above all, news is a commodity and must sell. Within the journalism profession, and particularly in television news, the potential for conflict between a media corporation's…

  11. Visualizing news: obstacles, challenges, and solutions

    NARCIS (Netherlands)

    Smit, Gerard; Haan, Yael de; Buijs, Laura; Bakker, Piet


    Depicting news graphically is considered an apt way to deal with challenges of modern journalism: to disclose big data, and present news attractively, visually, and fast to grasp. This study delves into reported obstacles and challenges for the production of news visualizations. It focuses on the qu

  12. Daily Market News Sentiment and Stock Prices

    NARCIS (Netherlands)

    D.E. Allen (David); M.J. McAleer (Michael); A.K. Singh (Abhay)


    textabstractIn recent years there has been a tremendous growth in the influx of news related to traded assets in international financial markets. This financial news is now available via print media but also through real-time online sources such as internet news and social media sources. The increas

  13. Between authority and media actor. The municipality as a news actor on the Internet

    Directory of Open Access Journals (Sweden)

    Signe Bock Segaard


    Full Text Available

    The article illuminates how local authorities as news actors fill their websites with content. This is done through a study of how active the local authorities are as news actors on the Internet, what kinds of electronic news dissemination they do in practice, and to what degree they experience dilemmas in electronic news dissemination. The analytic point of departure is the tension between a journalistic ideal of news mediation relates to democratic values and a strategic ideal of communication related to branding. Empirically the analysis is based on data from several Danish and Norwegian municipalities which are considered as particularly active on the Internet. Finally the article discusses municipal news mediation on the Internet in the light of the municipality as a public authority as well as a market actor, a service provider, and as a democratic actor. The question is in what way municipal news dissemination on the Internet is a democratic gain. The article shows that the work with news dissemination on the Internet to some degree is characterized by professionalization, centralization, and bureaucratization. The democratic gain of municipal news dissemination is an empirical question and related to the criteria of news selection (in practice. Furthermore the article shows that some municipalities have a more strategic focus while others have a more journalistic focus but one focus does not rule out the other.

  14. News on pediatric urology

    Directory of Open Access Journals (Sweden)

    Giuseppe Masnata


    Full Text Available Pediatric urology is a pediatric speciality dedicated to the diagnosis and treatment of congenital and acquired genitourinary tract diseases. It is a speciality that is rapidly changing, thanks to the technological development that has been emerging in recent years. There have been important diagnostic and therapeutic news.Congenital anomalies of the kidneys and urinary tract (CAKUT include various entities of structural malformations that result from defects in their morphogenesis. Clinical research and genetic studies on the origins of CAKUT are quickly evolving, with significant growth of high-quality research.Management goals of CAKUT include prevention of febrile urinary tract infections (UTIs in newborns and toddles and renal injury, while minimizing the morbidity of treatment and follow-up. Treatment options include observation with or without continuous antibiotic prophylaxis (CAP and surgical correction. Now, randomized controlled studies show that children with normal urinary tracts or low-grade vesicoureteral reflux (VUR do not benefit from prophylaxis.All children with known mechanical or functional obstructions of the urinary tract are considered to have UTI. Functional obstruction often results from lower urinary tract dysfunction (LUTD of either neurogenic or non-neurogenic origin and dilating VUR.The role of bladder and bowel dysfunction (BBD in children with UTI and the long-term risk of renal scarring have shed new light on treatment strategies. Often it is BBD, rather than reflux, that causes UTI in children older than 2 years.Pediatric urology has evolved in recent years, with a greater focus on bladder and renal function, minimally invasive treatment, evidence-based interventions, and guideline adherence. Other topics in pediatric urology include urinary incontinence in children with special needs and the use of robot-assisted laparoscopic surgery (RALS in children, with advantages over conventional laparoscopic surgery

  15. News of the world

    International Nuclear Information System (INIS)

    This article gathers information from the nuclear industry throughout the world. The most significant are the following. According to the ASN (French authority for nuclear safety) the 2012 was a satisfactory year concerning nuclear safety and radiation protection in France (149 events graded 1 at INES scale and 4 graded 2). Ukraine has received 600 millions euros for upgrading the safety level of its 15 reactors. AREVA has recently signed various contracts concerning nuclear fuels: contract for supplying the nuclear fuel for the EPR number 1 of Taishan, contract for supplying nuclear fuels to the American nuclear power plant operator Exelon and contract for supplying the nuclear fuel to the Jordanian research reactor JRTR. The Belgian federal agency for nuclear control (AFCN) has allowed the restart of the reactors Doel 3 and Tihange 2, which were shutdown in 2012 when hints for defects were discovered on the pressure vessels. The British Nuclear National Laboratory (NNL) has become the 11. partner for the Jules Horowitz research reactor project, reactor that is being built on the Cadarache Cea center. (A.C.)

  16. News of the world

    International Nuclear Information System (INIS)

    This document gathers pieces of information from various countries and companies concerning nuclear industry, the most relevant are the following. The second reactor of the Bugey power plant has been allowed by the ASN (French authority for nuclear safety) to operate 10 years more. The oldest nuclear power plant in Spain: Garona, will be stopped definitively in july 2013. In july 2012 a first and second reactor (units 3 and 4 of the Ohi power plant) had restarted since the Fukushima accident. The United Arab Emirates have launched the construction of 2 reactors at Abu Dhabi on the Barakah site, a consortium led by Kepco, a South-Korean company will build them. A report published by NEA and IAEA shows that uranium worldwide resources are sufficient for at least 1 hundred years at the present rate of consumption. In 2010 the most important producers of uranium were: Kazakhstan (33%), Canada (8%), Australia (11%), Namibia (8%), Niger (8%) and Russia (7%). A study shows that the Japanese nuclear power plant on the Onagawa site is in a surprisingly good state despite the proximity with the epicentre of the 2011 tsunami-earthquake. The recovery of the nuclear fuel from the fuel pool of the unit 4 of the Fukushima plant has begun. Moscow and Minsk have signed an agreement for the construction of a nuclear power plant with 2 reactors in the Byelorussian region of Grodno. The Belgian government has approved a nuclear phase-out strategy that will extend to 2025. (A.C.)

  17. News of the world

    International Nuclear Information System (INIS)

    This article gathers information concerning nuclear industry throughout the world. The most relevant pieces of information are the following. Some defects detected on metallic boxes necessary to the installation of the suspension crane have delayed the concreting of the EPR reactor building at Flamanville, nevertheless the commissioning of the reactor is still planned for 2016. In the United Kingdom the oldest operating power reactor in the world has been decommissioned in February 2012, it concerns the Oldbury 1 unit that is a Magnox type reactor. Poland is expected to launch in may 2012 an offer to tender for the construction of the first nuclear power plant. The Spanish Counsel for Nuclear Safety has given its agreement for operating the Garona plant 5 years more. The Russian company Rosenergoatom has begun the construction works for the first unit of the Baltic plant located in the Kaliningrad region, it concerns a VVER-1200 reactor. The Tamil Nadu Indian state has announced the construction of two 1000 MW reactors on the Kudankulam site in cooperation with Russia. In February 2012 CEA presented to the media its research activities concerning reactor safety. A brief description of the Tamaris facility and of the Plinius experimental platform is given. (A.C.)

  18. News of the world

    International Nuclear Information System (INIS)

    This article gathers pieces of information from the nuclear industry throughout the world. A digest follows. AREVA expects the end of the construction of the EPR at the Olkiluoto plant mid 2016 and its commissioning in 2018. The fast reactor Beloyarsk-4 reached went critical in july 2014 for the first time (its construction began in 1986 but was stopped when the Soviet Union collapsed and works resumed in 2004). The Chinese company CGN will build the units 3 and 4 of the Cernavoda plant in Romania. The NRC has approved the increase of power (+12%) of the units 2 and 3 of the Peach Bottom plant in the US, both reactors are 1140 MW BWR that were commissioned in 1974. A court ruling has obliged the American NRC to continue examining the operating license of the Yucca Mountain center despite the project was suspended in 2010 by Obama's Administration. A new line of fuel assembly production has been opened at Yibin (Sichuan - China) by a subsidiary of CNNC, the annual output is expected to reach 400 tonnes. Ukrainian authorities have announced that the foundations of the new sarcophagus surrounding the Chernobyl-4 damaged reactor have been completed. AREVA has won a contract for the dismantling of 2 research reactors R2-0 and R2 in Sweden. (A.C.)

  19. News of the world

    International Nuclear Information System (INIS)

    This article gathers pieces of information from the nuclear industry throughout the world. The most significant are the following. The foundation mat of the reactor 1 of the Fessenheim plant will be reinforced as planned despite the announcement by the French president to decommission this plant before the end of its presidency. The cost is estimated to be about 25 millions euros for both reactors of the plant, it is recalled that the plant generates a result of 400 millions euros each year. The Japanese government is ready to restart the nuclear reactors that are considered safe. The Chinese authorities have announced that they plan to export a Chinese third-generation reactor: the CAP1400, this reactor is being built at Rongcheng in the Shandong region. Russia has granted a loan to Bangladesh for the construction of its first nuclear plant. EDF has announced a net group result of 4.216 billion euros for 2012 and a turnover of 72.729 billions, it means a rise of 17% and 11% respectively compared to 2011. The turnover of Areva increased by 5.3% in 2012 to reach 9.3 billions euros. (A.C.)

  20. News from nuclear industry

    International Nuclear Information System (INIS)

    A cooperation agreement has been signed between Indian and French governments concerning energy and research. This agreement opens the Indian market to Areva for the supply of power reactors. Areva will face Russian and American competitors. Areva is already present in India in the sectors of power transmission and distribution, it employs 3500 people and operates 8 industrial plants. Areva and Northrop Grumman have signed an agreement to build the biggest site on American soil dedicated to the manufacturing of big nuclear components like reactor vessels, steam generators and pressurizers. An opinion poll shows that 78% Americans favor the use of nuclear energy for producing electricity, while 24% are opposed to it and that nuclear power plants are considered safe by 78% of the population. The Areva-Bechtel corporation has signed an agreement with Unistar Nuclear Energy for doing the preliminary studies for the construction of an EPR near the Calvert Cliffs site. More than 500 engineers are working on the project that benefit from the feedback experience of 4 EPR that are presently being built in Finland, France and China. The European Commission wants the European Union to play a major role in nuclear safety, a task group has been created whose purpose is to define new regulations illustrating common priorities and approaches for unifying national nuclear safety standards among the member states. (A.C.)

  1. News from the world

    International Nuclear Information System (INIS)

    This document gathers information from around the world and concerning nuclear industry. The most relevant are the following. The Russian group 'Atomstroy-Export' will build 2 PWR-type reactors (ES-2006 - 1200 MW) in Belarus in the following years. The American NRC has refused to accept the demand of Unistar for a combined license concerning the construction and operation of a new nuclear power plant (Calvert-Cliffs-3) under the consideration that Unistar belongs at 100% to a foreign company (EDF). SKB, the Swedish company for the management of radioactive wastes, has filed a demand for the construction of storage center for spent fuels in deep geological layers and of a unit for processing spent fuels. Areva has bought back the Siemens' share (34%) in Areva-NP for 1.63 billions euros. Exelon and Constellation, 2 American electricity producers have announced their merging, the new group, called Exelon will rank second in the Usa in terms of number of household customers (6.6 millions). The French Nuclear Safety Authority (ASN) has declared that the year 2010 was quite satisfactory in terms of nuclear safety and radiation protection in French facilities. Several agreements concerning cooperation in the domain of nuclear energy have been recently signed between France and Chile, France and Saudi Arabia and between France and South Africa. (A.C.)

  2. News of the world

    International Nuclear Information System (INIS)

    This document gathers information from nuclear industry throughout the world. The most relevant follows. The reactor 1 of the Kudankulam site has diverged and is expected to be connected to the grid soon. This reactor is a VVER-1000 reactor whose power output will reach 1000 MW, it is the most powerful of the 21 reactors operating in India. China and Pakistan have signed an agreement for the construction of 2 reactors ACP-1000 near Karachi for a cost of 9.6 billion dollars. Ukraine and Japan have launched a common project whose purpose is the satellite-based monitoring of damaged nuclear plants Chernobyl and Fukushima. 4 countries of central Europe (Hungary, Poland, Czech Republic and Slovakia) have created a common center for the research and development of reactors of 4. generation. The European Commission has decided to grant a loan for the construction of the Pallas high flux multi-purpose reactor on the Petten site (The Netherlands). It will replace the High Flux reactor as soon as 2023 particularly for the production of radio-isotopes. Jordan plans to build its first reactor, this reactor will be a 5 MW research reactor situated at Irbid in the promises of the Sciences and Technologies University. (A.C.)

  3. News of the Year. (United States)

    Albanese, Andrew R.; Oder, Norman; Rogers, Michael; St. Lifer, Evan; Jay, M. Ellen; Milliot, Jim


    Includes three articles that discuss the top stories from "Library Journal", including the demand for librarians, the Digital Millennium Copyright Act, library education, database publishers, electronic research services, the Uniform Computer Information Transactions Act (UCITA), Internet filtering, and electronic reference; the school library…


    Institute of Scientific and Technical Information of China (English)


    Tourism Incomein the First Quarter;Foreign Mountaineers to Climb Qomolangma;Tibet Mountodneers to Assaultthe last 8000-M Peak;Telephone Service Available to All Border Counties;New Members of the Camping Ground;More Farmers Drink Sanitary Water;

  5. News Aggregators and Competition Among Newspapers in the Internet


    Esfahani, Nikrooz Nasr; Jeon, Doh-Shin


    In this paper, we study how the presence of a news aggregator affects competition among (horizontally differentiated) newspapers in the Internet. For this purpose, we build a model of multiple issues which allows each newspaper to choose quality on each issue. Our model provides a micro foundation for the service offered by the aggregator and captures both the "business-stealing effect" and the "readership-expansion effect" of the aggregator. We find that the presence of the aggregator leads ...

  6. AC power supply systems

    International Nuclear Information System (INIS)

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  7. News and Announcements (United States)


    resource professionals to participate in a diverse, comprehensive, carefully focused program with many opportunities for interactive and one-on-one communication. The conference has five tracks with each track having five focus areas: technical infrastructure; planning and strategy; service delivery; applications and best practices; and management and organization. Speakers at the general session include Colin Powell, retired chairman of the Joint Chiefs of Staff; Rita Colwell, director of the National Science Foundation; and Barry Munitz, president of the J. Paul Getty Trust. For more information visit the conference WWW site at Proposal Deadlines National Science Foundation Division of Undergraduate Education (DUE) Course, Curriculum, and Laboratory Improvement (CCLI) June 7, 1999 NSF Collaboratives for Excellence in Teacher Preparation (CETP) Preliminary proposals, Track 1 May 1, 1999 Formal proposals, Track 1 September 1, 1999 DUE online 1999 guidelines, NSF 99-53 available at For further information about NSF DUE programs consult the DUE Web site at or contact the DUE Information Center; phone: 703/306-1666; email: The Camille and Henry Dreyfus Foundation, Inc. Camille Dreyfus Teacher-Scholar Awards Program: November 16, 1998 Henry Dreyfus Teacher-Scholar Awards Program: July 1, 1999 New Faculty Awards Program: May 14, 1999 Faculty Start-up Grants for Undergraduate Institutions: May 14, 1999 Scholar/Fellow Program for Undergraduate Institutions: July 1, 1999 Special Grant Program in the Chemical Sciences: July 15, 1999 Postdoctoral Program in Environmental Chemistry: February 26, 1999 Further information may be obtained from The Camille and Henry Dreyfus Foundation, Inc., 555 Madison Avenue, Suite 1305, New York, NY 10022; phone: 212/753-1760; email:; www: Research Corporation Cottrell

  8. Semantic Analysis of FBI News Reports

    DEFF Research Database (Denmark)

    Nizamani, Sarwat; Memon, Nasrullah


    In this paper we present our work on semantic analysis of FBI News reports. In the paper we have considered the News which are of the immense significance for the analyst who want to analyze the News of specific area. With this definite analysis we are able to extract critical events or concepts...... described in News along with entities involved in the event. These entities include important actors of the event or concept, with location and temporal information. This information will help News analyzers to retrieve the information of interest efficiently....

  9. Engaging and Disengaging with Political News

    DEFF Research Database (Denmark)

    Ørmen, Jacob; Linaa Jensen, Jakob

    cluster analysis of a survey of the adult Danish population (n = 1205). The typology encompasses archetypical ways user can consume (e.g. watching news on TV, reading news in print as well as digital versions, encountering news on social networks and in face-to-face situations) and discuss political news...... level, we further investigate the differences between users that only consume political news and users that also talk about politics with others. And on the tertiary level, we identify the most widespread communicative practices (e.g. sharing content on social network sites, writing comments on blogs...

  10. Guess Who's in the News. (United States)

    Wassom, Julie


    Examines the power of positive publicity as cost-effective child-care marketing. Suggests that getting positive press can make marketing easier, less expensive, and fun. Notes that by creating news stories and developing a working relationship with targeted media, child-care-center directors can inform, educate, and create new prospects and…

  11. Broadcast News: An Interdisciplinary Project. (United States)

    Nielsen, Carol; Sassi, Brenda

    Fourth graders in the Meroby School, Mexico, Maine, produce a weekly news program that is transmitted to all classrooms via closed circuit television. The classroom teacher is in charge of day-to-day preparation, working on the writing and the necessary skills with students. Teachers and students use their creativity to come up with new…

  12. News of the world

    International Nuclear Information System (INIS)

    This article reviews a series of events worldwide concerning nuclear energy. The second unit of the Cernavoda power plant (Rumania), a Candu-6 type reactor was commissioned in May 2007. The German minister of environment has rejected the demand from the RWE group to extend the operating life of the Biblis-A plant till the second semester of 2011. The Chinese unit of Tiawan-1 was connected to the grid in May 2007. The Turk government considers the construction of 3 nuclear power plants (totaling 5000 MW) as a means to reduce its energy dependency with Russia and Iran. The Japanese government wishes to increase the availability rate of nuclear plants (this rate is below 70%) by reducing the frequency of inspections. Brazilians authorities have invested 210 millions dollars to extend the Angra-1's operating life from 40 to 60 years. The first unit of the Browns-Ferry has restarted 22 years after its shutdown. The DOE has allowed the construction of a plant for the fabrication of Mox fuels on the Savannah River site. Russia and Kazakhstan have agreed to build an international center for the enrichment of uranium. The construction of a new enrichment plant has started on the Piketon site (Ohio, US), about 11500 centrifuges will be settled there. A study shows that the world consumption of energy will grow by 57% between 2004 and 2030. To meet the demand, the parts of coal, natural gas and renewable energies will grow while the part of oil will decrease from 38% in 2004 to 34% in 2030. (A.C.)

  13. News from CHIS

    CERN Multimedia


    New contract between CERN and UNIQA Following a competitive call for tender, the consortium UNIQA Switzerland and UNIQA Austria has been awarded the contract for providing third-party administrative services for CERN’s Health Insurance Scheme. The contract will enter into force on 1 January 2015 for an initial period of five years, renewable by CERN for a further period of five years. This means that the Third-Party Administrator of the CHIS remains the same as before. While the services remain essentially the same, certain improvements are foreseen under this new contract.  Some of these will impact the members directly and positively, while others will improve the supervision of the Scheme by CERN’s administration. More details will be provided in the next CHIS Bulletin. Approved Hospitals in Geneva: new in 2014 In 2014, CERN has concluded new agreements with the following care providers in Geneva: ·     &a...

  14. Exploring Digital News Publishing Business Models

    DEFF Research Database (Denmark)

    Lindskow, Kasper

    News publishers in the industrialized world are experiencing a fundamental challenge to their business models because of the changing modes of consumption, competition, and production of their offerings that are associated with the emergence of the networked information society. The erosion of the...... traditional business models poses an existential threat to news publishing and has given rise to a continuing struggle among news publishers to design digital business models that will be sustainable in the future. This dissertation argues that a central and underresearched aspect of digital news publishing...... business models concerns the production networks that support the co-production of digital news offerings. To fill this knowledge gap, this dissertation explores the strategic design of the digital news publishing production networks that are associated with HTML-based news offerings on the open Web. In...

  15. News from the Library

    CERN Multimedia

    CERN Library


    The LHC Library to be merged with the Central Library. Not everyone knows that CERN Scientific Information Service currently counts three physical libraries on site. The Central Library is located in Building 52 and there are two satellite libraries located respectively in building 30 (the LHC Library) and in building 864 on Prévessin site (the SPS Library). Moreover, the Legal Service Library is located in Building 60. In the past, there have been at CERN up to 6 satellite libraries; they were essential at a time when information was only in paper form and having multiple copies of documents located in several places at CERN was useful to facilitate scientific research. Today, this need is less critical as most of our resources are online. That is why, following a SIPB (Scientific Information Policy Board) decision, the collections of the LHC Library will be merged this summer with the Central collection. This reorganization and centralization of resources will improve loan services. The SP...

  16. Teaching Social Work Students to Use News Media for Public Education Purposes. (United States)

    Brawley, Edward A.; Martinez-Brawley, Emilia E.


    Efforts to teach social work students to use the news media (television, radio, and local newspapers) to publicize social work activities and social service programs and to educate the public about existing and needed services are described. Information is given on the opportunities in most localities for public education activities and results…

  17. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available optera acutorost... 37 0.66 tr|B1ACS6|B1ACS6_BALBN DMP1 (Fragment) OS=Balaenoptera ...bonaerens... 37 0.66 tr|B1ACS5|B1ACS5_BALED DMP1 (Fragment) OS=Balaenoptera edeni... GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3..._BALMU DMP1 (Fragment) OS=Balaenoptera musculus ... 37 0.86 tr|B1ACS1|B1ACS1_MEGNO DMP1 (Fragment) OS=Megapt...1ACS2_BALPH DMP1 (Fragment) OS=Balaenoptera physalus ... 37 1.1 tr|B1ACT6|B1ACT6_MESPE DMP1 (Fragment) OS=Me

  18. News from Online: Industrial Chemicals and Polymers (United States)

    Sweeney Judd, Carolyn


    of the American Chemical Society Divisions of Polymer Chemistry and Polymeric Materials: Science and Engineering and General Electric Corporation. The POLYED site, http:/ /, is hosted by the University of Wisconsin at Stevens Point. This National Center for Polymer Education is another good place to go for information. More education is available at the Ziegler Research Group Home Page at . Go to Metallocene as Olefin Polymerization Catalysis: An Introduction ( ) for historical accounts of metallocene and Ziegler-Natta catalysts. Movies are available here too. This Canadian site is well-documented and educational. Back at the University of Wisconsin-Madison, The Why Files site at helps bring important chemical and technology news to the public. Go to the archived files of October 1997 ( ) to find information about the importance of low-temperature metallocene catalysts. The Why Files received funding from the National Science Foundation. Go here for science information in an easy-to-read format. One of the driving forces toward better catalysis is the attempt to reach 100% product, combining efficiency with lowered pollution. Companies can look to the Environmental Protection Agency for information: Environsense at is pledged to offer "Common Sense Solutions to Environmental Problems". So where can we get these polymers? The American Chemical Society can help. Go to Chemcylopedia at for great information. Both purchasers and users of chemicals can benefit from this site. Searches can be made on the chemical or on the supplier. Information provided includes CAS Registry Numbers and special shipping requirements as well as potential applications. Do you remember that we started with paper? Let

  19. News on Accounting and Tax Treatment Related to the Activity of Intracommunitarian Goods Transport


    Pravãþ Ionela-Cristina


    The economical activity of transport fits within the broad category of services, but in terms of taxation, transport services are treated as an exception, compared to how services are approached in general. Among the categories of transportation services, intracommunitarian transport shows certain particularities. Therefore, we proposed in this work to address from a theoretical point of view a series of news occured in the tax and accounting treatment of specific business operations of intra...

  20. News for analytical chemists

    DEFF Research Database (Denmark)

    Andersen, Jens Enevold Thaulov; Karlberg, Bo

    The EuCheMS Division of Analytical Chemistry (DAC) maintains a website with informations on groups of analytical chemistry at European universities (www.dac-euchems. org). Everyone may contribute to the database and contributors are responsible for an annual update of the information. The service...... is offered free of charge. The report on activities of DAC during 2008 was published in journals of analytical chemistry where Manfred Grasserbauer contributed with his personal view on analytical chemistry in the assessment of climate changes and sustainable application of the natural resources to...

  1. Nuclear news for all

    International Nuclear Information System (INIS)

    Fifty-seven percent of the employees of the Public Service Electric and Gas Company of Newark, NJ, answered No to the question: When people outside the company talk to you about nuclear power, do you feel you have enough information to adequately explain the company's position. Five booklets produced by the company's Advertising and Community Relations Department in July 1980 would have altered those results. The booklets (Nuclear Energy and the Environment, Low-Level Radiation, Nuclear Reactor Safety, Nuclear Waste Management and Disposal, and Alternative Energy Sources for Electric Generation) are summarized, and ordering information is given

  2. News and Announcements (United States)


    University of Michigan in Ann Arbor, is up and running at bcce. Organizers of symposia and workshops as well as proposers of papers are invited to submit their ideas over the Web or in writing to the Program Chair, Brian Coppola; phone: 734/764-7329; email:, or to the Workshop Coordinator, Evelyn Jackson; phone: 517/355-9715 ext 204; email: For general information please contact Seyhan Ege, phone: 734/764-7340, email: ChemCareers Debuts on ChemCenter The ACS ChemCenter website has recently launched a moderated career forum where chemists, chemical engineers, scientists in related fields, students, and other interested persons pose their questions related to career development in the chemical sciences. At the site you can hear what your peers think about preparing for, launching, maintaining, and advancing a career in chemistry. You can bring questions, share experiences, or offer advice. The forum is moderated by ACS career consultants who offer their expert opinions as a part of the discussion. The address is Click on the "discussions" hypertext link under "Discover Chemistry." Green Chemistry The closing date for grant funding from the EPA/NSF Technologies for a Sustainable Environment Solicitation is July 26, 1999. For specific grant information, visit the Web site For general grant information about green chemistry, go to,, and; phone: 202/260-2659. Grad Resources Hotline A national crisis hotline sponsored by Grad Resources was set up effective April 1999. Graduate students who face overwhelming stress or despair may call 1/877-GRAD-HLP, toll-free, 24 hours a day, every day, to speak anonymously with a counselor specially trained in graduate issues. Grad Resources is a non-profit organization serving graduate students. For further references and

  3. AC1 Wing

    Directory of Open Access Journals (Sweden)

    Adrian DOBRE


    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  4. AC1 Wing


    Adrian DOBRE


    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  5. News from the Library

    CERN Document Server

    CERN Library


    Discover more literature and be aware of the most popular articles! For years particle physicists have  enjoyed monitoring the most cited articles thanks to the Spires system. This is obviously an important feature that is also carried forward by Inspire, a system currently available in its beta version. For colleagues based at CERN working in closely related disciplines or in technological areas, no system has been available to monitor the most cited articles within the various specific topics. As a result of the rapid changes in the information landscape, the Library is currently streamlining the set of databases CERN subscribes to. In this context the Library is now making  different services available for site-wide evaluation. Thomson Web of Knowledge is a platform that integrates over 100 years of scientific literature and citations, covering more than 256 disciplines. This tool offers various interesting features, including the citation report, which can be a good sourc...

  6. Move! Eat better: news

    CERN Document Server


    Are you curious to know whether you’re doing enough daily exercise…? Test yourself with a pedometer!   Through the Move! Eat better campaign, launched in May 2012, the CERN medical service is aiming to improve the health of members of the personnel by encouraging them to prioritise physical activity in conjunction with a balanced diet. Various successful activities have already taken place: relay race/Nordic walk, Bike2work, Zumba and fitness workshops, two conferences (“Physical activity for health” and “Good nutrition every day”), events in the restaurants, as well as posters and a website. Although everyone has got the message from our various communications that physical activity is good for your health, there is still a relevant question being asked: “What is the minimum amount of exercise recommended?” 10,000 steps per day is the ideal figure, which has been demonstrated as beneficial by scientific studies ...

  7. News for analytical chemists

    DEFF Research Database (Denmark)

    Andersen, Jens Enevold Thaulov; Karlberg, Bo


    The EuCheMS Division of Analytical Chemistry (DAC) maintains a website with informations on groups of analytical chemistry at European universities (www.dac-euchems. org). Everyone may contribute to the database and contributors are responsible for an annual update of the information. The service...... is offered free of charge. The report on activities of DAC during 2008 was published in journals of analytical chemistry where Manfred Grasserbauer contributed with his personal view on analytical chemistry in the assessment of climate changes and sustainable application of the natural resources to...... committee directed to various topics of analytical chemistry. Although affected by the global financial crisis, the Euroanalysis Conference will be held on 6 to 10 September in Innsbruck, Austria. For next year, the programme for the analytical section of the 3rd European Chemistry Congress is in...

  8. Misunderstanding International News in Brazil

    Directory of Open Access Journals (Sweden)

    Jacques Wainberg


    Full Text Available This study evaluates the nature of the Brazilian public comprehension of international news by revealing the quality of such reception with regard to a sample of 170 subjects randomly selected in the city of Porto Alegre, Brazil. A questionnaire was created taking as a basis the directives of Bloom et al(1972. Evaluated in it are the cognitive and aff ective dimensions of thought. In the fi rst case, questions were formulated that allowed the establishment of the level of knowledge of individuals, as well as their comprehension abilities, application, analysis, synthesis, and evaluation of a wide range of international news topics. For the aff ective dimension the following abilities were evaluated: attention, response, valorization, organization and the structuring of a value scale.

  9. Implicit Operational Definitions of Economic News Literacy in the Printed News Media. (United States)

    VanSickle, Ronald L.


    Describes study which focused on the economic vocabulary used in national and international news magazines and papers. Compares findings with definitions of economic literacy proposed by economists and suggests that economics courses include economic news literacy. (KC)

  10. News with an attitude: assessing the mechanisms underlying the effects of opinionated news

    NARCIS (Netherlands)

    M. Boukes; H.G. Boomgaarden; M. Moorman; C.H. de Vreese


    Opinionated news targets communities of likeminded viewers, relies on dramaturgical storytelling techniques, and shares characteristics with political satire. Accordingly, opinionated news should be understood as a specific form of political entertainment. We have investigated the mechanisms underly

  11. News and Announcements (United States)


    News from Journal House Conceptual Questions and Challenge Problems Many readers are trying to modify the way they teach and in so doing are trying to write new types of questions and problems. The Journal has a new online resource, the JCE Internet Conceptual Questions and Challenge Problems Web site, . The site is a source of questions and problems that can be used in teaching and assessing conceptual understanding and problem solving in chemistry. Here you can find a library of free-response and multiple-choice conceptual questions and challenge problems, tips for writing these questions and problems, and a discussion of types of concept questions. This site is intended to be a means of sharing conceptual questions and challenge problems among chemical educators. It will be as inclusive as possible, and to achieve this readers need to share their questions and alert the authors to references or Web sites. The screen captures shown below should provide a feeling for what you will find when you visit the site. The authors, William R. Robinson and Susan C. Nurrenbern, welcome additions to the library of conceptual questions or other comments or suggestions. Contact them by email, fax, or regular mail. William R. Robinson and Susan C. Nurrenbern, Department of Chemistry, Purdue University, West Lafayette, IN 47907-1393. Bill: phone: 765/494-5453; fax: 765/494-0239; email: Sue: phone: 765/494-0823; fax: 765/494-0239; email: fax: 765/494-0239. 1998 Ford Foundation Fellowships The National Research Council has announced the recipients of the 1998 fellowships for minority scholars. Three categories of fellowships were awarded: 50 to beginning graduate students, 33 to students writing their dissertations, and 28 to recent Ph.D. recipients. There were about 1,000 applicants. For information about the next competition contact the Fellowship Office of the National

  12. Social Media News: Motivation, Purpose and Usage

    Directory of Open Access Journals (Sweden)

    Samaneh Beheshti-Kashi


    Full Text Available This paper presents the results of an online survey which was conducted to analyse the use of social web inthe context of daily news. Users’ motivation and habit in the news consumption were focused. Moreover,users’ news behaviour was distinguished in three purposes such news consumption, news production andnews dissemination to find out if the usage has a passive or active character. In a second step it wasquestioned which social software is used for which purpose. In conclusion users appreciate social softwarefor features such as interactivity and information that traditional media does not provide. Among the socialweb platforms users prefer social networking sites as well as videoshare platforms. Social networking sitesalso rank first in the news production and dissemination.

  13. Mine your own business! Mine other's news!


    Pham, Quang-Khai; Saint-Paul, Régis; Benatallah, Boualem; Mouaddib, Noureddine; Raschia, Guillaume


    Major media companies such as The Financial Times, the Wall Street Journal or Reuters generate huge amounts of textual news data on a daily basis. Mining frequent patterns in this mass of information is critical for knowledge workers such as financial analysts, stock traders or economists. Using existing frequent pattern mining (FPM) algorithms for the analysis of news data is difficult because of the size and lack of structuring of the free text news content. In this article, we demonstrate ...

  14. The shifting cross-media news landscape

    DEFF Research Database (Denmark)

    Schrøder, Kim Christian; Steeg Larsen, Bent


    market, as a consequence of accelerating divisions between 'overview' and 'depth' news media (across print, broadcasting and the internet). The project is carried out in a partnership of university-based researchers and analysts from one of the major newspaper publishers in Denmark, and presents the...... first user-based analysis of the relative position of each individual news medium in the entire news media matrix....

  15. News Media Sentiment and Investor Behavior


    Kräussl, Roman; Mirgorodskaya, Elizaveta


    This paper investigates the impact of news media sentiment on financial market returns and volatility in the long-term. We hypothesize that the way the media formulate and present news to the public produces different perceptions and, thus, incurs different investor behavior. To analyze such framing effects we distinguish between optimistic and pessimistic news frames. We construct a monthly media sentiment indicator by taking the ratio of the number of newspaper articles that contain predete...

  16. Noteworthy: News Briefs from PA Libraries


    Linda Neyer; Larissa Gordon


    Accomplishments, experiences, events, and news about Pennsylvania librarians and libraries. In this issue: Chatham University Appointments and Professional Development Clarion University Libraries Appoint Two New Library Faculty Duquesne University Library News Lehigh Libraries Go Live with OLE The Library Company of Philadelphia’s African Americana Graphics Collection Now Online PADIGITAL E-mail List Penn State University Libraries News Seton Hill Library Marks 125th Anniversary with Makeov...

  17. Cancer News Coverage and Information Seeking


    Niederdeppe, Jeff; Frosch, Dominick L; Hornik, Robert C.


    The shift toward viewing patients as active consumers of health information raises questions about whether individuals respond to health news by seeking additional information. This study examines the relationship between cancer news coverage and information seeking using a national survey of adults aged 18 years and older. A Lexis-Nexis database search term was used to identify Associated Press (AP) news articles about cancer released between October 21, 2002, and April 13, 2003. We merged t...

  18. News of the Year Top Ten News of China’s Textile Industry in 2009

    Institute of Scientific and Technical Information of China (English)


    "As a calendar event, ‘China Textile’ Publishing House together with China Textile News appraised and selected the ten major news of China’s textile industry in 2009 as the news of the year according to the subscriptionon on a public poll basis ."

  19. News of the Year Top Ten News of China's Textile Industry in 2009

    Institute of Scientific and Technical Information of China (English)


    @@ "As a calendar event,'China Textile' Publishing House together with China Textile News appraised and selected the ten major news of China's textile industry in 2009 as the news of the year according to the subscriptionon on a public poll basis ."

  20. News: Good chemical manufacturing process criteria (United States)

    This news column covers topics relating to manufacturing criteria, machine to machine technology, novel process windows, green chemistry indices, business resilience, immobilized enzymes, and Bt crops.

  1. The relative concentration of bad versus good news flows


    Athanasakou, Vasiliki E.; Norman C Strong; Walker, Martin


    This paper examines flows of bad and good news as a feature of the firm’s information environment. We argue that to the extent that managers delay reporting bad news, this leads to bad news being more concentrated. Measuring flows of bad and good news using flows of negative and positive abnormal stock returns, we find that firms with higher volatility of operations and managerial incentives to withhold bad news exhibit relatively more concentrated bad news flows. This relative concentration ...

  2. A System for the Semantic Multimodal Analysis of News Audio-Visual Content

    Directory of Open Access Journals (Sweden)

    Michael G. Strintzis


    Full Text Available News-related content is nowadays among the most popular types of content for users in everyday applications. Although the generation and distribution of news content has become commonplace, due to the availability of inexpensive media capturing devices and the development of media sharing services targeting both professional and user-generated news content, the automatic analysis and annotation that is required for supporting intelligent search and delivery of this content remains an open issue. In this paper, a complete architecture for knowledge-assisted multimodal analysis of news-related multimedia content is presented, along with its constituent components. The proposed analysis architecture employs state-of-the-art methods for the analysis of each individual modality (visual, audio, text separately and proposes a novel fusion technique based on the particular characteristics of news-related content for the combination of the individual modality analysis results. Experimental results on news broadcast video illustrate the usefulness of the proposed techniques in the automatic generation of semantic annotations.

  3. Media Literacy, News Literacy, or News Appreciation? A Case Study of the News Literacy Program at Stony Brook University (United States)

    Fleming, Jennifer


    This case study provides practical and theoretical insights into the Stony Brook news literacy program, which is one of the most ambitious and well-funded curricular experiments in modern journalism education and media literacy. Analysis of document, interview, and observation data indicates that news literacy educators sought to teach students…

  4. Press problem related to nuclear energy news reporting

    International Nuclear Information System (INIS)

    Since the event of Niigataken Chuetsu-oki Earthquake in 2007 and the subsequent press reports on damage of nuclear power station after it, a stance of media is being questioned. In order to clear this problem, basic organizational structure of the press related to nuclear energy news was analyzed. Local news department, social news department, science news department and economical news department involve in nuclear energy news the accordance with their own situations and concerns. This structure makes problem of nuclear energy news reporting complicated. Changing this system is required but very difficult. It is concluded that the press problem around nuclear energy news is strange. (author)

  5. Understanding News Geography and Major Determinants of Global News Coverage of Disasters

    CERN Document Server

    Kwak, Haewoon


    In this work, we reveal the structure of global news coverage of disasters and its determinants by using a large-scale news coverage dataset collected by the GDELT (Global Data on Events, Location, and Tone) project that monitors news media in over 100 languages from the whole world. Significant variables in our hierarchical (mixed-effect) regression model, such as the number of population, the political stability, the damage, and more, are well aligned with a series of previous research. Yet, strong regionalism we found in news geography highlights the necessity of the comprehensive dataset for the study of global news coverage.

  6. Report on the 1st International Workshop on Recent Trends in News Information Retrieval (NewsIR16)


    Martinez, Miguel; Kruschwitz, Udo; Kazai, Gabriella; Hopfgartner, Frank; Corney, David; Campos, Ricardo; Albakour, Dyaa


    The news industry has gone through seismic shifts in the past decade with digital content and social media completely redefining how people consume news. Readers check for accurate fresh news from multiple sources throughout the day using dedicated apps or social media on their smartphones and tablets. At the same time, news publishers rely more and more on social networks and citizen journalism as a frontline to breaking news. In this new era of fast- flowing instant news deli...

  7. ac bidirectional motor controller (United States)

    Schreiner, K.


    Test data are presented and the design of a high-efficiency motor/generator controller at NASA-Lewis for use with the Space Station power system testbed is described. The bidirectional motor driver is a 20 kHz to variable frequency three-phase ac converter that operates from the high-frequency ac bus being designed for the Space Station. A zero-voltage-switching pulse-density-modulation technique is used in the converter to shape the low-frequency output waveform.

  8. NEWS: Post-16 update (United States)

    Campbell, Peter


    sometimes hard-to-come-by information, insightful and occasionally witty comment and illustration. The fifth booklet, published in April this year, rounds off the series so far. For those who have not yet seen them, here are the questions that the booklets have explored: Making Physics Connect (editor: Peter Campbell). How can physics courses connect better with the learner and with other human activities and areas of knowledge? Physics in Mathematical Mood (editor: Simon Carson). How can we teach physics in an appropriately mathematical way, conveying the beauty and power of mathematical reasoning to students? Physics in Vocational Courses (editor: Ken Gadd). In the new National Qualifications Framework, what role should physics play in the `general vocational' and `vocational' pathways? The Study of Matter (editor: Claire Davis). What aspects of a wide and interdisciplinary subject should be included in courses at advanced level, and how can these best be taught? Revitalising Physics Education (editor: Andrew Morris). What can we learn from histories of physics and of education, or from curriculum development projects of the last thirty years? What can be said about teaching and learning physics beyond qualifications, or learned from international developments in physics education? These booklets should find their way into every physics department in the UK. They will be of immediate practical use in schools or colleges, informing teaching while also providing stimulus material for discussion among physics teachers. (The latter would rightly be called in-service training.) Student teachers will find them a good guide covering new terrain. Lecturers at higher education level will gain valuable insight into changes affecting their undergraduate intake. And the physics advisory committee of every Awarding Body will surely want to discuss issues raised in the booklets. The main message overall is that, to meet tomorrow's challenges, the many parties involved in physics

  9. Top medical news stories 2015


    Robbins RA


    No abstract available. Article truncated after 150 words. Here is our list of the top seven medical news stories for 2015 with special emphasis on the Southwest. 7. Wearable health devices: A wave of wearable computing devices such as Fitbit and UP wristbands have people keeping track of how much they sit, stand, walk, climb stairs and calories they consume (1). These fitness-tracking devices herald a series of devices that will detect and monitor serious diseases. However, these so-called me...

  10. NEWS: AAPT Summer Meeting (United States)

    Mellema, Steve


    The 2000 Summer Meeting of the American Association of Physics Teachers (AAPT) was held from 28~July-2~August at the University of Guelph in Ontario, Canada. Despite somewhat rainy weather throughout the week, the annual gathering was an enjoyable one, filled with interesting talks on the state of physics education in North America. Using a new scheduling format for the summer meeting, all of the paid workshops and tutorials were held on Saturday and Sunday 29-30 July. The invited and contributed papers for the main AAPT meeting were then presented on Monday, Tuesday and Wednesday. As had been done in 1999 in San Antonio, a two-day tandem meeting dedicated to Physics Education Research (PER) was held on Wednesday and Thursday 2-3 August, immediately after the main AAPT meeting. Over the three days of the main meeting, 60 sessions were held under the sponsorship of various AAPT committees. These included sessions (numbers in parentheses) organized by the committees on Apparatus (1), Astronomy Education (3), Awards (2), Computers (5), Graduate Education (2), High Schools (1), History and Philosophy (1), Instructional Media (3), International Education (1), Laboratories (2), Pre-High School Education (2), Programs (4), Professional Concerns (6), Research in Physics Education (8), Science Education for the Public (2), Two-Year Colleges (5), Undergraduate Education (7) and Women in Physics (4). Figure 1. Guelph Church of Our Lady. The main meeting opened on Sunday evening with an invited lecture by Dr John J Simpson from the host institution, the University of Guelph, describing the Sudbury Neutrino Observatory. At the ceremonial session that began the activities on Monday morning, recognition was given to Clifford Swartz for his almost 30 years of service as Editor of the AAPT journal, The Physics Teacher. This was followed by an invited talk by Jim Nelson from Seminole County Public School in Florida, who received the Excellence in Pre-College Teaching Award. The

  11. Detecting Terrorism Incidence Type from News Summary

    DEFF Research Database (Denmark)

    Nizamani, Sarwat; Memon, Nasrullah


    The paper presents the experiments to detect terrorism incidence type from news summary data. We have applied classification techniques on news summary data to analyze the incidence and detect the type of incidence. A number of experiments are conducted using various classification algorithms and...

  12. TV News Analysis Project Motivates Broadcast Class. (United States)

    Smith, James R.


    Describes the use of content analysis by a journalism class in studying television news. Indicates that the method is flexible, generates familiarity with quantitative approaches to the analysis of broadcast journalism, can result in increased awareness of the complexity of the broadcast news medium, and increases student motivation. (TJ)

  13. Computational Methods for Analyzing Health News Coverage (United States)

    McFarlane, Delano J.


    Researchers that investigate the media's coverage of health have historically relied on keyword searches to retrieve relevant health news coverage, and manual content analysis methods to categorize and score health news text. These methods are problematic. Manual content analysis methods are labor intensive, time consuming, and inherently…

  14. Creating Reality: How TV News Distorts Events. (United States)

    Altheide, David L.

    A three-year research project, including more than one year in a network affiliate station, provided the material for an analysis of current practices in television news programming. Based on the thesis that the organization of news encourages the oversimplification of events, this analysis traces the foundation of the bias called the "news…

  15. The Places and Spaces of News Audiences

    DEFF Research Database (Denmark)

    Historically, or so we would like to believe, the story of everyday life for many people included regular, definitive moments of news consumption. Journalism, in fact, was distributed around these routines: papers were delivered before breakfast, the evening news on TV buttressed the transition...

  16. News Analytics for Financial Decision Support

    NARCIS (Netherlands)

    V. Milea (Viorel)


    textabstractThis PhD thesis contributes to the newly emerged, growing body of scientific work on the use of News Analytics in Finance. Regarded as the next significant development in Automated Trading, News Analytics extends trading algorithms to incorporate information extracted from textual messag

  17. When Literature Language Meets News Language

    Institute of Scientific and Technical Information of China (English)



    Literature language and News language are two different language type,while,for attracting readers,writers more likely apply Literature language in News reports.This paper presents some comments on this phenomenon and make analysis,using examples to understand and comment on it.

  18. When Literature Language Meets News Language

    Institute of Scientific and Technical Information of China (English)



    Literature language and News language are two different language type, while, for attracting readers, writers more likely apply Literature language in News reports. This paper presents some comments on this phenomenon and make analysis, using examples to understand and comment on it.

  19. Scandal Clouds News Corporation's Move into Education (United States)

    Quillen, Ian


    When News Corporation announced last fall its entry into the education technology market, some observers said the media conglomerate led by Rupert Murdoch was a bad fit for education. Between the ownership of conservative-leaning outlets like Fox News and a reputation for identifying opportunities to generate lots of revenue very quickly, News…

  20. Stylistic Analysis on Online News Story Comments

    Institute of Scientific and Technical Information of China (English)

    LI Pei


    This study examines stylistic features of the news story comments from major online news outlets and their possible ef-fects on the evolution of the English language. With a corpus composed of 34 examples drawn from renowned news sites such as The Washington Post, The Economist, Wall Street Journal, CNN and NBC, a detailed analysis on the stylistic features and effects of the news story comments has been conducted for the purpose of discovering possible links between a poster ’s linguistic behav-ior and his thought process. The result shows that interrogative, noun phrase and verb phrase are commonly used in news story comments by virtue of their slightly ostentatious nature. Rhetorical devices such as metaphor, simile and parataxis are frequently employed among comments. And the relationship between a poster’s educational background and his postings is also touched up-on at the end of this study.

  1. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB


    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  2. AC/RF Superconductivity


    Ciovati, G.


    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  3. The NEWS Water Cycle Climatology (United States)

    Rodell, Matthew; Beaudoing, Hiroko Kato; L'Ecuyer, Tristan; William, Olson


    NASA's Energy and Water Cycle Study (NEWS) program fosters collaborative research towards improved quantification and prediction of water and energy cycle consequences of climate change. In order to measure change, it is first necessary to describe current conditions. The goal of the first phase of the NEWS Water and Energy Cycle Climatology project was to develop "state of the global water cycle" and "state of the global energy cycle" assessments based on data from modern ground and space based observing systems and data integrating models. The project was a multi-institutional collaboration with more than 20 active contributors. This presentation will describe the results of the water cycle component of the first phase of the project, which include seasonal (monthly) climatologies of water fluxes over land, ocean, and atmosphere at continental and ocean basin scales. The requirement of closure of the water budget (i.e., mass conservation) at various scales was exploited to constrain the flux estimates via an optimization approach that will also be described. Further, error assessments were included with the input datasets, and we examine these in relation to inferred uncertainty in the optimized flux estimates in order to gauge our current ability to close the water budget within an expected uncertainty range.

  4. News

    Institute of Scientific and Technical Information of China (English)


    China Sees First Quarterly Trade Deficit in 6 Years, Textile & Clothes Trade Remains Surplus China saw a trade deficit of 1.02 billion U.S. dollars from January to March this year, the fir st quarterly trade

  5. News (United States)


    Schools lecture: Institute of Physics roadshow is a lecture series with a difference Rugby Meeting: 17th Annual Meeting for Teachers of Physics boasts an impressive schedule Courses: Year-12 pupils go to Open University Camera Competition: Enter now to win a new camera! Conference: Teachers invited to CERN in September New Zealand: Royal Society of New Zealand tackles fear of physics Bulgaria: Fairies, witches and extraterrestrials: how to teach science using theatre Schools lecture: Institute seeks speaker for its annual lecture series Competition: Critical thinking is encouraged by global warming competition Scotland: Two good reasons to visit Scotland this summer Competition: Test your knowledge Free Event: June IOP conference Conference: Also in Liverpool…

  6. News

    Institute of Scientific and Technical Information of China (English)


    Textile & Clothes Orders Reach $4.56 Billon in Three Days Raw Material Prices Soaring Impact Canton Fair Leading by the cotton price, al-most all the textile and clothes raw material prices kept rising, which

  7. NEWS

    Institute of Scientific and Technical Information of China (English)


    Cotton spinning orders tends to transferred to Southeast Asia Customs data show that in the first four months by 2012, China imported a total of 430,000 tons of cotton yarn, an increase of 40% Y/Y.The im-ports increased in the number of cotton textile, yet

  8. News

    Institute of Scientific and Technical Information of China (English)


    Pension given to quake-hit staff After the severe earthquake struck southwestern China’s Sichuan province on May12, the China International Exhibition CenterGroup Co.,Ltd (CIEC) made immediate effortsto aid the quake-hit regions. More than 400,000yuan were donated by the group to the quake-devastated regions.

  9. NEWS

    Institute of Scientific and Technical Information of China (English)


    <正>Policy, standard, regulation Chongqing enacts China’s first local rule to govern the natural gas vehicle industry The administrative method is due to take effect on July 1, 2008. The legal process took the local authorities 3 years.

  10. News

    Institute of Scientific and Technical Information of China (English)


    "蓝色"年代最新"Blue"车款潮流若以"Blue"为词根,衍生出频率最高的词组、语句会是什么?blue sky,blue sea,blueJazz,还是 blueberry?"Blue"通常寓意"蓝色"、"忧郁"、"蓝调",然而在汽车制造业,近年来却赋予了"Blue"一个新的意义:"环保"!各大厂商在争相推出"Blue"技术,如Bluetec、BlueMotion 之后,便开始了新的"环保战役"。

  11. News

    Institute of Scientific and Technical Information of China (English)

    Celine; Yi


    China consumption in July hit 12-year high According to the statistics from National Bureau of Statistics of China, the retail sales of social consumer goods reached RMB 862.9 billion yuan in July,increased by 23.3% year on year and this is the highest record since February of 1996.Statistics

  12. NEWS

    Institute of Scientific and Technical Information of China (English)


    <正>Policy,standard,regulation Eco-friendly cars to get policy support in China Favorable policies that support the development of new energy vehicles are expected to come out this year,an insider from the China Association of Automobile Manufacturers was quoted as saying.

  13. News

    Institute of Scientific and Technical Information of China (English)


    "Made in China" Ad Campaign Calls for Global CooperationA 30-second TV commercial re-mains a hot topic in China nearly two weeks after four Chinese indus-try associations launched a "Made in China" ad campaign on the CNN

  14. NEWS

    Institute of Scientific and Technical Information of China (English)


    The 3rd Textile Entrepreneurs Survey:Economic Situation Turns to Better,Confidence Returns To follow the situation of textile enterprises, and learn the confidence of entrepreneurs on their business, China Textile Entrepreneur Association

  15. News

    Institute of Scientific and Technical Information of China (English)


    2010~2011 most competitive textile enterprises unveiled China National Textile Industry Council announced recently the evaluation result of 2010~2011 most competitive textile enterprises. At the meanwhile

  16. News

    Institute of Scientific and Technical Information of China (English)


    China Fashion Week 2011 Spring/Summer Concluded The nine-day China Fashion Week 2011 Spring/Summer concluded successfully in Beijing Hotel on Nov. 1st. The overall level of Chinese designers have obvious

  17. News

    Institute of Scientific and Technical Information of China (English)


    Chinese creativity blooms in Paris Following the event of"China in Paris·Unbounded Chinese Contemporary Creativity Night"show,which was listed in the official release schedule of Paris Fashion Week and held successfully in March

  18. News

    Institute of Scientific and Technical Information of China (English)


    Textile Export Grew Fast, But Future Still Unclear According to the latest Customs data, the export of textile & garment kept stable growth from Jan. to May. The accumulated export in first five months

  19. NEWS

    Institute of Scientific and Technical Information of China (English)


    "The twelfth ve-year plan" industrial transformation and upgrading plan released Textile industry was included in the key industries of reformRecently, the State Council officially released "industrial transformation and upgrading plan (2011-2015).

  20. News

    Institute of Scientific and Technical Information of China (English)


    PMI index down,the downward trend of economic growth continued China Federation of Logistics and Purchasing released November China’s Manufacturing Purchasing Managers Index(PMI) on December1,which indicated that the

  1. News

    Institute of Scientific and Technical Information of China (English)


    High-tech Prop up National Flag in Tian’anmen Square During the 60th National Day Ceremony,thousands of national flags are going to fly over the streets.They are all manufactured by an exclusive producer,Beijing Red Flag Co.,Ltd.

  2. News

    Institute of Scientific and Technical Information of China (English)


    China to Raise Export Tax Rebates for Textile,Garment Products China is raising tax rebates for certain exports to help producers cope with smaller profit margins as a result of slacking market demand,the yuan’s appreciation and rising production costs.

  3. News

    Institute of Scientific and Technical Information of China (English)


    <正>Policy,standard,regulation China says to raise tax on big cars China’s cabinet agreed in principle to raise the consumption tax on cars with large engines to help save energy,the government said recently.

  4. NEWS

    Institute of Scientific and Technical Information of China (English)


    <正>Policy, standard, regulation Shanghai to curb government car use to save energy Thousands of government vehicles in Shanghai will be taken off the roads for at least one day each week from the first day of November, the local government recently announced.

  5. NEWS

    Institute of Scientific and Technical Information of China (English)


    Policy, standard, regulation Shanghai to enact local standards on small cars The technical condition document (DB31/T390-2007) takes effect on Dec 1, 2007. The standard is in fact a threshold for small cars sold in Shanghai.

  6. News

    Institute of Scientific and Technical Information of China (English)


    RMB settlement of cross-border trade broaden to the whole nation e Central Bank revealed on Aug.23, Circular on Broaden RMB settlement of Cross-Border Trade to the Whole Nation, jointly released by Central Bank, Ministry of Finance,Ministry of Commerce, General Administrations of Customs, State Administration of Taxation and Banking Regulatory Commission, clearly defined that enterprises from Hebei,

  7. News

    Institute of Scientific and Technical Information of China (English)


    17th China International Trade Fair for Apparel Fabrics & Accessories Shanghai closes The 17th China International Trade Fair Fabrics & Accessories was held in Shanghai new international exhibition center from October 18~21. China is a big power for textile production and manufacturing, also

  8. News

    Institute of Scientific and Technical Information of China (English)


    Three Textile Exhibitions Open in Shanghai Intertextile Shanghai Home Textiles,and The 4th China Inter-national Knitting Trade Fair,and China International Trade Fair for Fibres and Yarns,is to open in Shanghai New International Expo Centre on 24-26 August 2010.

  9. News (United States)


    Particle Physics: LHC switch-on inspires pupils Science Fair: Science takes centre stage in Spain Conference: Czech and Slovak physicists get together Curriculum: UK needs independent curriculum body Conference: Edmonton enjoys a physics-show treat

  10. News

    Institute of Scientific and Technical Information of China (English)


    China Apparel Retail Sales Value+24.6%Y/Y in H1 The year-on-year growth of sales value remained stable According to the State Statistics Bureau,in the first half of 2011,the retail sales value of textile products including clothing,shoes,hats for

  11. News

    Institute of Scientific and Technical Information of China (English)


    Textile Exporters Report Profit Shrinking in First Four Monthse Ministry of Industry & Infor-mation Technology recently released China Industry Economic Operation Report 2011 Spring Edition, whichestimated the steady growth of con-sumer product industry in the future.From Jan. to Apr, the industrialadded value of statistics-worthy con-sumer product industry rose 14.2%;that’s 1.4 percentage points lowerfrom a year ago. Of which, the pace

  12. News


    Riedmann, Eva M.


    Chickenpox cases in the US drop by 80% Novel immunotherapy for breast, ovarian and prostate cancer successfully completes Phase 1 Important progress for Inovio’s universal influenza vaccine Vaccine against ricin exposure successful in phase 1B BCG could help reverse Type 1 Diabetes HPV vaccine: effective, when given early First vaccine for visceral leishmaniasis starts human testing CDC prepares vaccine for new swine flu strain

  13. News

    Institute of Scientific and Technical Information of China (English)


    2010 Intertextile Shanghai Apparel FabricsTrade Fair to Open Intertextile Shanghai Apparel Fabrics, the most important textile trade fair in the world, is to open for four days from 19 October 2010 at the Shanghai New International Exhibition Centre. Nearly 2,500 industry suppliers from 20 coun- tries and regions including Austria, Belgium, China,

  14. News

    Institute of Scientific and Technical Information of China (English)


    The list of eliminating backward production capability published Ministry of Industry and Information Technology (MIIT) declared enterprises’ list from 18 industries that to eliminate backward production

  15. News

    Institute of Scientific and Technical Information of China (English)


    Shandong Ruyi: Pioneer in Energy-saving & Emission-reductionRuyi Dyeing & Printing Co., Ltd., a subsidiary of Shandong Ruyi Group, is awarded as the pioneer in energy-saving and emission-reduction in the dyeing industry by Shandong Textile

  16. News

    Institute of Scientific and Technical Information of China (English)


    MOC Plans New Rule for Retail Business The access fee into supermarkets and department stores pushes flat prices and damage the interest of suppliers. Yao Jian, the spokenman of Ministry of Commerce said in a recent press conference that the MOC was drafting some rules to regulate this market

  17. News

    Institute of Scientific and Technical Information of China (English)


    Major Export Markets Going Up in Frist Four Months According to Customs Data,the export of textile and clothing accumulated to 70.255 billion USD in first four months,rising 27.05% from the same period last year.

  18. News

    Institute of Scientific and Technical Information of China (English)


    Investment in Textile Industry Kept Growth in Jan.-Apr. With the favorable policy support and the drive of domestic market demand, the investment in textile industry accumulated to 81.673 billion USD from Jan. to Apr. , up 19.95% year over year. The growth

  19. NEWS

    Institute of Scientific and Technical Information of China (English)


    East China Fair Revealed Encouraging Trading Volume The just closed 20th East China Fair revealed that the trading volume reached 2.733billion USD in the fi ve days session,up21.95% from same period last year.Both the trading volume and visitor numbers implied that the foreign trade was recovering.

  20. NEWS

    Institute of Scientific and Technical Information of China (English)


    OTEXA: Imports from China Kept Growth According to the latest data from OTEXA of the US,the import of Chinese textiles reached 4.202 billion USD from Mar.this year,up 26.13% from same period last year.The growth trend was continuing.

  1. News

    Institute of Scientific and Technical Information of China (English)


    CNTAC decided on the 9th batch of featured Textile Production Bases China National Textile and Appar-el Council (CNTAC) newly selected 23 cities or towns as the 9th batch of Textile Production Bases at the Great

  2. News (United States)


    IRELAND New courses for high-tech Ireland; SCIENCE YEAR Science Year launched with a jump; THE NETHERLANDS School science teachers face uncertainty; KOREA Embedding physics in a cultural context; TEACHING RESOURCES Teacher, get your hook; ICT RESOURCES Stock-take of ICT progress; INTERNET Teachers to test-drive new physics gateway; NEW ZEALAND Physics is valued in New Zealand; JAPAN Advancing Physics in Japan; HIGHER EDUCATION Networking works in Cologne; INSTITUTE MATTERS IoP demands a better deal for physics teachers; AUSTRALIA Physics numbers decline: educators blame the low impact curriculum; SCIENCE FOR THE PUBLIC More than sixty seconds in Glasgow; INTERNET A gift selection of papers from IoP; TEACHING STYLES I know what you did last summer;

  3. News (United States)


    Nearly Complete Set: I have an almost complete set of J. Chem. Educ., lacking only 3-4 volumes from the early 1930's. It is in pristine condition, bound each year (except the last five years), and used gently only by myself. I am retired and willing to part with this collection for a reasonable offer - I cannot afford to donate them. Any library or individual who might have a serious interest should contact Robert Goldenberg, P. O. Box 412, Westside Station, Buffalo, NY 14213; phone: 905/871-1098; email:

  4. News

    Institute of Scientific and Technical Information of China (English)


    Premier:Textile Industry will Overcome the DifficultiesOct. 27, Moscow. Premier Wen Jiabao made an interview regarding the current global financial crisis during his visit to Russia. He pointed out that China had adjusted the marco-economy policy in time and was going to further extend its domestic demand.

  5. NEWS

    Institute of Scientific and Technical Information of China (English)


    Policy, standard, regulationl Administration program for environmental protection during the 11th five-year collecting comments The State Environmental Protection Administration has recently issued the draft document for comments. The program is expected to form a framework and establish the policies for the period 2006-2010.

  6. News

    Institute of Scientific and Technical Information of China (English)


    T300 Carbon Fiber Technique Made Breakthrough Zhongfu Shenying Carbon Fiber&Key Equipment Program Completed CNTAC organized a technology achievement appraisal meeting in Lianyungang for the program of R&D of Annu

  7. NEWS

    Institute of Scientific and Technical Information of China (English)


    Cotton prices where to go after purchase and reserve end April,this year’s cotton purchasing and reserve work came to an end,the policy factors that support cotton prices weakened. For some time,how the cotton price will change has become the focus of widespread concern of the industry.

  8. News

    Institute of Scientific and Technical Information of China (English)


    2008/2009 China Top 500 Textile & Apparel Competitiveness Enterprises 2008/2009 China Top 500 Textile & Apparel Competitiveness Enterprises List was published on Aug. 8th in Guangzhou by China National Textile & Apparel Council.

  9. News

    Institute of Scientific and Technical Information of China (English)


    China Textile&Apparel Export Rebounds With the recovery of global economy,and the low base number of last year’s export,as well as the export product price rising droven by raw material price increase,the export of textile and apparel products turned to rebound in first half.

  10. NEWS

    Institute of Scientific and Technical Information of China (English)


    POLICY China set to restructure auto industry by mergers hina said it wanted to boost its auto industry by reducing the number of companies in the sector through mergers and promoting two or three carmakers to become the dominant players. The government's plans for auto industry reform were

  11. News

    Institute of Scientific and Technical Information of China (English)


    Textile Industry Sees Signs of an Easing Decline Under the interaction of global economic recession and easingdomestic macro environment,Chinese textile industry is also facingthe unstable drive of two markets,overseas and domestic.

  12. NEWS

    Institute of Scientific and Technical Information of China (English)


    Policy, standard, regulationl China to formulate national standard for fuel cell powered vehiclesThe campaign has started in Shanghai where first two documents-vehicle term and safety requirement are expected to come in 2008.

  13. NEWS

    Institute of Scientific and Technical Information of China (English)


    <正>Policy, standard, regulation China mulling fuel tax to replace road tolls China’s top economic planning body is working with other organizations to handle the feasibility of setting a new fuel pricing mechanism and introducing fuel taxes to replace road tolls and cut oil prices.

  14. NEWS

    Institute of Scientific and Technical Information of China (English)


    Jack 8th China National Garment Brand Annual Awards announced March 25,Jack The 8th China National Garment Brand Annual Awards Presentation Ceremony held at the Beijing Century Theatre. 9 awards of Chinese clothing were unveiled,namely they are: brand style,innovation potential,quality,planning,marketing,public,value,achievements as well as other special awards such as: promote,support,clothing,manufacturing,commercial.

  15. News

    Institute of Scientific and Technical Information of China (English)


    "12 five-year plan" Industrial Technology Innovation Plan released"12 five-year plan" Industrial Technology Innovation Plan was released by Ministry of Industry and Information Technology on November 14,clearing the objec-tives and priorities of industrial

  16. NEWS

    Institute of Scientific and Technical Information of China (English)


    Mercedes-Benz China Fashion Week concludedIn the evening of November 2nd, Mercedes-Benz China Fashion Week 2012 annual award ceremony, sponsored by WHITE COLLAR (a famous women’s apparel brand),was held in Beijing hotel golden hall.

  17. The Role of Audiovisual Mass Media News in Language Learning (United States)

    Bahrani, Taher; Sim, Tam Shu


    The present paper focuses on the role of audio/visual mass media news in language learning. In this regard, the two important issues regarding the selection and preparation of TV news for language learning are the content of the news and the linguistic difficulty. Content is described as whether the news is specialized or universal. Universal…

  18. 16 CFR 1012.6 - The news media. (United States)


    ... 16 Commercial Practices 2 2010-01-01 2010-01-01 false The news media. 1012.6 Section 1012.6... PERSONNEL AND OUTSIDE PARTIES § 1012.6 The news media. The Agency recognizes that the news media occupy a... inherently public nature of the news media allows their activities to be exempt from the requirements of...

  19. Engagement with News Content in Online Social Networks (United States)

    Oeldorf-Hirsch, Anne


    Reports indicate that as the Internet is displacing traditional news sources, younger users continue to be disconnected from the news. Fortunately, the Internet provides new ways of sharing and discussing news stories with others through social networking sites such as Facebook, which may be important for engaging users in the news they read…

  20. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  1. Breaking bad news in cancer patients

    Directory of Open Access Journals (Sweden)

    Apostolos Konstantis


    Full Text Available Objective: In a regional hospital, many patients are newly diagnosed with cancer. Breaking the bad news in these patients and their relatives is a tough task. Many doctors are not experienced in talking to patients about death or death-related diseases. In recent years, there have been great efforts to change the current situation. The aim of this study was to investigate the experience and education of medical personnel in breaking bad news in a secondary hospital. Materials and Methods: 59 doctors from General Hospital of Komotini, Greece were included in the study. All the doctors were in clinical specialties that treated cancer patients. A brief questionnaire was developed based on current guidelines such as Baile/SPIKES framework and the ABCDE mnemonic. Results: Residents are involved in delivering bad news less frequently than specialists. Only 21 doctors (35.59% had specific training on breaking bad news. 20 doctors (33.90% were aware of the available techniques and protocols on breaking bad news. 47 doctors (79.66% had a consistent plan for breaking bad news. 57 (96.61% delivered bad news in a quiet place, 53 (89.83% ensured no interruptions and enough time, 53 (89.83% used simple words and 54 (91.53% checked for understanding and did not rush through the news. 46 doctors (77.97% allowed relatives to determine patient′s knowledge about the disease. Conclusions: There were low rates of specific training in breaking bad news. However, the selected location, the physician′s speech and their plan were according to current guidelines.

  2. Hermetisk AC-Krets


    Hirsch, Carl; Smirnoff, Alexander


    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  3. The news machine hacking, the untold story

    CERN Document Server

    Hanning, James


    There is one mystery figure at the heart of ?Hackergate' ? Glenn Mulcaire, the News of the World's top private investigator. The former AFC Wimbledon footballer has never spoken publicly or in court about his work investigating and backing up front-page news stories (such as the News of the World's award-winning David Beckham scoop). Mulcaire's arrest in 2006 for intercepting royal-household phone messages barely registered at the time. Yet his work has continued to generate headlines and embarrassment for the establishment ? with a Prime Minister on the back foot after his former aide Andy

  4. ATLAS-1 Video News Release (United States)


    Allen Kenitzer, from Marshall Space Flight Center (MSFC), narrates this NASA Kennedy Space Center video presenting a MSFC-Television news release describing the overall scientific objectives of the Atmospheric Laboratory for Applications in Science-1 (ATLAS-1) Spacelab mission. Byron Lichtenberg (NASA Science Astronaut) and Anthony O'Neil (ATLAS-1 Mission Manager) explain that the 13 sophisticated and complementary instruments carried in shuttle Atlantis' payload bay are designed to identify the chemical species in our atmosphere, to measure the Sun's energy falling on and entering the atmosphere, to study the behavior of charged particles in the electric and magnetic fields surrounding the earth, and to gather ultraviolet light from stars and galaxies. ATLAS-1 is the first Spacelab flight of the National Aeronautics and Space Administration's (NASA's) Mission to Planet Earth.

  5. Your Lung Operation: After Your Operation

    Medline Plus

    Full Text Available ... the College Statements of the College Statements on Principles ACS Foundation ACS Foundation ACS Foundation Why Your ... News Stay Up to Date with ACS Association Management Services Jobs Events Find a Surgeon Patients and ...

  6. Ostomy Home Skills Program

    Medline Plus

    Full Text Available ... the College Statements of the College Statements on Principles ACS Foundation ACS Foundation ACS Foundation Why Your ... News Stay Up to Date with ACS Association Management Services Jobs Events Find a Surgeon Patients and ...

  7. The Interaction of Production and Consumption in the News Media Social Space (United States)

    Graham, Gary; Kerrigan, Finola; Mehmood, Rashid; Rahman, Mustafizur

    Newspapers are operating in increasingly competitive and fragmented markets for audiences and advertising revenues, government media policy and changing audience requirements for news and the ways in which it is presented and delivered. A growing army of bloggers and amateur citizen journalists now delivers - but rarely edits - content for all media platforms, while new media technologies, combined with the changing structure of global news industries, are radically changing the ways in which newspapers and media business functions and struggles for profitability. Our research sought to answer the question of how the internet is impacting on producer/consumer value activities in the news media supply chain. To answer this question initial descriptive statistical analysis was performed on 51 newspapers. This was followed by a focus group undertaken with London-based news media organizations and bloggers. The findings showed that in spite of initial fear and rejection, the internet is now firmly embedded in news media supply chain operations. Firms are now using the internet as an operant resource and working proactively with consumers to develop various forms of relationship value. We highlight the role of consumers in the creation of news (editorial) content and consumer-driven moves toward a merged media platform of distribution (including television, online, mobile and printed forms). Regional news media organizations will probably continue to survive if they are able to supply a highly specialized and 'hyper local' community service. This will be in the form of 'hybrid' content: analysis, interpretation and investigative reporting in a print product that appears less than daily combined with constant updating and reader interaction on the web.

  8. A good news or bad news has greater impact on the Vietnamese stock market?


    Nguyen, Phuong


    The arrival of news plays an extremely important role in the stock market because it mainly drives the movement of the stock market. In this paper, therefore, we would like to investigate how the Vietnamese stock market responses to the arrival of news via applying the AR – EGARCH in Mean model. Our research result indicates that the arrival of bad news has a greater impact on the conditional volatility than the arrival of good news does. We also found that there exists a positive tradeoff be...

  9. La crisis nuclear de Corea del Norte: Sky News o Fox News


    Pablo Rodríguez; Dimitrina Jivkova Semova


    En este artículo analizamos, desde la teoría del framing, la información ofre - cida por los dos canales de noticias 24 horas del grupo News Corporation, Sky News y Fox News, con relación a la crisis nuclear de Corea del Norte en el periodo 9 -23 de abril de 2013. Nos centramos en aspectos como la “foxificación”, la presencia de expertos militares en los bloques de noti - cias y los encuadres informativos. En el caso de Sky News, la información se ofrece desde el prisma de los sucesos a nivel...

  10. INVISIBLE GIANTS IN BROADCAST JOURNALISM: news agencies and the global news ecosystem

    Directory of Open Access Journals (Sweden)

    Maria Cleidejane Esperidião


    Full Text Available Key actors of the global informational web, the international television news agencies are not often covered in the communications field in Brazil. This paper aims to understand the dynamics established between these transnational companies and their subscribers (world television stations. It attempts to clarify how these western-led news agency companies operate within the flow of communication. It intends to identify production processes (assessment, collection, treatment and radial distribution for the Associated Press Television News (APTN and Reuters Television News (Reuters TV.

  11. The New News Media: Democratic implications of undergraduate education and news consumption over social and traditional media


    Miller, Jennifer


    Communication students at Simon Fraser University were surveyed and interviewed to deduce perceptions and behaviour of news consumption over social and traditional media. Both social media and traditional media are used to consume news with traditional media acting as the primary news source and as more accessible and reliable than social media. News stories considered important or having various perspectives were verified the most, especially world news. Extent of accessibility of sources an...

  12. News Media Framing of Negative Campaigning

    DEFF Research Database (Denmark)

    Pedersen, Rasmus Tue


    News media coverage of election campaigns is often characterized by use of the strategic game frame and a focus on politicians’ use of negative campaigning. However, the exact relationship between these two characteristics of news coverage is largely unexplored. This article theorizes that consumer...... demand and norms of journalistic independence might induce the news media outlets to cover negative campaigning with a strategic game frame. A comprehensive content analysis based on several newspaper types, several election campaigns, and several different measurements of media framing confirms...... that news coverage of negative campaigning does apply the strategic game frame to a significantly larger degree than articles covering positive campaigning. This finding has significant implications for campaigning politicians and for scholars studying campaign and media effects....

  13. Nuclear Malaysia in the news 2014

    International Nuclear Information System (INIS)

    Nuclear was a term that always misunderstands by public as a terrifying term. The nuclear activities around Malaysia was disseminated in newspaper and Malaysian Nuclear Agency as a responsible agency for nuclear for peace were collecting that news and compiled them to make the public aware the benefits of nuclear energy to develop our country. All the news about nuclear were collected using various type of newspaper published in Malaysia such as Utusan Malaysia, Berita Harian, Daily Express, News Straits Time, The Star, Borneo Post and others. This news was compiled according to their main topics such as energy, nuclear in agriculture, education and others. Each year one edition of this report will publish and disseminate it to the other libraries, government agencies, school and others to make the public aware the existence of nuclear activities around their countries.

  14. Nuclear Malaysia in The News 2015

    International Nuclear Information System (INIS)

    Nuclear was a term that always misunderstands by public as a terrifying term. The nuclear activities around Malaysia was disseminated in newspaper and Malaysian Nuclear Agency as a responsible agency for nuclear for peace were collecting that news and compiled them to make the public aware the benefits of nuclear energy to develop our country. All the news about nuclear were collected using various type of newspaper published in Malaysia such as Utusan Malaysia, Berita Harian, Daily Express, News Straits Time, The Star, Borneo Post and others. This news was compiled according to their main topics such as energy, nuclear in agriculture, education and others. Each year one edition of this report will publish and disseminate it to the other libraries, government agencies, school and others to make the public aware the existence of nuclear activities around their countries.

  15. Nuclear Malaysia in the news 2011

    International Nuclear Information System (INIS)

    Nuclear was a term that always misunderstood by public as a terrifying term. Nuclear activities around Malaysia were disseminated in newspaper and Malaysian Nuclear Agency as a responsible agency were collecting that news and compiled them. The purpose for this compilation were to make the public aware the benefits of nuclear energy and all the activities regarding nuclear surround them. All the news about nuclear technology were collected using various type of newspaper published in Malaysia such as Utusan Malaysia, Berita Harian, Daily Express, News Straits Time, The Star, Borneo Post and others. This news was compiled according to their main topics such as energy, nuclear in agriculture, education and others. Each year one edition of this report will publish and disseminate it to the other libraries, government agencies, school and others to make the public aware the existence of nuclear activities around their countries.

  16. Nuclear Malaysia in the news 2008

    International Nuclear Information System (INIS)

    Nuclear was a term that always misunderstood by public as a terrifying term. Nuclear activities around Malaysia were disseminated in newspaper and Malaysian Nuclear Agency as a responsible agency were collecting that news and compiled them. The purpose for this compilation were to make the public aware the benefits of nuclear energy and all the activities regarding nuclear surround them. All the news about nuclear technology were collected using various type of newspaper published in Malaysia such as Utusan Malaysia, Berita Harian, Daily Express, News Straits Time, The Star, Borneo Post and others. This news was compiled according to their main topics such as energy, nuclear in agriculture, education and others. Each year one edition of this report will publish and disseminate it to the other libraries, government agencies, school and others to make the public aware the existence of nuclear activities around their countries.

  17. Multimodal Indexing of Multilingual News Video

    Directory of Open Access Journals (Sweden)

    Hiranmay Ghosh


    Full Text Available The problems associated with automatic analysis of news telecasts are more severe in a country like India, where there are many national and regional language channels, besides English. In this paper, we present a framework for multimodal analysis of multilingual news telecasts, which can be augmented with tools and techniques for specific news analytics tasks. Further, we focus on a set of techniques for automatic indexing of the news stories based on keywords spotted in speech as well as on the visuals of contemporary and domain interest. English keywords are derived from RSS feed and converted to Indian language equivalents for detection in speech and on ticker texts. Restricting the keyword list to a manageable number results in drastic improvement in indexing performance. We present illustrative examples and detailed experimental results to substantiate our claim.

  18. Nuclear Malaysia in the news 2010

    International Nuclear Information System (INIS)

    Nuclear was a term that always misunderstood by public as a terrifying term. Nuclear activities around Malaysia were disseminated in newspaper and Malaysian Nuclear Agency as a responsible agency were collecting that news and compiled them. The purpose for this compilation were to make the public aware the benefits of nuclear energy and all the activities regarding nuclear surround them. All the news about nuclear technology were collected using various type of newspaper published in Malaysia such as Utusan Malaysia, Berita Harian, Daily Express, News Straits Time, The Star, Borneo Post and others. This news was compiled according to their main topics such as energy, nuclear in agriculture, education and others. Each year one edition of this report will publish and disseminate it to the other libraries, government agencies, school and others to make the public aware the existence of nuclear activities around their countries.

  19. The Electronic Archiving of Arab News Agencies

    Directory of Open Access Journals (Sweden)

    Haifa Ayub Gigawy


    Full Text Available This Research aims to present the electronic archives of Arab news agency websites and their methods of searching for and retrieving information. Also, its aim is to examine all their methods in order to find out which are the best and most practically useful ones. The research refers to the news agencies and the Internet, through the methods that users encounter in these inquires and links which present information. It concentrates on practical ways of searching for news items in both texts and pictures. The research contains tables showing the results. It presents a brief summery for each of Arab news agencies.The research comes to the conclusion that there are many things which need to be considered, and also some suggestions as to how the search for and retrieval of information might be improved

  20. Nuclear Malaysia in the news 2012

    International Nuclear Information System (INIS)

    Nuclear was a term that always misunderstood by public as a terrifying term. Nuclear activities around Malaysia were disseminated in newspaper and Malaysian Nuclear Agency as a responsible agency were collecting that news and compiled them. The purpose for this compilation were to make the public aware the benefits of nuclear energy and all the activities regarding nuclear surround them. All the news about nuclear technology were collected using various type of newspaper published in Malaysia such as Utusan Malaysia, Berita Harian, Daily Express, News Straits Time, The Star, Borneo Post and others. This news was compiled according to their main topics such as energy, nuclear in agriculture, education and others. Each year one edition of this report will publish and disseminate it to the other libraries, government agencies, school and others to make the public aware the existence of nuclear activities around their countries.

  1. Generating News Headlines with Recurrent Neural Networks


    Lopyrev, Konstantin


    We describe an application of an encoder-decoder recurrent neural network with LSTM units and attention to generating headlines from the text of news articles. We find that the model is quite effective at concisely paraphrasing news articles. Furthermore, we study how the neural network decides which input words to pay attention to, and specifically we identify the function of the different neurons in a simplified attention mechanism. Interestingly, our simplified attention mechanism performs...

  2. News media consumption among immigrants in Europe

    DEFF Research Database (Denmark)

    Christiansen, Connie Carøe


    In recent years, especially with the advent of Digital Broadcasting Technology, transnational media has become central in the consumption of news by immigrant populations. This has received some attention as a factor associated with lack of integration into their new societies. The present article...... international news than is currently the national television channels, are also part of the picture. A diaspora perspective transforms the prospect presented by observers and journalists, worried about integration processes, and prompts considerations that immigrants are also emigrants....


    Directory of Open Access Journals (Sweden)

    Kalyani Joshi


    Full Text Available Efficient Market Hypothesis is the popular theory about stock prediction. With its failure much research has been carried in the area of prediction of stocks. This project is about taking non quantifiable data such as financial news articles about a company and predicting its future stock trend with news sentiment classification. Assuming that news articles have impact on stock market, this is an attempt to study relationship between news and stock trend. To show this, we created three different classification models which depict polarity of news articles being positive or negative. Observations show that RF and SVM perform well in all types of testing. Naïve Bayes gives good result but not compared to the other two. Experiments are conducted to evaluate various aspects of the proposed model and encouraging results are obtained in all of the experiments. The accuracy of the prediction model is more than 80% and in comparison with news random labelling with 50% of accuracy; the model has increased the accuracy by 30%.

  4. Focal Points on Constructing News Stories

    Directory of Open Access Journals (Sweden)

    Elena Yuryevna Ilyinova


    Full Text Available The issues stated in the article line with the current interest to pragmatic value of news releases in modern media. The news is thought to be a verbalized focal reflection of some event that was chosen by media professionals for setting the current information agenda. Having generated the opinions on the newsworthiness the authors present a set of values that may be used for measurement of relevance and clarity of an event reflection in the news content with frequency, clarity, predictability, unexpectedness, amplitude, cultural proximity, elite nations, elite people, personification, negativity among them. The novelty of the research is that the newsworthiness is checked with the focus to lexical (thematic representation of the news in a diachronic approach: the empirical base of the research was taken from the archives of UK national and local media sources (18–20th cent. and implied comparison of lexical means that reflected an event itself and some values of human interest potential in the news stories written in defined periods. The article states the trend for dynamics in the way the event is reflected in the news stories – the information core of the story is merged with detailed reporting parts, and their content is conditioned by social and moral values.

  5. New York Times Current News Physics Applications (United States)

    Cise, John


    Since 2007 I have been using NYTimes current News articles rich in graphics and physics variables for developing edited one page web ( physics questions based on current events in the news. The NYTimes home page listed above contains currently ten pages with about 40 one page current edited News related physics articles per page containing: rich graphics, graphic editions by the author, edited articles, introduction to a question, questions, and answers. I use these web pages to introduce new physics concepts to students with current applications of concepts in the news. I also use these one page physics applications as pop quizzes and extra credit for students. As news happens(e.g. the 2010 Vancouver Olympics) I find the physics applications in the NYTimes articles and generate applications and questions. These new one page applications with questions are added to the home page: The newest pages start with page 10 and work back in time to 9, 8, etc. The ten web pages with about 40 news articles per page are arranged in the traditional manner: vectors, kinematics, projectiles, Newton, Work & Energy, properties of matter, fluids, temperature, heat, waves, and sound. This site is listed as a resource in AAPT's Compadre site.

  6. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar


    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  7. Superconducting ac cable

    International Nuclear Information System (INIS)

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.)

  8. News Portrayal of Cancer: Content Analysis of Threat and Efficacy by Cancer Type and Comparison with Incidence and Mortality in Korea. (United States)

    Shim, Minsun; Kim, Yong-Chan; Kye, Su Yeon; Park, Keeho


    How the news media cover cancer may have profound significance for cancer prevention and control; however, little is known about the actual content of cancer news coverage in Korea. This research thus aimed to examine news portrayal of specific cancer types with respect to threat and efficacy, and to investigate whether news portrayal corresponds to actual cancer statistics. A content analysis of 1,138 cancer news stories was conducted, using a representative sample from 23 news outlets (television, newspapers, and other news media) in Korea over a 5-year period from 2008 to 2012. Cancer incidence and mortality rates were obtained from the Korean Statistical Information Service. Results suggest that threat was most prominent in news stories on pancreatic cancer (with 87% of the articles containing threat information with specific details), followed by liver (80%) and lung cancers (70%), and least in stomach cancer (41%). Efficacy information with details was conveyed most often in articles on colorectal (54%), skin (54%), and liver (50%) cancers, and least in thyroid cancer (17%). In terms of discrepancies between news portrayal and actual statistics, the threat of pancreatic and liver cancers was overreported, whereas the threat of stomach and prostate cancers was underreported. Efficacy information regarding cervical and colorectal cancers was overrepresented in the news relative to cancer statistics; efficacy of lung and thyroid cancers was underreported. Findings provide important implications for medical professionals to understand news information about particular cancers as a basis for public (mis)perception, and to communicate effectively about cancer risk with the public and patients. PMID:27478333

  9. A Blind Angle? News Sources, Gender and Ethnicity in Danish TV News

    DEFF Research Database (Denmark)

    Fiig, Christina

    The paper will present and discuss a framework for grasping some of the democratic consequences of biased TV news programs. In line with Jürgen Habermas, one can ask what consequences it has for a democratic public sphere that the national TV news landscape is biased in term of source diversity...

  10. Television News and Sexist Language: A Study of Television News Effects. (United States)

    Gebhardt, Randall E.; Harless, James D.

    To test the hypothesis that use of sexist language in television newscasts cultivates images of women as immature, frivolous, or incompetent, two television news anchors (one male, one female) were asked to tape versions of a news story involving a 28-year-old female lottery winner. In one version, each anchor referred to this female as "woman,"…

  11. News reported on 30 November 1993 by the Middle East News Agency

    International Nuclear Information System (INIS)

    The document reproduces a letter dated 27 December 1993 from the Alternate Resident Representative of Iraq to the IAEA including in an annex the news reported on 30 November 1993 by the Middle East News Agency concerning the detection of nuclear radiations in Iraqi military equipment left behind by the Iraqi army during the war for Kuwait liberation

  12. News From Nowhere: Sources of International News in the Pacific Islands. (United States)

    Richstad, Jim; Nnaemeka, Tony

    A study was undertaken to examine the sources of international news in the Pacific Island press in the light of J. Galtung's structural theory of imperialism and to explore the relationship between the remoteness and isolation of the Pacific press and its sources of news. The Galtungian concepts of center-periphery and dominance-dependency were…

  13. Top medical news stories 2015

    Directory of Open Access Journals (Sweden)

    Robbins RA


    Full Text Available No abstract available. Article truncated after 150 words. Here is our list of the top seven medical news stories for 2015 with special emphasis on the Southwest. 7. Wearable health devices: A wave of wearable computing devices such as Fitbit and UP wristbands have people keeping track of how much they sit, stand, walk, climb stairs and calories they consume (1. These fitness-tracking devices herald a series of devices that will detect and monitor serious diseases. However, these so-called medical-grade wearables require approval from the U.S. Food and Drug Administration, a regulatory hurdle avoided by the fitness-tracking devices which will likely slow their introduction. 6. Caitlyn Jenner: Caitlyn Jenner became the most famous transgender woman in the world following an interview published in Vanity Fair (2. The Vanity Fair website saw 11.6 million visits curious about the former Olympic athlete. Though Jenner publicly shared her gender identity, many transgender Americans do not-12% of gender non-conforming adults said they ...

  14. News Ethics in View of Vviolence Against Women

    Directory of Open Access Journals (Sweden)

    Çiler Dursun


    Full Text Available The issue of how violence against women is represented on news is included in the concerns of critical and feminist media studies way back. It is displayed that the representations of women in general and the violence against women news are constructed in the form of strenghtening the meanings against women in society. The fundamental dynamic of this problematic representations is embedded into the epistemic status of news that assertes it as neutral and impartial knowledge and which is proposed by liberal positivistic approach to the news. News constructs images and meanings which strenghten existed patriarchal meaning regime in society. Because of the issue is emerged at the level of operation of news and its characteristics as knowledge, solution will arise on the ground of revising of this knowledge and improving a news ethics parallel to this. Here, by examining feminist critical approach to the news and to the macho work culture of news producing, a different epistemic status for news which makes possible an original and authentic news ethics is offered. It is essential to improve a new work ethics that journalists embraces and recognizes their responsibilities in society for reducing the dominant meaning cycle which justifies and naturalizes violence against women Aiming at this future, main lines of the news ethics which is developed by journalism institutions is displayed, and then foundations of a novel news ethics is proposed which will be capable to transform the self recognition of journalists

  15. Modeling news dissemination on nuclear issues

    Energy Technology Data Exchange (ETDEWEB)

    Reis Junior, Jose S.B.; Barroso, Antonio C.O.; Menezes, Mario O., E-mail: jsbrj@ime.usp.b, E-mail: barroso@ipen.b, E-mail: mario@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)


    Using a modified epidemiological model, the dissemination of news by media agents after the occurrence of large scale disasters was studied. A modified compartmented model was developed in a previous paper presented at INAC 2007. There it used to study to the Chernobyl's nuclear accident (1986) and the Concorde airplane crash (2000). Now the model has been applied to a larger and more diverse group of events - nuclear, non-nuclear and naturally caused disasters. To be comprehensive, old and recent events from various regions of the world were selected. A more robust news repository was used, and improved search techniques were developed to ensure that the scripts would not count false positive news. The same model was used but with improved non-linear embedded simulation optimization algorithms to generate the parameters of interest for our model. Individual parameters and some specific combination of them allow some interesting perceptions on how the nature of the accident / disaster gives rise to different profiles of growth and decay of the news. In our studies events involving nuclear causes generate news repercussion with more explosive / robust surge profiles and longer decaying tails than those of other natures. As a consequence of these differences, public opinion and policy makers are also much more sensitive to some issues than to others. The model, through its epidemiological parameters, shows in quantitative manner how 'nervous' the media content generators are with respect to nuclear installations and how resilient this negative feelings about nuclear is. (author)

  16. Physician-patient communication: breaking bad news. (United States)

    Fields, Scott A; Johnson, W Michael


    Physicians often struggle with how to manage the task of breaking bad news with patients. Moreover, the arduous nature of the task can contribute to physician detachment from the patient or an avoidance of breaking the news in a timely manner. A plan of action can only improve physician confidence in breaking bad news, and also make the task more manageable. Over a decade ago, Rabow and McPhee offered a strategy; the ABCDE plan, which provided a patient centered framework from which to deliver troubling news to patients and families. At the heart of this plan was the creation of a safe environment, the demonstration of timely communication skills, and the display of empathy on the physician's part. Careful consideration of the doctor's own reactions to death and dying also played an important role. A close review of the five tenets of this plan indicates the relevance of Rabow and McPhee's strategy today. The patient base in our nation and state continues to be older, on average, and physicians are faced with numerous patients who have terminal illness. A constructive plan with specific ideas for breaking bad news can help physicians effectively navigate this difficult task. PMID:22655433

  17. Wordplay in English Online News Headlines

    Directory of Open Access Journals (Sweden)

    Roya Monsefi


    Full Text Available Within the endless stream of information available on the news media market, news headline language is characterised by several linguistic, pragmatic, rhetorical and functional features that distinguish it from other varieties of language that are not specialised. In the present study, the rhetorical features of English news headlines, through wordplay investigation, using a sample of 100 headlines were studied. Wordplay is investigated because it leads to the persuasiveness of message that is sometimes so subtle that the readers might not even recognise it. A taxonomy of wordplays was constructed according to Leigh’s (1994 model which made it possible to access a comprehensive checklist. The way the persuasive element, i.e. wordplay, was presented for the English headline readers was examined using the descriptive method and in light of textual rhetorical analysis. The outcome of the study suggests that English news headlines are likely to contain one or more clearly defined wordplay. The most frequent wordplay is that of tropes or more specifically metonymy. However, there are some wordplays such as polysyndeton, anadiplosis, antimetabole, epistrophe and polyptoton that are absent in English headlines. The majority of unused categories fall under the category of schemes.Keywords: wordplay, news headlines, schemes, tropes, rhetoric

  18. Measuring the Interestingness of News Articles

    Energy Technology Data Exchange (ETDEWEB)

    Pon, R K; Cardenas, A F; Buttler, D J


    An explosive growth of online news has taken place. Users are inundated with thousands of news articles, only some of which are interesting. A system to filter out uninteresting articles would aid users that need to read and analyze many articles daily, such as financial analysts and government officials. The most obvious approach for reducing the amount of information overload is to learn keywords of interest for a user (Carreira et al., 2004). Although filtering articles based on keywords removes many irrelevant articles, there are still many uninteresting articles that are highly relevant to keyword searches. A relevant article may not be interesting for various reasons, such as the article's age or if it discusses an event that the user has already read about in other articles. Although it has been shown that collaborative filtering can aid in personalized recommendation systems (Wang et al., 2006), a large number of users is needed. In a limited user environment, such as a small group of analysts monitoring news events, collaborative filtering would be ineffective. The definition of what makes an article interesting--or its 'interestingness'--varies from user to user and is continually evolving, calling for adaptable user personalization. Furthermore, due to the nature of news, most articles are uninteresting since many are similar or report events outside the scope of an individual's concerns. There has been much work in news recommendation systems, but none have yet addressed the question of what makes an article interesting.

  19. Modeling news dissemination on nuclear issues

    International Nuclear Information System (INIS)

    Using a modified epidemiological model, the dissemination of news by media agents after the occurrence of large scale disasters was studied. A modified compartmented model was developed in a previous paper presented at INAC 2007. There it used to study to the Chernobyl's nuclear accident (1986) and the Concorde airplane crash (2000). Now the model has been applied to a larger and more diverse group of events - nuclear, non-nuclear and naturally caused disasters. To be comprehensive, old and recent events from various regions of the world were selected. A more robust news repository was used, and improved search techniques were developed to ensure that the scripts would not count false positive news. The same model was used but with improved non-linear embedded simulation optimization algorithms to generate the parameters of interest for our model. Individual parameters and some specific combination of them allow some interesting perceptions on how the nature of the accident / disaster gives rise to different profiles of growth and decay of the news. In our studies events involving nuclear causes generate news repercussion with more explosive / robust surge profiles and longer decaying tails than those of other natures. As a consequence of these differences, public opinion and policy makers are also much more sensitive to some issues than to others. The model, through its epidemiological parameters, shows in quantitative manner how 'nervous' the media content generators are with respect to nuclear installations and how resilient this negative feelings about nuclear is. (author)

  20. Ac Hybrid Charge Controller

    Directory of Open Access Journals (Sweden)

    Shalini S. Durgam


    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.



    Heywood, Emma


    The thesis explores the state of European foreign conflict reporting by public sector broadcasters, post-Cold War and post-9/11. It provides a comparative analysis of the news values of three television news providers from three differing public systems: BBC’s News at 10, representing a British public service broadcaster, nominally independent of government control; Russia’s Vremya on Channel 1, a state-aligned broadcaster used, to a large extent, as a mouthpiece for the government; and Franc...

  2. Early Telegraphic News Dispatches: Forerunner of the AP (United States)

    Schwarzlose, Richard A.


    While the Associated Press's origins remain obscure, a "news broker" system operated in New York City in 1846 and news dispatches occupied telegraph lines almost as soon as the lines were opened. (RB)

  3. News Framing in a Time of Terror

    DEFF Research Database (Denmark)

    Jørndrup, Hanne


    This article analyses how Danish media framed the Copenhagen attacks in February 2015. The attacks did not take the Danish media by surprise. They were instantly picked up as breaking, developing news – something journalists know how to deal with. More so they had recently been engaged in the...... coverage of similar events, when reporting from the attacks in Paris in January 2015. The paper will present a framing analysis of the coverage of the attacks in the newscast on DR1 from the first shot at Krudttønden into the following week. Furthermore, the analysis will discuss how the labelling of the...... shooting as a “terror attack” transformed the news coverage into a ‘News Media’ media event (Nossek 2008), abandoning the journalistic norm of critical approach. Instead media became the scene of national mourning – at least for a couple of days until political debate and political journalism resumed...

  4. Water and environment news. No. 1

    International Nuclear Information System (INIS)

    This news bulletin will brief the reader on news related to isotope applications in the water and environment sector. It will bring the reader up to date on what is going on in the various projects constituting the IAEA sub programme entitled Development and Management of Water Resources, and will highlight new results and achievements made in implementing the programme activities, including those jointly carried out with other organizations and institutes. Furthermore, the news bulletin will serve as an international open forum for the exchange of information in isotope hydrology and related fields. The first issue will make readers acquainted with general aspects of the Agency's sub-programme mentioned above, give an overview on past activities and achievements, and highlight current ones. The Agency's staff involved in all these activities is briefly introduced

  5. On the Strategies for Translating English News Headlines

    Institute of Scientific and Technical Information of China (English)

    Wang Chao


    A good headline can not only attract readers' attention and trigger their desire to read, but also help them grasp the main points. Thus, news headlines act as guides for readers to choose the information they need. Headlines play a peculiar and essential role in news reporting. In order to understand the headline well, it's better for us to know something about the features and translations of English news headlines. In this paper, the strategies of translation of English news headlines are introduced.

  6. The Effect of Facebook on Parasocial Interaction in Local News


    Farmer, Whitney


    News agenciesâ ratings often hinge on the relationships their anchors build with viewers. Strong feelings of parasocial interaction, or these on-sided â relationshipsâ audiences feel with on-screen media figures, have been found to be a strong predictor of media use. Local news stations have long been challenged with ways to encourage these feelings of parasocial interaction. With local news ratings consistently falling, news agencies must consider new ways to gain untapped markets a...

  7. AcEST: BP920072 [AcEST

    Lifescience Database Archive (English)


  8. A Comparative Study of News Sources in Sino-English News Reports Re-lated to Nobel Winner Mo Yan

    Institute of Scientific and Technical Information of China (English)



    News, by no means a neutral vehicle, is in reality ideologically driven and controlled by news values to which the use of news sources is of great help. Geis once argued that the single most important power of the press is its capacity to say what the important issues are at any particular time and to determine whose voices will be heard on any given issue (Geis, 1987:10). News sources may tell readers something, but it may also mislead readers since people cannot think about and make sense out of news events without imposing a bias on the news. It is, therefore, worth our attention and effort to understand how news source works, how it affects readers' perceptions of news events, how it is produced, how it is shaped by values and ideology.

  9. News Media, Crime and Fear of Violence


    Mirka Smolej


    Finland witnessed a surge in crime news reporting during the 1990s. At the same time, there was a significant rise in the levels of fear of crime reported by surveys. This research examines whether and how the two phenomena: news media and fear of violence were associated with each other. The dissertation consists of five sub-studies and a summary article. The first sub-study is a review of crime reporting trends in Finland, in which I have reviewed prior research and used existing Finni...

  10. Robust anchorperson detection for TV news segmentation (United States)

    Lu, Ko-Yen; Chang, Min-Kuan; Yeh, Chia-Hung; Shih, Maverick


    In this paper, we proposed a scheme for TV news segmentation via exploring the efficient visual features. The proposed scheme can be divided into three parts, such as shot change detection based on skin color; probable anchorperson shot detection and anchorperson detection. According to experimental results, our proposed method can efficiently decompose TV news into anchorperson shots and report shots. Compared to the traditional face detection methods, the proposed method can robustly exclude the non-anchorperson shots in report shots such as the interview scenes. Experimental results are given to demonstrate the feasibility and efficiency of the proposed technique.

  11. A Critical Discourse Analysis of News Reports

    Institute of Scientific and Technical Information of China (English)

    SHEN Ke-lin


    Critical discourse analysis studies the relations between discourse, power, dominance, etc. and the position of the analyst. News report, which is a sociopolitical and official discourse, is often greatly affected by power or dominant ideologies and it affects people’s ideologies and attitudes. The comparative study of two pieces of news report on the same event respectively from China Daily and Times New York shows that ideology and power relationship are hidden in the public discourses and serve their purpose of forming people’s ideology.

  12. Affective priming during the processing of news articles

    NARCIS (Netherlands)

    S.E. Baumgartner; W. Wirth


    The present study investigates the role of affective priming during the processing of news articles. It is assumed that the valence of the affective response to a news article will influence the processing of subsequent news articles. More specifically, it is hypothesized that participants who read

  13. The Significance of Vague Language in Political News in

    Institute of Scientific and Technical Information of China (English)



    Political News always reports the facts happening in the country's political life, which mainly including the guidelines, this paper aims to analyze the application of Vague Language in political news in magazine in details. In this way, to help the readers understand and appreciate the political news better.

  14. Network Television Evening News Coverage of Infectious Disease Events. (United States)

    Greenberg, Michael; Wartenberg, Daniel


    Examines coverage of several infectious diseases and teenage suicide to see whether television news favors covering illness where it clusters or when it occurs near major news centers where it is easier to cover. Finds that television news did go to where the illness broke out but tended to favor reporting urban over rural suicides. (RS)

  15. News for the '90s: A Question of Values. (United States)

    Silver, Rosalind, Ed.; Thoman, Elizabeth, Ed.


    This special issue of "Media & Values" gives a perspective on how news is changing, what is missing in the news, and how to spot bias and misinformation in news coverage, both print and electronic. Articles examine the impact of computer imaging on the credibility of photographs and the issue of privacy--just how far should journalists go to get a…

  16. 7 CFR 500.9 - Photographs for news or advertising. (United States)


    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Photographs for news or advertising. 500.9 Section 500... for news or advertising. Photographs for news purposes may be taken at the USNA without prior permission. Photographs for advertising and other commercial purposes may be taken, but only with the...

  17. The E-C Translation of Vocabularies in Sports News

    Institute of Scientific and Technical Information of China (English)



    In recent years, many world top level sports events take place in China. The exchange in sports field between China and international society adds more significance to the E-C translation of sports news. This paper analyses the lexical features of sports news and then explains some difficulties in the translation of the words of sports news.

  18. Context-Aware Browsing for Hyper-Local News Data (CABHLND

    Directory of Open Access Journals (Sweden)

    Dr. Yousef Ibrahim Daradkeh


    Full Text Available This paper describes a new model for delivering hyper-local data to mobile subscribers. Our model uses any exiting or especially created Wi-Fi hot spot as presence sensor that can open access for some user-generated content. In our approach we can describe hyper local data as info snippets that are valid (relevant for mobile subscribers being at this moment nearby some Wi-Fi access point. And an appropriate mobile service (customized browser can discover that information to mobile users. Service builds on the fly dynamic web pages and lets mobile subscribers to browse hyper-local data only. As the possible use-cases we can mention for example delivering news and deals in malls, news feeds for office centers and campuses, Smart City projects, personal classifieds etc.

  19. Nuclear news from the world

    International Nuclear Information System (INIS)

    The Monju breeder reactor (Japan) has diverged again after a shutdown period of 14 years. This prototype reactor was stopped in 1995 after a sodium leak from its cooling system had initiated a fire. The construction works of the third power reactor on Brazilian soil has begun on the Angra site. The Chinese advanced research reactor (CARR - 60 MWth) diverged for the first time on May 2010 the 13., its design nears that of the Australian Opale reactor. The first reactor of the Ling Ao Phase 2 has been commissioned, this reactor is the first Chinese model (CPR-1000) to be built, it is the fruit of the technological transfer agreements that were signed in 1992 and 1995 with Framatome. The Finn government has given its agreement for the extension of the storing capacity in deep geological layers of the Posiva Oy center, this capacity is now of 9000 tonnes of uranium. Russia and Namibia have signed an agreement for the exploration and exploitation of uranium mines. The 2 first BWR-type reactors (1350 MW) on American soil will be constructed in the state of Texas. Russia and Turkey have signed an agreement for the construction of the first nuclear power plant in Turkey, this plant will be composed of 4 reactors. A study shows that there is no supplementary health hazards in the surroundings of nuclear power plants in Spain. (A.C.)

  20. President Ilves gives interview to Russian Interfax news service

    Index Scriptorium Estoniae


    President Toomas Hendrik Ilvese intervjuust Venemaa agentuurile Interfax. Küsimused puudutasid Eesti-Vene suhteid, piirilepingut, venelaste olukorda Eestis, Tallinnas asuva Teise maailmasõja mälestusmärgi teisaldamise võimalust

  1. Natural gas news; Gaz actualites

    Energy Technology Data Exchange (ETDEWEB)



    This brochure is a compilation of practical information concerning the Gaz de France group: organization chart, daughter companies, services, economical activity, natural gas market, trade, regulations etc. A list of partners, directions, centres, groups, associations and other various organisms in relation with Gaz de France company is given. (J.S.)

  2. Induction Motor Control through AC/DC/AC Converters


    Elfadili, Abderrahim; Giri, Fouad; Ouadi, Hamid; El Magri, Abdelmounime; Dugard, Luc; Abouloifa, Abdelmajid


    We consider the problem of controlling inductions motors driven through AC/DC rectifiers and DC/AC inverters. The control objectives are threefold: (i) forcing the motor speed to track a reference signal, (ii) regulating the DC Link voltage, (iii) assuring a satisfactory power factor correction (PFC) with respect to the power supply net. First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a nonlinear multi-loop controller is synthesized using th...

  3. AcEST: BP920905 [AcEST

    Lifescience Database Archive (English)


  4. AcEST: DK950147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0007_O05 706 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_O05. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  5. AcEST: DK959344 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0004_G23 714 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_G23. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  6. AcEST: DK949716 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0006_L20 613 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_L20. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  7. Comparing local TV news with national TV news in cancer coverage: an exploratory content analysis. (United States)

    Lee, Chul-Joo; Long, Marilee; Slater, Michael D; Song, Wen


    The authors compared local TV news with national TV news in terms of cancer coverage using a nationally representative sample of local nightly TV and national network TV (i.e., ABC, CBS, NBC, and CNN) cancer news stories that aired during 2002 and 2003. Compared with national TV news, local TV cancer stories were (a) much shorter in length, (b) less likely to report on cancer prevention (i.e., preventive behaviors and screening tests), and (c) less likely to reference national organizations (i.e., National Cancer Institute, American Cancer Society, National Institutes of Health, Centers for Disease Control and Prevention, Food and Drug Administration) that have made clear recommendations about ways to prevent cancer. The implications of these findings for health communication research and cancer education were discussed. PMID:24750022

  8. News from the Library: PressDisplay on mobile devices!

    CERN Multimedia

    CERN Library


    You are probably already using PressDisplay to read newspapers online, but for those of you who are not yet aware of this service, PressDisplay is an online portal where you can browse and read online articles from more than 1,900 newspapers from 95 countries, as soon as they are published.   Whether you are an experienced user or a beginner, we have good news concerning PressDisplay: our license now permits you to download complete newspaper issues to your mobile devices and read them offline wherever you like. To do that, you have to use the mobile app PressReader. Instructions on how to install the PressReader app are available here: For Ipad For Android smartphone For Android tablet For Windows 8 devices For BlackBerry Playbook For Android eReader Your feedback is welcome! Please contact us by e-mail.

  9. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Energy Technology Data Exchange (ETDEWEB)

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))


    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  10. Different Visions of Framing Violence in International Press News

    DEFF Research Database (Denmark)

    Ramirez, Jacobo

    Mass media can play an important role in capturing the dynamic between social groups and institutional environments. This paper presents a quantitative content analysis of international news to determine and analyze the themes covered by the international news press in relation to violence in Mex...... on the dynamic between informal and formal institutions (North, 1990) in the context of organized crime and violence in Mexico....... in Mexico and to explore entrepreneurs’ reaction to the covered news. We also analyze journalists’ treatment of this news (Semetko & Valkendurg, 2000) and differences among newspapers from the U.S., Mexico and the European Union (EU). A sample of 200 news histories was constructed by integrating...

  11. The News Media as a Political Institution

    DEFF Research Database (Denmark)

    Ørsten, Mark; Allern, Sigurd


    On the basis of Scandinavian journalism research this article discusses the changing political roles of news organizations and journalists after the fall of the party press and the dissolution of broadcasting as a state-controlled monopoly. Given these institutional changes, we ask the following:...

  12. How to work through the news media

    International Nuclear Information System (INIS)

    There are essentially four steps that anyone must follow if the objective is to communicate a message through the news media: 1) Understand media (adversarial relationship, code of ethics, importance of First Amendment); 2) Redefine the relationship (become acquainted with reporter, save steps for the reporter); 3) Communicate clearly; and 4) Use alternatives when appropriate. These four steps are discussed

  13. The Spatiotemporal Dynamics of Digital News Audiences

    DEFF Research Database (Denmark)

    Peters, Chris


    these interrelated changes in the media ecology if we want to grasp the newfound complexity of media consumption. Specifically, it outlines how audience engagement with news and different spatiotemporal configurations made possible by digital technology are trends that complement and reinforce one...

  14. Analysis of textual Cohesion in News Report

    Institute of Scientific and Technical Information of China (English)



    Cohesion embodies the non-structural resources in English discourse and indicates the latent continuity existing in the text.On the basis of cohesion theory,this paper analyzes textual cohesion of the selected news reports form BBC website,in order to explore the way of structuring the text and realizing the meaning of the text.

  15. Soviet Cybernetics: Recent News Items, Number Thirteen. (United States)

    Holland, Wade B.

    An issue of "Soviet Cybernetics: Recent News Items" consists of English translations of the leading recent Soviet contributions to the study of cybernetics. Articles deal with cybernetics in the 21st Century; the Soviet State Committee on Science and Technology; economic reforms in Rudnev's ministry; an interview with Rudnev; Dnepr-2; Dnepr-2…

  16. System for Information Extraction from News Sites


    Stefanov, Tihomir


    The present paper deals with a system for crawling and content extraction from news sites. The system of web crawlers extracts textual and graphic information and checks for multimedia content availability. A part of the programming code and the database have been presented.

  17. Spaces and Places of News Consumption

    DEFF Research Database (Denmark)

    Peters, Chris


    the news. This chapter outlines the importance of space and place when it comes to audiences/users of journalism and the gradual recognition of this in digital journalism studies, with an eye to highlighting pertinent research trajectories. It first explores how the everyday digital geographies of...

  18. The Best of Chem 13 News (United States)

    Thorsen, Kathy


    This column is designed to give JCE readers a few highlights from Chem 13 News, a monthly publication for chemistry educators from the University of Waterloo in Ontario, Canada, and provides annotations describing a particular activity or a variety of sources from which new and creative ideas can be extracted.

  19. Publicity, news content, and cultural debate

    DEFF Research Database (Denmark)

    Nørgaard Kristensen, Nete; From, Unni


    Forever (1995) and Sex and the City (2008). The article argues that blockbusters are not only predestined media coverage due to increasingly professional com-munication strategies. Blockbusters also carry both ‘publicist’ and media commercial news value – for many of the same reasons: These movies may...

  20. Implication for Media Convergence on News Learning (United States)

    Gumus, Agah; Ozad, Bahire


    Over the last decade, comparisons of the effects of the traditional news media and the Internet have been made in relation to comprehension and remembering. This study aims at assessing the effects of single and compound presentational elements, and making predictions for the future. One of the two main aims of this study is to measure…

  1. Marine environment news. Vol. 2, no. 2

    International Nuclear Information System (INIS)

    This issue of the Newsletter carries articles on Tracers to reveal Global Role of Southern Oceans in Climate Change, a Technical Cooperation project on contamination in Mediterranean Sea and an article Marine Environment Laboratory (MEL) and Harmful Algal Blooms: nuclear methods serving seafood toxicity management. News items on training, personnel and intercomparison exercise are also covered

  2. News from the biological stain commission

    DEFF Research Database (Denmark)

    Kiernan, J.A.; Lyon, Hans Oluf


    In the three earlier editions of News from the Biological Stain Commission (BSC), under the heading of "Regulatory affairs," the BSC's International Affairs Committee reported on the work of Technical Committee 212, Clinical Laboratory Testing and in Vitro Diagnostic Test Systems of the...

  3. News from the Biological Stain Commission

    DEFF Research Database (Denmark)

    Lyon, H O; Kiernan, J A


    In the three earlier editions of News from the Biological Stain Commission (BSC), under the heading of "Regulatory affairs," the BSC's International Affairs Committee reported on the work of Technical Committee 212, Clinical Laboratory Testing and in Vitro Diagnostic Test Systems of the...

  4. Exploring the Interactions of Storylines from Informative News Events

    Institute of Scientific and Technical Information of China (English)

    胡珀; 黄民烈; 朱小燕


    Today’s news readers can be easily overwhelmed by the numerous news articles online. To cope with information overload, online news media publishes timelines for continuously developing news topics. However, the timeline summary does not show the relationship of storylines, and is not intuitive for readers to comprehend the development of a complex news topic. In this paper, we study a novel problem of exploring the interactions of storylines in a news topic. An interaction of two storylines is signified by informative news events that play a key role in both storylines. Storyline interactions can indicate key phases of a news topic, and reveal the latent connections among various aspects of the story. We address the coherence between news articles which is not considered in traditional similarity-based methods, and discover salient storyline interactions to form a clear, global picture of the news topic. User preference can be naturally integrated into our method to generate query-specific results. Comprehensive experiments on ten news topics show the effectiveness of our method over alternative approaches.

  5. Cohesiveness in financial news and its relation to market volatility. (United States)

    Piškorec, Matija; Antulov-Fantulin, Nino; Novak, Petra Kralj; Mozetič, Igor; Grčar, Miha; Vodenska, Irena; Smuc, Tomislav


    Motivated by recent financial crises, significant research efforts have been put into studying contagion effects and herding behaviour in financial markets. Much less has been said regarding the influence of financial news on financial markets. We propose a novel measure of collective behaviour based on financial news on the Web, the News Cohesiveness Index (NCI), and we demonstrate that the index can be used as a financial market volatility indicator. We evaluate the NCI using financial documents from large Web news sources on a daily basis from October 2011 to July 2013 and analyse the interplay between financial markets and finance-related news. We hypothesise that strong cohesion in financial news reflects movements in the financial markets. Our results indicate that cohesiveness in financial news is highly correlated with and driven by volatility in financial markets. PMID:24849598

  6. News regarding Mobility at CERN

    CERN Multimedia


    CERN Bikes CERN owns a fleet of more than 500 bikes, managed by the Mobility Centre (bdg. 6167). Members of CERN personnel (MPE and MPA) can use these free of charge during work-related activities at CERN (a security deposit is requested). Between 1st of June to 30th September anyone, except Summer Students, who wish to benefit from this service shall pay 1 CHF per day. As from the 1st of August, the CERN bike rental requests are done via the Service Now (SNOW) Portal. For more information, please consult:   CERN Cars More than 60 vehicles are available for rent by members of personnel (MPE and MPA) at the Mobility Center (bdg. 6167). As from the 5th of September you can submit reservation requests via the new EDH Car Rental Request document. As a reminder, the Terms of Use are the following: Operational Circular n° 4 (rev.1), governing the use of CERN vehicles;   Any use of the service must be authorised by the concerned Head of Department or Team Leader...

  7. Content-Based Hierarchical Analysis of News Video Using Audio and Visual Information

    Institute of Scientific and Technical Information of China (English)


    A schema for content-based analysis of broadcast news video is presented. First, we separate commercials from news using audiovisual features. Then, we automatically organize news programs into a content hierarchy at various levels of abstraction via effective integration of video, audio, and text data available from the news programs. Based on these news video structure and content analysis technologies, a TV news video Library is generated, from which users can retrieve definite news story according to their demands.

  8. Adaptation Strategies of Translating English News Lead——From the Perspective of Discourse Differences

    Institute of Scientific and Technical Information of China (English)



    Despite the common ground of outlining the news story and attracting reader's attention,the English News lead differs largely from the Chinese counterpart in terms of the news structures and news elements.Based on Eugene Nida's Functional Equivalence Theory and the analysis of the discourse differences between English and Chinese,three corresponding adaptation strategies of news translation can be summarized--omitting news elements,restructuring news information,and rearranging the attributions.

  9. Nuclear news of the world

    International Nuclear Information System (INIS)

    was inaugurated in Zhuhai (China). (A.C.)

  10. Warning: safety risk with some Apple AC Wall Plug Adapters

    CERN Multimedia

    CERN IT department


    Dear Mac and iOS Users, Apple has determined that some of its two prong Apple AC wall plug adapters may break and create a risk of electrical shock.   CERN users can now exchange their affected Apple wall plug adapters at the Service Desk. To find out if your adapter is affected and for any further information concerning the procedure to follow to exchange it, please check the following URL:

  11. AcEST: DK955197 [AcEST

    Lifescience Database Archive (English)


  12. AcEST: BP915640 [AcEST

    Lifescience Database Archive (English)


  13. How to take advantage of tablets: effects of news structure on recall and comprehension

    NARCIS (Netherlands)

    A. van Cauwenberge; L. d'Haenens; H. Beentjes


    In light of the growing use of tablets for news reading and mobile news consumption behaviors, this study examined whether an innovative way of structuring news on the tablet that mimics mobile news behaviors reinforced attention for, and learning from, news. Specifically, it was theorized that the

  14. La crisis nuclear de Corea del Norte: Sky News o Fox News

    Directory of Open Access Journals (Sweden)

    Pablo Rodríguez


    Full Text Available En este artículo analizamos, desde la teoría del framing, la información ofre - cida por los dos canales de noticias 24 horas del grupo News Corporation, Sky News y Fox News, con relación a la crisis nuclear de Corea del Norte en el periodo 9 -23 de abril de 2013. Nos centramos en aspectos como la “foxificación”, la presencia de expertos militares en los bloques de noti - cias y los encuadres informativos. En el caso de Sky News, la información se ofrece desde el prisma de los sucesos a nivel nacional debido al tiempo dedicado a la polémica con el documental del programa “Panorama” de la BBC. El tratamiento de la crisis nuclear en Fox News se traduce en constantes críticas a las políticas militares llevadas a cabo por Corea, la exalta - ción patriótica de los Estados Unidos poniendo el acento sobre el sistema defensivo y todo ello rodeado de una crítica feroz a la Administración Oba - ma por no promover una intervención militar en el conflicto.

  15. Recommendations for how to communicate bad news

    Directory of Open Access Journals (Sweden)

    Beatriz Villa López


    Full Text Available The communication, along with the control of the symptoms and the emotional support are the basic instruments that are used in the daily development of our profession. To be little capable at the time of notifying bad news can generate an added suffering unnecessary in the person who receives the new and a deterioration in the relation professional-patient.In many occasions, at the time of approaching these situations, the professional of the health usually feels anguish, fear and restlessness, this is because during is scared and restlessness this happens because during his stage of studies in the faculty the student has received a formation based on the binomial health-disease from a totally biological perspective forgetting the abilities communication.Supported in different bibliographical sources, this article tries to analyze the factors that influence when communicating the bad news and, to suggest some preventatives ideas on how giving them trying to prevent the burnout syndrome.

  16. ASTONISHING IMAGES: TV news and accountability processes

    Directory of Open Access Journals (Sweden)

    Braulio B. Neves


    Full Text Available Several scholars acknowledge the important role that journalism
    has in promoting accountability. Precisely how television news
    images contribute to triggering accountability dynamics, however, remains virtually unexplored. With this in mind, this study aims at a theoretical specification regarding the potential of video images to provoke public debates supporting accountability. Taking into consideration a case of extreme police violence - “Favela Naval Event”, which occurred in Diadema, São Paulo, Brazil - the authors analyze how TV news constructs the denunciation of police brutality and shapes controversies regarding attribution of responsibilities. Several dimensions of accountability are addressed in a range of competitive contexts that underscore the debate concerning the
    meaning of such scandalous images. This study challenges the
    common sense view that images degenerate the public sphere.

  17. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar


    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  18. Arctic Warming as News - Perils and Possibilities (United States)

    Revkin, A. C.


    A science journalist in his 30th year covering human-driven climate change, including on three Arctic reporting trips, reflects on successes and setbacks as news media, environmentalists and Arctic communities have tried to convey the significance of polar change to a public for which the ends of the Earth will always largely be a place of the imagination.Novel challenges are arising in the 24/7 online media environment, as when a paper by a veteran climate scientist proposing a mechanism for abrupt sea-level rise became a big news story before it was accepted by the open-review journal to which it had been submitted. New science is digging in on possible connections between changing Arctic sea ice and snow conditions and disruptive winter weather in more temperate northern latitudes, offering a potential link between this distant region and the lives of ordinary citizens. As cutting-edge research, such work gets substantial media attention. But, as with all new areas of inquiry, uncertainty dominates - creating the potential for distracting the public and policymakers from the many aspects of anthropogenic climate change that are firmly established - but, in a way, boring because of that.With the challenges, there are unprecedented opportunities for conveying Arctic science. In some cases, researchers on expeditions are partnering with media, offering both scientists and news outlets fresh ways to convey the story of Arctic change in an era of resource constraints.Innovative uses of crittercams, webcams, and satellite observations offer educators and interested citizens a way to track and appreciate Arctic change. But more can be done to engage the public directly without the news media as an intermediary, particularly if polar scientists or their institutions test some of the established practices honed by more experienced communicators at NASA.

  19. Volume, Volatility and Public News Announcements


    Bollerslev, Tim; Li, Jia; Xue, Yuan


    We provide new empirical evidence for the way in which financial markets process information. Our results are based on high-frequency intraday data along with new econometric techniques for making inference on the relationship between trading intensity and spot volatility around public news announcements. Consistent with the predictions derived from a theoretical model in which investors agree to disagree, our estimates for the intraday volume-volatility elasticity around the most important n...

  20. Volume, Volatility and Public News Announcements

    DEFF Research Database (Denmark)

    Bollerslev, Tim; Li, Jia; Xue, Yuan

    We provide new empirical evidence for the way in which financial markets process information. Our results are based on high-frequency intraday data along with new econometric techniques for making inference on the relationship between trading intensity and spot volatility around public news annou...... measures of disagreements in beliefs, economic uncertainty, and textual-based sentiment, further highlighting the key role played by differences-of-opinion....

  1. Social News Sites as Democratic Media

    DEFF Research Database (Denmark)

    Szabo, András

    This thesis presents an empirical analysis and normative theoretical evaluation of Reddit, a social news website, focusing on its coverage of the 2012 US presidential election campaign. It explores the site's structural features and organization, and evaluates its coverage by standards derived from...... three different ideal concepts of democracy. In all three theoretical settings, the study finds Reddit's performance lacking, while also identifying praiseworthy aspects of the site's operation. The thesis concludes by putting the mostly disappointing results into broader historical and technological...

  2. Live Blogging Science News: The Rosetta Mission (United States)

    Clark, S.


    When one of the world's most popular online news websites decides to cover a space science event live, you know that something big is brewing. Stuart Clark reports on how live blogging can be used for science reporting and how an idea that was triggered by his observations during the Rosetta flyby of the asteroid Lutetia and the landing of the Curiosity rover on Mars led to him live blogging two of Rosetta's most memorable occasions for The Guardian newspaper.

  3. Ultrasonographie dentaire par techniques TR-NEWS

    Czech Academy of Sciences Publication Activity Database

    Dos Santos, S.; Převorovský, Zdeněk

    Lyon: IntellAgence Technologies, 2010, s. 1-4. ISBN 978-2-9521105-7-0. [10éme Congrés Francais d´Acoustique. Lyon (FR), 12.04.2010-16.04.2010] Institutional research plan: CEZ:AV0Z20760514 Keywords : ultrasonic time-reversal (TR) * nonlinear elastic wave spectroscopy (NEWS) * human tooth damage imaging Subject RIV: BI - Acoustics

  4. Consumer Confidence, News and Consumption Stimulation


    Guo, Xinqiang; Xu, Zhiwei


    In the Chinese urban data, there is a stronger relationship between consumer behavior (measured by consumption income ratio or cy ratio) and consumer confidence (measured by Consumer Confidence Index or CCI), which implies expectation about the future plays an important role in domestic demand. In our paper, a structural VAR method (based on Beaudry&Portier 2006 AER) is employed to identify the news shock about three markets including housing, education and medical care. We also extract the c...

  5. Stock Prices, News, and Economic Fluctuations: Comment


    André Kurmann; Elmar Mertens


    Beaudry and Portier (American Economoc Review, 2006) propose an identification scheme to study the effects of news shocks about future productivity in Vector Error Correction Models (VECM). This comment shows that their methodology does not have a unique solution, when applied to their VECMs with more than two variables. The problem arises from the interplay of cointegration assumptions and long-run restrictions imposed by Beaudry and Portier (2006).

  6. ASTONISHING IMAGES: TV news and accountability processes


    Braulio B. Neves; Rousiley C. M. Maia


    Several scholars acknowledge the important role that journalism
    has in promoting accountability. Precisely how television news
    images contribute to triggering accountability dynamics, however, remains virtually unexplored. With this in mind, this study aims at a theoretical specification regarding the potential of video images to provoke public debates supporting accountability. Taking into consideration a case of extreme police violence - “Favela Naval Event&a...

  7. Bad news: delivery, dialogue, and dilemmas. (United States)

    Quill, T E; Townsend, P


    The narrative from a real patient encounter is used to illustrate the powerful effect that delivering bad news can have on both patient and physician. The meaning of bad news to the patient may be quite different than the medical or the personal meaning to the physician. Differences in perception must be explored and understood before the common ground necessary for joint decision making is established. Initial patient responses can be divided into three categories: (1) basic psychophysiologic (fight-flight or conservation-withdrawal), (2) cognitive, and (3) affective. Responses vary considerably depending on the meaning of the diagnosis to the patient, the degree of immediate threat, and the patient's previous experience with illness. Desired outcomes of the initial meeting include (1) minimizing aloneness and isolation for both patient and physician; (2) achieving a common perception of the problem; (3) giving information tailored to the immediate needs of the patient; (4) addressing immediate medical needs, including the risk of suicide; (5) responding to immediate discomforts; and (6) ensuring a basic plan for follow-up. Though all clinicians deliver bad news, few have had formal training or open exploration of the profound potential impact of the experience. PMID:2001128

  8. Substance Abuse and Mental Health Services Administration. March/April 2008 (United States)

    Goodman, Deborah, Ed.


    "SAMHSA News" is the national newsletter of the Substance Abuse and Mental Health Services Administration. Published six times a year (bimonthly) by SAMHSA's Office of Communications, SAMHSA News contains information about the latest substance abuse and mental health treatment and prevention practices, recent statistics on mental health and…

  9. Audiovisual Webjournalism: An analysis of news on UOL News and on TV UERJ Online

    Directory of Open Access Journals (Sweden)

    Leila Nogueira


    Full Text Available This work shows the development of audiovisual webjournalism on the Brazilian Internet. This paper, based on the analysis of UOL News on UOL TV – pioneer format on commercial web television - and of UERJ Online TV – first on-line university television in Brazil - investigates the changes in the gathering, production and dissemination processes of audiovisual news when it starts to be transmitted through the web. Reflections of authors such as Herreros (2003, Manovich (2001 and Gosciola (2003 are used to discuss the construction of audiovisual narrative on the web. To comprehend the current changes in today’s webjournalism, we draw on the concepts developed by Fidler (1997; Bolter and Grusin (1998; Machado (2000; Mattos (2002 and Palacios (2003. We may conclude that the organization of narrative elements in cyberspace makes for the efficiency of journalistic messages, while establishing the basis of a particular language for audiovisual news on the Internet.

  10. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O


    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  11. Latest news from the Tiles

    CERN Multimedia

    Costanzo, D

    The Tile hadronic calorimeter will be installed in the central region of ATLAS with an inner radius of 2.28 m, an outer radius of 4.25 m, a total length of about 12 m and a weight of about 2300 tons. The calorimeter is mechanically divided in one central barrel and two extended barrels, with a gap in between for the services of the internal part of ATLAS. The construction of the calorimeter is advanced, and installation in the ATLAS pit is foreseen to start in December 2003. After mechanical assembly the modules are instrumented with all the optical components. Scintillating tiles are inserted into the slots, and the read-out Wave Length Shifting fibers are coupled to scintillators and bundled to achieve the quasi-projective cell geometry of the calorimeter. The final modules are stored in bldg 185, shown in the first photo, and in bldg 175 at CERN. The barrel modules are mechanically assembled in Dubna and then transported to CERN to be optically instrumented, while the extended barrels are constructed in t...

  12. AcEST: BP920800 [AcEST

    Lifescience Database Archive (English)


  13. AcEST: DK945549 [AcEST

    Lifescience Database Archive (English)


  14. AcEST: BP917632 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000103_D10 554 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D10. BP917632 - Show ... YSKCKIHQKALELLVLML 154 Query: 466 KDSLEPDEVTYLNVLKACARE EDLKV 543 +D++ P+ TY +VL++C D+++ Sbjct: 155 RDNVRPN ... 185 Query: 415 GHSDSS--KEALKLLTQMRKDSLEPDEVTYLNVLKACARE EDLK 540 + EA KL +M+ ++ PDE+ N++ AC R +++ Sbjct: 18 ...

  15. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  16. AcEST: DK946687 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0013_G11 544 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_G11. 5' end seq ... + G P+ TY+ + AC+ E Sbjct: 97 YSFNYMIRGLTNTWN-------DHEA ---ALSLYRRMKFSGLKPDKFTYNFVFIACAKLE 146 Query: 214 A ... Sbjct: 71 LIPKAVELGDFNYSSFLFSVTEEPNHYSFNYMIRGLTNTWNDHEA ALSLYRRMKFSGLKP 130 Query: 469 DGATFSCVLRACGNVGALDV ...

  17. AcEST: DK949372 [AcEST

    Lifescience Database Archive (English)


  18. News and financial intermediation in aggregate and sectoral fluctuations


    Görtz, Christoph; Tsoukalas, John


    We estimate a two-sector DSGE model with financial intermediaries—a-la Gertler and Karadi (2011) and Gertler and Kiyotaki (2010)—and quantify the importance of news shocks in accounting for aggregate and sectoral fluctuations. Our results indicate a significant role of financial market news as a predictive force behind fluctuations. Specifically, news about the value of assets held by financial intermediaries, reflected one to two years in advance in corporate bond markets, generate countercy...

  19. News Shocks and Labor Market Dynamics in Matching Models


    Francesco Zanetti; Konstantinos Theodoridis


    We enrich a baseline RBC model with search and matching frictions on the labor market and real frictions that are helpful in accounting for the response of macroeconomic aggregates to shocks. The analysis allows shocks to have an unanticipated and a news (i.e. anticipated) component. The Bayesian estimation of the model reveals that the model which includes news shocks on macroeconomic aggregates produces a remarkable fit of the data. News shocks in stationary and non-stationary TFP, investme...

  20. Entity-Specific Sentiment Classification of Yahoo News Comments


    Biyani, Prakhar; Caragea, Cornelia; Bhamidipati, Narayan


    Sentiment classification is widely used for product reviews and in online social media such as forums, Twitter, and blogs. However, the problem of classifying the sentiment of user comments on news sites has not been addressed yet. News sites cover a wide range of domains including politics, sports, technology, and entertainment, in contrast to other online social sites such as forums and review sites, which are specific to a particular domain. A user associated with a news site is likely to ...

  1. Trade Deficit News, Systematic Risk and the Crash of 1987


    Willem Thorbecke


    News of enormous trade deficits began affecting asset prices in the mid-1980s. Some have suggested that trade deficit news contributed to the October 1987 stock market crash. This argument would be more compelling if the trade deficit were a source of systematic risk to asset prices, since then trade deficit news could have contributed to the increased perception of the riskiness of holding equities that occurred just before the crash. Here the Arbitrage Pricing Theory is used to demonstrate ...

  2. "Be prepared for bad news": Framing Terrorism in Norwegian News Media


    Rabe, Ingvild Knævelsrud


    Title: Be prepared for bad news : Framing Terrorism in Norwegian News Media Author: Ingvild Knævelsrud Rabe Supervisor: Sveinung Sandberg Place: Department of Criminology and the Sociology of Law: Faculty of Law, University of Oslo Submission date: 08.05.2015 How are acts of terrorism framed in Norwegian newspapers? This thesis seeks to answer this question in a comparative case study on the coverage of two terrorist attacks that took place in 2013. The case study is based on 1121 newspaper ...

  3. Radio News Source Preference by Residents of UYO Urban, Nigeria




    Exposure to broadcast news by audience members is part of human information processing.  Radio is believed to be a major source of news on many local and national issues for many people in many countries. But it was uncertain whether the assumption was tenable in Nigeria. Selectivity plays significant role in audience members’ exposure to broadcast news.  The study set out to investigate which radio station(s) residents of Uyo residents tune to for news on important local and national issues....

  4. An analysis of news flow on the nation's nurse shortage. (United States)

    Kalisch, B J; Kalisch, P A; Clinton, J


    Using data from national newspaper clipping services, this article analyzes characteristics of 1978 news coverage of the nation's nurse shortage. Based on a content analysis of nearly 3,000 newspaper articles, findings revealed that 14 per cent of the articles mentioned problems of nurse supply. Articles on nurse shortage were most frequent in the Pacific, Mid-Atlantic and South-Atlantic states and occurred least in the West-North Central and East-South Central states. Articles mentioning nurse shortage were more frequently placed on page 1, associated with clinical nursing in hospital settings and explained as the result of maldistribution of nurses, poor salaries, deficient working conditions and lack of job satisfaction. The reading public was confronted with three major consequences of current and continued shortages in nursing: 1) decline in the availability and diversity of health services; 2) erosion in the quality of care offered the public and jeopardized patient welfare; and 3) escalating health care costs. Solutions to the nurse shortage appear to be closely tied to further expansion of the issue among the public, the initiation of remedial governmental action and timely relocation of scarce resources within the health care industry. PMID:7289679

  5. Energy saving in ac generators (United States)

    Nola, F. J.


    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  6. Apuntes de Acústica


    Martín Domingo, Agustín


    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  7. SSTI Clark ACS Technology Demonstrations


    Freesland, Douglas


    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  8. "Chemistry Is in the News": Taxonomy of Authentic News Media-Based Learning Activities. Research Report (United States)

    Glaser, Rainer E.; Carson, Kathleen M.


    A brief history is given of approaches that aim at achieving a connectedness of the content of organic chemistry courses to real world issues. Recently, such approaches have relied more and more on online media resources, the tools of the Internet and the World Wide Web. We propose a six-level taxonomy of 'authentic news media-based learning…

  9. AcEST: DK950895 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |A7SFA3|A7SFA3_NEMVE Predicted protein OS=Nematostella vectens... 210 5e-53 tr|Q0CVA9|Q0CVA9_ASPTN ATP-citrate synthase subunit...stX Result : Swiss-Prot sp_hit_id Q54YA0 Definition sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos...PIDYSWAQELGLIRKPAAFISTI 404 >sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora cras...IRKPASFMTSI 844 >sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe G....done Score E Sequences producing significant alignments: (bits) Value sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos

  10. AcEST: BP914304 [AcEST

    Lifescience Database Archive (English)


  11. AcEST: BP911793 [AcEST

    Lifescience Database Archive (English)


  12. AcEST: BP921649 [AcEST

    Lifescience Database Archive (English)


  13. AcEST: BP919669 [AcEST

    Lifescience Database Archive (English)


  14. AcEST: DK957916 [AcEST

    Lifescience Database Archive (English)


  15. AcEST: DK956923 [AcEST

    Lifescience Database Archive (English)


  16. AcEST: BP921492 [AcEST

    Lifescience Database Archive (English)


  17. Benchmarking News Recommendations in a Living Lab


    Hopfgartner, Frank; Kille, Benjamin; Lommatzsch, Andreas; Plumbaum, Till; Brodt, Torben; Heintz, Tobias


    Most user-centric studies of information access systems in literature suffer from unrealistic settings or limited numbers of users who participate in the study. In order to address this issue, the idea of a living lab has been promoted. Living labs allow us to evaluate research hypotheses using a large number of users who satisfy their information need in a real context. In this paper, we introduce a living lab on news recommendation in real time. The living lab has first been organized as Ne...

  18. Social Media as a News Platform


    Liu, Guanjun


    Since the birth of social media, we’ve seen a dramatic transformation of how news is produced and consumed and how we interact with it. The main drivers are the rapid development of technology and a boom in the number of social media users. For example the Pope interacts with his followers on Twitter; the newly elected Iranian president, Hassan Rouhani, opened his Facebook profile to the public, and 2013 Russian meteor explosion went viral on YouTube with millions of hits. Thus it is conceiva...

  19. Miscellaneous South East Asian cucurbit news


    W.J.J.O. - De Wilde; Duyfjes, Brigitta E.E.


    DE WILDE, W.J.J.O. & DUYFES, B.E.E. 2008. Miscellaneous South East Asian cucurbit news. Reinwardtia 12(4):267 – 274. –– This paper contains corrections, additions, and name changes in several genera, which became apparentsince previous publications by the authors in these genera.(1) Baijiania A.M. Lu & J.Q. Li: a range-extension(2) Benincasa Savi: a name change(3) Diplocyclos (Endl.) T. Post & Kuntze: lectotypification of the synonym Ilocania pedata Merr.(4) Gymnopetalum Arn.: a n...

  20. Displaying fairness while delivering bad news: Testing the effectiveness of organizational bad news training in the layoff context. (United States)

    Richter, Manuela; König, Cornelius J; Koppermann, Christopher; Schilling, Michael


    Although giving bad news at work is a stressful experience, managers are often underprepared for this challenging task. As a solution, we introduce organizational bad news training that integrates (a) principles of delivering bad news from the context of health care (i.e., bad news delivery component), and (b) principles of organizational justice theory (i.e., fairness component). We argue that both the formal and fair delivery of bad news at work can be enhanced with the help of training to mitigate distress both for the messenger and the recipient. We tested the effectiveness of training for the delivery of a layoff as a typical bad news event at work. In 2 studies, we compared the performance of a training group (receiving both components of training) with that of a control group (Study 1, Study 2) and a basics group (receiving the bad news delivery component only; Study 2) during a simulated dismissal notification meeting. In general, the results supported our hypotheses: Training improved the formal delivery of bad news and predicted indicators of procedural fairness during the conversation in both studies. In Study 2, we also considered layoff victims' negativity after the layoff and found that training significantly reduced negative responses. This relationship was fully mediated by layoff victims' fairness perceptions. Despite preparation, however, giving bad news remained a challenging task in both studies. In summary, we recommend that organizations provide managers with organizational bad news training in order to promote professional and fair bad news conversations at work. (PsycINFO Database Record PMID:26882444

  1. A Functional Conceptualization of Understanding Science in the News (United States)

    Anderson, Megan M.


    The idea that the public should have the capacity for understanding science in the news has been embraced by scientists, educators, and policymakers alike. An oft-cited goal of contemporary science education, in fact, is to enhance students' understanding of science in the news. But what exactly does it "mean" to understand science…

  2. Children's Expectations for Television Entertainment vs. Television News Events. (United States)

    Reitzes, Katherine A.; White, Mary Alice


    Found that sixth- and eighth-grade children (1) predicted a greater proportion of positive outcomes for television entertainment events than for television news events and (2) rated news events as more likely to happen in everyday life than entertainment events. Concluded that children can discriminate between the two facets of television reality.…

  3. Teaching the Scientific Method Using Current News Articles (United States)

    Palmer, Laura K.; Mahan, Carolyn G.


    We describe a short (less than 50 minutes) activity using news articles from sources such as "Science Daily" to teach students the steps of the scientific method and the difference between primary and secondary literature sources. The flexibility in choosing news articles to examine allowed us to tailor the activity to the specific interests of…

  4. The Effects of Market Structure on Television News Pricing. (United States)

    Wirth, Michael O.; Wollert, James A.

    Multiple regression techniques were used to examine the business side of local television news operations for November 1978. Research questions examined the effect of several variables on local television news prices (advertising rates), including type of ownership, network affiliation/signal type, market size, cable network penetration, market…

  5. A Multi-Dimensional Approach to Measuring News Media Literacy (United States)

    Vraga, Emily; Tully, Melissa; Kotcher, John E.; Smithson, Anne-Bennett; Broeckelman-Post, Melissa


    Measuring news media literacy is important in order for it to thrive in a variety of educational and civic contexts. This research builds on existing measures of news media literacy and two new scales are presented that measure self-perceived media literacy (SPML) and perceptions of the value of media literacy (VML). Research with a larger sample…

  6. Rereading Bad News: Compliance-Gaining Features in Management Memos. (United States)

    David, Carol; Baker, Margaret Ann


    Shows how compliance-gaining theory (more accurately than the "bad news formula") can help to explain the content and style of two kinds of memos that deliver bad news from managers to subordinates. Finds that features of compliance gaining governing message production explicate the power base, verbal strategies and tactics, and negotiating…

  7. Automated Detection of Financial Events in News Text

    NARCIS (Netherlands)

    F.P. Hogenboom (Frederik)


    markdownabstractToday’s financial markets are inextricably linked with financial events like acquisitions, profit announcements, or product launches. Information extracted from news messages that report on such events could hence be beneficial for financial decision making. The ubiquity of news, how

  8. Determining Citizens’ Opinions About Stories in the News Media

    Directory of Open Access Journals (Sweden)

    Timo Wandhöfer


    Full Text Available We describe a method whereby a governmental policy maker can discover citizens’ reaction to news stories. This is particularly relevant in the political world, where governments’ policy statements are reported by the news media and discussed by citizens. The work here addresses two main questions: whereabouts are citizens discussing a news story, and what are they saying? Our strategy to answer the first question is to find news articles pertaining to the policy statements, then perform internet searches for references to the news articles’ headlines and URLs. We have created a software tool that schedules repeating Google searches for the news articles and collects the results in a database, enabling the user to aggregate and analyse them to produce ranked tables of sites that reference the news articles. Using data mining techniques we can analyse data so that resultant ranking reflects an overall aggregate score, taking into account multiple datasets, and this shows the most relevant places on the internet where the story is discussed. To answer the second question, we introduce the WeGov toolbox as a tool for analysing citizens’ comments and behaviour pertaining to news stories.  We first use the tool for identifying social network discussions, using different strategies for Facebook and Twitter. We apply different analysis components to analyse the data to distil the essence of the social network users’ comments, to determine influential users and identify important comments.

  9. Positive Organizational Behavior: A Buffer for Bad News (United States)

    French, Sandra L.; Holden, Tracey Quigley


    Most communication research on bad news messages focuses on crisis communication, where attention is often limited to image repair strategies. The authors argue that a key indicator of an organization's effectiveness in communicating "bad news" messages is its organizational culture. Developing an organizational culture that values positive…

  10. Loops of Spoken Language i Danish Broadcasting Corporation News

    DEFF Research Database (Denmark)

    le Fevre Jakobsen, Bjarne


    The tempo of Danish television news broadcasts has changed markedly over the past 40 years, while the language has essentially always been conservative, and remains so today. The development in the tempo of the broadcasts has gone through a number of phases from a newsreader in a rigid structure...... tempo of programmes, and we will anchor television news in a wider context....

  11. The quality of political news in a changing media environment

    NARCIS (Netherlands)

    C.A. Jacobi


    What do ongoing changes in the media environment, notably the perceived popularization of news and the shift towards individualized online media, mean for political news quality, both in terms of what it is, as well as how we measure it? This dissertation firstly argues, based on a literature review

  12. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)


    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  13. Defragmenting the effect of major news announcements on financial markets

    Directory of Open Access Journals (Sweden)

    Ikhlaas Gurrib


    Full Text Available The issue of High Frequency Trading (HFT and its impact on financial markets is hitting the headlines hard nowadays. This paper looks at the effects of three major news announcements on two major currency pairs namely the Australian dollar against the US dollar and the Euro against the US dollar. The three major news announcements are the cash rate from the Reserve Bank of Australia, the minimum bid rate from European Central Bank (ECB and the official bank rate from the Bank of England.  A one minute data interval analysis is used over a time period of four years.  Findings suggest the effects of the specific news under analysis to be insignificant for a trader to benefit from the fluctuations in the two major currency markets. The use of other macroeconomic news or higher frequency data is warranted to defragment the effects of major news announcements further.

  14. Simultaneous distribution of AC and DC power (United States)

    Polese, Luigi Gentile


    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  15. Your Lung Operation: After Your Operation

    Medline Plus

    Full Text Available ... at ACS ACS and Veterans Diversity at ACS Benefits Current Openings Newsroom Newsroom Newsroom Press Releases Media Resources The FIRST Trial ACS Publications ACS in the News Stay Up to Date with ACS Association Management Services Jobs Events Find a Surgeon Patients and ...

  16. Radio News Source Preference by Residents of UYO Urban, Nigeria

    Directory of Open Access Journals (Sweden)



    Full Text Available Exposure to broadcast news by audience members is part of human information processing.  Radio is believed to be a major source of news on many local and national issues for many people in many countries. But it was uncertain whether the assumption was tenable in Nigeria. Selectivity plays significant role in audience members’ exposure to broadcast news.  The study set out to investigate which radio station(s residents of Uyo residents tune to for news on important local and national issues. It also studied what factors influence their choice of radio station for news on socio-political crises in Nigeria. The findings showed that majority of the respondents prefer foreign radio stations – Voice of America (VOA and British Broadcasting Corporation (BBC for news on socio-political crises in Nigeria. The survey also revealed that media credibility exerted great influence on audience exposure to broadcast news and choice of broadcast medium for news. It is the submission of this work that the continuous presentation of one-sided point of view, whether in government-controlled media or privately-owned ones not only makes the audience hold their news content suspect but also makes such mass medium to rank low in terms of perceived credibility. One of the implications of that situation is that mass mobilization through such media would be difficult to achieve.  Consequently, it is the submission of this research that if broadcast media in Nigeria are to be reckoned trustworthy and reliable, diverse and balanced views on all issues in the news should always be presented.

  17. Network television news coverage of environmental risks

    Energy Technology Data Exchange (ETDEWEB)

    Greenberg, M.R.; Sandman, P.M.; Sachsman, D.V.; Salomone, K.L.


    Despite the criticisms that surround television coverage of environmental risk, there have been relatively few attempts to measure what and whom television shows. Most research has focused analysis on a few weeks of coverage of major stories like the gas leak at Bhopal, the Three Mile Island nuclear accident, or the Mount St. Helen's eruption. To advance the research into television coverage of environmental risk, an analysis has been made of all environmental risk coverage by the network nightly news broadcasts for a period of more than two years. Researchers have analyzed all environmental risk coverage-564 stories in 26 months-presented on ABC, CBS, and NBC's evening news broadcasts from January 1984 through February 1986. The quantitative information from the 564 stories was balanced by a more qualitative analysis of the television coverage of two case studies-the dioxin contamination in Times Beach, Missouri, and the suspected methyl isocyanate emissions from the Union Carbide plant in Institute, West Virginia. Both qualitative and quantitative data contributed to the analysis of the role played by experts and environmental advocacy sources in coverage of environmental risk and to the suggestions for increasing that role.

  18. Network television news coverage of environmental risks

    International Nuclear Information System (INIS)

    Despite the criticisms that surround television coverage of environmental risk, there have been relatively few attempts to measure what and whom television shows. Most research has focused analysis on a few weeks of coverage of major stories like the gas leak at Bhopal, the Three Mile Island nuclear accident, or the Mount St. Helen's eruption. To advance the research into television coverage of environmental risk, an analysis has been made of all environmental risk coverage by the network nightly news broadcasts for a period of more than two years. Researchers have analyzed all environmental risk coverage-564 stories in 26 months-presented on ABC, CBS, and NBC's evening news broadcasts from January 1984 through February 1986. The quantitative information from the 564 stories was balanced by a more qualitative analysis of the television coverage of two case studies-the dioxin contamination in Times Beach, Missouri, and the suspected methyl isocyanate emissions from the Union Carbide plant in Institute, West Virginia. Both qualitative and quantitative data contributed to the analysis of the role played by experts and environmental advocacy sources in coverage of environmental risk and to the suggestions for increasing that role

  19. Australian news media framing of medical tourism in low- and middle-income countries: a content review


    Imison, Michelle; Schweinsberg, Stephen


    Background Medical tourism – travel across international borders for health care – appears to be growing globally, with patients from high-income nations increasingly visiting low- and middle-income countries to access such services. This paper analyses Australian television and newspaper news and current affairs coverage to examine how medical tourism and these destinations for the practice are represented to media audiences. Methods Electronic copies of Australian television (n = 66) and ne...

  20. Speaking of meta: Questioning the internet as homogeneous and global news medium


    Opgenhaffen, Michaël


    In 1996, Morris and Ogan wrote ‘the Internet as mass medium’, on of the most important articles in the early stages of the Internet. This paper proposed a conceptualisation of the internet as a mass medium that is comprised of multiple sites and services which are the components of the medium. This way of viewing the internet as a multifaceted mass medium helps us to study the consumption and effects of the online media. Especially with regard to online news, this meta-approach is important. ...

  1. Taking Science to the Marketplace: Examples of Science Service's Presentation of Chemistry during the 1930s


    Marcel C. LaFollette


    During the 1930s, Science Service, a not-for-profit independent news organization, promulgated an approach to popularizing science which favored audience preferences over scientific agendas and attended to industry as well as academic research interests. Stories about chemistry and chemists harmonized well with Science Service's emphasis on research utility and relevance. This article describes examples from syndicated news reports, radio broadcasts, a newspaper series called 'Fabrics of the ...

  2. Understanding the role of the news media in HPV vaccine uptake in the United States: Synthesis and commentary. (United States)

    Gollust, Sarah E; LoRusso, Susan M; Nagler, Rebekah H; Fowler, Erika Franklin


    Vaccination rates for the human papillomavirus (HPV) vaccine fall below targets and only 2 states and the District of Columbia require the vaccine for middle school-age children. Messages conveyed through news media-to parents, providers, policymakers, and the general public-may contribute to sluggish vaccination rates and policy action. In this commentary, we review the findings from 13 published studies of news media coverage of the HPV vaccine in the United States since FDA licensure in 2006. We find 2 important themes in news coverage: a rising focus on political controversy and a consistent emphasis on the vaccine as for girls, even beyond the point when the vaccine was recommended for boys. These political and gendered messages have consequences for public understanding of the vaccine. Future research should continue to monitor news media depictions of the HPV vaccine to assess whether political controversy will remain a pronounced theme of coverage or whether the media ultimately depict the vaccine as a routine public health service. PMID:26554612

  3. AcEST: DK948526 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0003_I19 675 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_I19. 5' end seq ... IAMVRTTTPVYV 214 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 215 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 254 >sp|Q09138|AAKG1_PIG 5'-AMP-acti ... IAMVRTTTPVYV 215 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 216 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 255 >sp|O54950|AAKG1_MOUSE 5'-AMP-ac ...

  4. AcEST: DK962916 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0015_C06 596 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_C06. 5' end seq ... NA. clone: TST39A01NGRL0015_C06. 5' end sequence. Acce ssion DK962916 Tissue type prothallia with plantlet ... 2 Query: 317 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 335 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 326 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 454 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  5. AcEST: DK955705 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0023_N02 635 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_N02. 5' end seq ... NA. clone: TST39A01NGRL0023_N02. 5' end sequence. Acce ssion DK955705 Tissue type prothallia with plantlet ... 2 Query: 296 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 314 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 305 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 433 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  6. AcEST: DK961330 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FWVPCMHTPIKQEKHTHA 405 +AR P W +++PI+ ++C++ P + AK+ PL DVTH+F+V + +QE Sbjct: 61 VARRTRP-SWHEDNPINYVQCDISDPDD...+IL +D PGGPWKVYG Sbjct: 4 WWAGAIGAAKKKLEEDDAPPKHS---SVALIVGVTGIIGNSLAEILPLADTPGGP...AWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTCANR--STEPENCE 117 Query: 406 MATHMFENIIGVLLTHAPNLQHVCMQTSDKHY-... : Swiss-Prot sp_hit_id Q7MXT7 Definition sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac...lue sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-... 34 0.62 sp|P60369|KR103_HUMAN Kerati

  7. AcEST: BP913772 [AcEST

    Lifescience Database Archive (English)


  8. AcEST: DK952954 [AcEST

    Lifescience Database Archive (English)


  9. AcEST: BP912540 [AcEST

    Lifescience Database Archive (English)


  10. A Comparison of Career Attitudes of News-Editorial and Ad-PR Students. (United States)

    Smith, Ron F.


    Assesses the attitudes that news-editorial students have toward careers in public relations and advertising and the attitudes that public relations-advertising students have toward news careers. Finds that news-ed students saw careers in public relations as being less useful to society and having less prestige in the community than their careers.…

  11. Amateur Sources Breaking the News, Meta Sources Authorizing the News of Gaddafi's Death

    DEFF Research Database (Denmark)

    Mortensen, Mette; Kristensen, Nete Nørgaard


    the sources included by selected newspapers to report on this event, the current article investigates the following research questions: Which types of sources are brought into play in the news coverage of Gaddafi’s death, and which forms of interplay between sources in today’s globalized and......This article takes its point of departure in the thesis that today’s global, digitalized and conver- gent media environment has promoted new patterns of information gathering and dissemina- tion within journalism, and war journalism in particular, which involve changing forms and various degrees of...... interplay between elite and non-elite sources as well as media professionals and amateur sources. On account of their proximity to unfolding events, amateur sources often break the news by means of raw and fragmented bits of visual and verbal information. Elite sources rarely possess the same exclusive...

  12. Using Multimedia to Bring Science News to the Public (United States)

    O'Riordan, C.; Stein, B.; Lorditch, E. M.


    Creative partnerships between scientists and journalists open new opportunities to bring the excitement of scientific discoveries to wider audiences. Research tells us that the majority of the general public now gets more science and technology news from the Internet than from TV sources (2014 NSF Science and Engineering Indicators). In order to reach these audiences news organizations must embrace multiple forms of multimedia. We will review recent research on how the new multimedia landscape is changing the way that science news is consumed and how news organizations are changing the way they deliver news. News programs like Inside Science, and other examples of new partnerships that deliver research news to journalists, teachers, students, and the general public will be examined. We will describe examples of successful collaborations including an article by a former Newsweek science reporter entitled "My 1975 'Cooling World' Story Doesn't Make Today's Climate Scientists Wrong," which got reprinted in Slate, RealClearScience, and mentioned in and USA Today.

  13. The Impact of Power on Translation of News Stories

    Directory of Open Access Journals (Sweden)

    Javad Azodi


    Full Text Available Translation has always undergone the impact of various metalinguistic factors which impose their impact during the process of translation and rendering its final linguistic product. News stories or better to say political discourses are among those linguistic materials that more than other textual materials undergo the impact of factors such as ideology. Not being aware of such discursive practices leads the so-called translator to suffice to linguistic substitutions without observing imbedded intentions. For the purpose of this study through a qualitative type of research and based on critical discourse analysis (CDA approach for textual analysis and following Tymoczko’s concept of power (2002 in translation this study aimed to scrutinize the impact of power on Persian translations of different pieces of news stories in English in 2012. The corpus consists of some pieces of English news stories in worldwide news agencies (namely, Reuters, Washington Post, New York Post, and Forbes about Iran’s nuclear program. Results of the study showed that ideology is the very important stimulus which can control and direct the purpose of the news stories being translated from English to Persian and reveal its impact in a desired way as news stories for target audience.Keywords: Power, Translation, Political Discourse, News Translation

  14. From Adaptation to Appropriation: Framing the World Through News Translation

    Directory of Open Access Journals (Sweden)

    Valdeón Roberto A.


    Full Text Available Terminological issues are problematic in the analysis of translation processes in news production. In the 1980s, Stetting coined the term “transediting”, which has been widely used in the translation studies literature, but “translation” itself becomes contentious in communication studies, a discipline closely related to news translation research. Only a few communication scholars have specifically dealt with the linguistic and cultural transformations of source texts, but they tend to regard translation as word-for-word transfer, unusual news production. More productive for the study of news translation seems to be the application of the concept of framing, widely used in communication studies. Framing considers the linguistic and paralinguistic elements of news texts in the promotion of certain organizing ideas that the target audience can identify with. In news translation, this entails the adaptation of a text for the target readership, a process can lead to appropriation of source material. Two examples are mentioned to illustrate this point: the appropriation of the US Department of State cables by the Wikileak organisation, and the pro-Romanian slogans produced by the Gandul newspaper as a response to Britain’s anti-immigration campaigns. The final section relates news adaptation to adaptation of other text types, such as literary and historical works.

  15. Stealth Advertising: The Commercialization of Television News Broadcasts in Canada

    Directory of Open Access Journals (Sweden)

    Gennadiy Chernov


    Full Text Available This two-phase study deals with the phenomenon of “stealth advertising” in Canada. This concept refers to the encroachment of commercially tinted messages into broadcast news segments. Different theories of commercial speech were used as a theoretical framework. The study combined mixed methods, content analysis and in-depth interviews. The first phase concentrated on the frequency and actual time spent airing commercially influenced messages in television newscast segments. The sample consisted of eight randomly selected English-language markets across Canada including news stations affiliated with CBC, CTV and Global. Seventy-five newscasts were recorded and content-analyzed. The analysis demonstrated that private television stations used more explicit and aggressive stealth advertising than publicly owned ones. In subsequent interviews, the news directors and sales managers of some of these stations denied that they yield to outside commercial pressures but admitted they may include messages with commercial content if these have public interest value. In the second phase thirty-nine newscasts of a news station affiliated with Global were recorded and content-analyzed, showing high numbers of commercially influenced messages and corroborating previous research findings. Subsequent interviews showed some news decision-makers accept the inclusion of commercially tinted news segments, thus eroding the divide between editorial and commercial contents. This study is intended to contribute to the empirical basis for pursuing the question of corruption of news by surreptitious commercial content.

  16. News coverage of climate change in Nature News and ScienceNOW during 2007

    DEFF Research Database (Denmark)

    Nielsen, Kristian Hvidtfelt; Kjærgaard, Rikke Schmidt


    Climate change has become one of the most favored topics in mass media, political discourses, and scientific discussions during the past decade. By the end of 2007 the scientific journals Science and Nature both demonstrated the urgency of climate change by emphasizing the importance and necessity...... news sections run by scientific journals are very similar to mass media in framing their coverage of science to fit specific agendas....

  17. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques


    Rakan Kh Antar


       This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time fo...

  18. Approach for Developing Scientific News Aggregators Using ATOM Feeds

    Directory of Open Access Journals (Sweden)

    Farha Shaikh


    Full Text Available Scientists want to stay connected with everything that is new and innovative in the world, so they constantly read and analyze several online scientific resources such as magazines and journals. A user needs to do a lot of searching through on the web to locate the articles which are important to their interest. The idea of a news aggregator is not new to scientific world. A news aggregator is a software application, which periodically reads several sources and displays them on a separate page such as Google news. The information is stored in XML format. A scientific news aggregator helps in structuring online resources into useful contents. These contents are automatically fetched from several online resources available on the Internet and categorized on a separate page. Mostly, RSS feeds are used to done this job. Atom feeds are more detailed and having advance feature than RSS feeds, helps to improve the performance of scientific news aggregator by giving more updated information. A modern view of an aggregator offers a friendly user interface for users by merging the news content. We are working on an interesting approach for the design and implementation of news aggregators which will collect and aggregate data from the web to acquire unstructured information and transform it into data that could be understood and dynamically processed. The proposed approach will combine various mechanisms in order to connect to the data sources specified, identify the categories of articles, extract the corresponding pieces of news and automatically place them into the knowledge database and automatically extract the new pieces of information in the knowledge base and display them on the Science News section

  19. Language use depending on news frame and immigrant origin. (United States)

    Fernández, Itziar; Igartua, Juan-José; Moral, Félix; Palacios, Elena; Acosta, Tania; Muñoz, Dolores


    The purpose of this study was to analyze the effect of the media on individuals' specific language use in relation to a news story on immigration: the influence of the news frame and group cue. Abstraction, complexity of language use, and negative affective language were evaluated. The 523 participants were randomly distributed to each of the four experimental conditions: news frame (crime versus economic contribution) by group cue (geographical origin of the immigrants involved: Moroccans versus Latin Americans). Through content analysis of the ideas and reflections that arose after the participants read the different news stories, using the Linguistic Category Model (LCM; Semin & Fiedler, 1991) to measure abstract language and the Linguistic Inquiry and Word Count (LIWC; Pennebaker, Booth, & Francis, 2007) to analyze complex language and negative affective language, it emerged that abstract language and negative affective language were more frequent in the participants assigned to the news frame on crime. Complex language was more commonly used when the news frame referred to the economic contribution of immigrants. Regression analyses showed the mediating role of attitude to immigration in the effects of news frame on negative affective language. The bootstrap method was used to assess the magnitude of the indirect effect. A significant mediator effect was also found through structural equation modeling. Analyses of covariance showed one interaction between news frame and group cue: Among those who read the news story in a frame linking immigration to crime and Moroccan origin, abstract language was more characteristic. The results are discussed from the theoretical perspective of framing. PMID:23113573

  20. Marine environment news Vol. 3, no. 2, December 2005

    International Nuclear Information System (INIS)

    This issue is MEL's fifth Marine Environment News. Over the last 6 months MEL's programmes have been subjected to detailed evaluation first by an External Expert Panel that scrutinised our 5 year outputs and reported to the Director General, then by IAEA's Standing Advisory Group on Nuclear Application (SAGNA) which looked at our future marine programmes and challenges. Overall, both panels commended MEL for the volume, quality and relevance of MEL's outputs including our research findings, peer reviewed publications, training expertise and services to Member States. They also welcomed our decision to integrate our studies and services on non-nuclear contaminants with nuclear and isotopic projects, thereby providing Member States with value-added information on sources, fluxes and fates of contaminants in the coastal environment. They re-iterated previous recommendations for regular budget support to stabilise and re-launch a strategy for new extra budgetary partnerships. The reviews also welcomed the consolidation of MEL's carbonbased projects into a new Subprogramme H3 Ocean Climate Coupling and Carbon Cycling (OC4) for 2006-2007. (See our Website for New Subprogrammes). The Philippines Nuclear Research Institute (PNRI) was officially designated as an IAEA Collaborating Centre for their work on Harmful Algal Blooms (HABs). We plan joint research on tracking the food-chain mobility, impact and fate of HABs biotoxins using radiolabelled analogues. We were pleased to offer support to HSH Prince Albert II's Centenary Expedition to Spitzbergen and so contribute in a modest but symbolic way to the Centenary legacy of Oceanography in Monaco

  1. Need identification for educational services in Albania


    Bakrrugji, Simon


    This commissioned research-based thesis aimed at identifying the need for educational services in Albania. The results produced herein were accomplished through secondary and primary research. Secondary research was collected from a variety of sources published by international government agencies, and ministries and newspaper agencies in the country researched. These publications consisted of online reports, press releases, and news articles which described the need for educational services ...

  2. A Critical Discourse Analysis of English News Reports

    Institute of Scientific and Technical Information of China (English)

    PI Ya-xin


    Critical discourse analysis (CDA) can help people better understand the subjective view and the hidden ideology in a news discourse. Based on M.A.K. Halliday’s theory of transitivity and classification, this essay analyzes 3 reports from The New York Times and finds that despite how news reports may seem objective, every report contains the author’s own opinion he/she tries to convince the readers. Special attention needs to be paid when we come across news discourse and we shouldn’t let the hidden ideology in the reports manipulate our own viewpoint toward this world.


    Directory of Open Access Journals (Sweden)

    S. YU. Buryak


    Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.

  4. Social Media Guidelines and the News Paradigm

    DEFF Research Database (Denmark)

    Blumell, Lindsey; Hellmueller, Lea; Etter, Michael

    and if these guidelines challenge the news paradigm. While using social media have been a “loop-hole” of sorts to disseminating political information in countries that have strong censorship (the Arab Spring being a premiere example, Eltantawy & Wiest, 2011; Lotan, Graeff, Ananny, Gaffney, & Pearce, 2011), journalists......Social network use continues to increase in the majority of regions around the world, with a global increase of 17.6% in 2012, and another projected 12.6% in 2014 (, 2014). Social media have also been incorporated into daily routines of American journalists, with 53.8% reporting...... that they use microblogs like Twitter on a regular basis to both gather and disseminate information (Willnat & Weaver, 2014). The aim of this study is to investigate how social media, more specifically, social media guidelines, implemented at the organizational level intercede with journalism practices...

  5. NEWS: Nuclear Emulsions for WIMP Search (United States)

    Di Marco, Natalia; NEWS Collaboration


    In the field of direct Dark Matter search a different and promising approach is the directionality: the observation of the incoming apparent direction of WIMPs would in fact provide a new and unambiguous signature. The NEWS project is a very innovative approach for a high sensitivity experiment aiming at the directional detection of WIMPs: the detector is based on a novel emulsion technology called NIT (Nano Imaging Trackers) acting both as target and tracking device. In this paper we illustrate the features of a NIT-based detector and the newly developed read-out systems allowing to reach a spatial resolution of the order of 10 nm. We present the background studies and the experimental design. Finally we report about the time schedule of the experiment and the expected sensitivity for DM searches.

  6. A tale of two news reports

    Directory of Open Access Journals (Sweden)

    Robbins RA


    Full Text Available No abstract available. Article truncated at 150 words. On Wednesday, February 25, 2015 two new stories aired, one on National Public Radio (NPR that I heard riding home that afternoon and the other later in the evening on the CBS Evening News with Scott Pelley. Both stories were on the Department of Veterans Affairs (VA but I was struck by the contrasting style of the two reports. The first story was an NPR report on back injuries in nurses (1. According to the report nurses suffer more back injuries than almost any other occupation — and they get those injuries mainly from doing the everyday tasks of lifting and moving patients. The report stated that the VA has invested over $200 million in protecting nurses predominately by providing lifts and other devices for moving patients. VA hospitals across the country have reduced nursing injuries from moving patients by an average of 40 percent since the program started. The reduction ...

  7. Peace Journalism and the news production process

    Directory of Open Access Journals (Sweden)

    Burkhard Bläsi


    Full Text Available In recent years various models of „peace journalism“ or „constructive conflict coverage“ have been proposed. These models suggest alternative ways of conflict reporting in order to contribute to processes of de-escalation, peacebuilding and reconciliation instead of escalating, exaggerating or neglecting conflicts. However, these models will remain irrelevant for the practical work of journalists unless they are connected to the reality of today’s media. Therefore it is of great importance to also direct our attention to the news production process. At the same time, studying the factors that influence the production of journalistic reporting in times of conflict and war means learning about the actual preconditions for any effort of constructive conflict coverage. Based on qualitative expert interviews with German journalists, this paper presents a model of the production process of conflict coverage. According to this model, the production process can be described as a complex interaction of six factors: (1 structural aspects of the media, (2 conflict situation on-site, (3 personal features of the individual journalist, (4 the political climate, (5 lobbies, (6 the audience. After presenting the general model and the discussion of its limitations and possible benefits, the influence of the „political climate“ factor is explored in more detail and illustrated with the experience of German journalists in the aftermath of 9/11. The author argues that peace journalism can only attract the critical number of journalists needed for a noticeable change in conflict coverage, if there are realizable suggestions for how to meet the obstacles journalists face in their daily work. The model of influencing factors affecting conflict coverage could be a good starting point for this undertaking, as it enables us, on the one hand, to systematize and specify attempts to implement peace journalism and, on the other hand, to develop a more

  8. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas


    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  9. News trustworthiness and verification in China: The tension of dual media channels


    Wang, Yiran; Mark, Gloria


    From 2006 to 2013, the increasing use of social media in China has provided a stage for citizens to report news and to vocalize viewpoints. News information circulated on social media at times contradicted the highly curated official news sources. In this study, we conducted two online surveys to explore 1) the level of trust that Chinese Internet users place on news from social media versus official media; and, 2) whether and how Chinese Internet users verify news from citizen sources. We fo...

  10. Deregulation or democracy? New media, news, neoliberalism and the public interest


    Fenton, Natalie


    This article began from the premise that news media are in crisis. The crisis is being managed by closing papers or shedding staff. Drawing on extensive empirical research the paper argues that these cuts are having a devastating effect on the quality of the news. The cuts are being delivered to news so that shareholder profits remain in an increasingly deregulated news environment. This is having a particularly negative impact on local news. While new technology is opening up new spaces for ...

  11. Short term dynamic aperture with AC dipoles

    CERN Document Server

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department


    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  12. ac electroosmosis in rectangular microchannels. (United States)

    Campisi, Michele; Accoto, Dino; Dario, Paolo


    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310


    Directory of Open Access Journals (Sweden)

    Alfredo Aguilar Valdés


    Full Text Available El objetivo de este trabajo fue analizar el diagnostico situacional de una Empresa de Servicios Profesionales en el caso de: Instituto de Promoción Para el Desarrollo Rural A.C., a través de la Metodología “UALAE” así como la oportunidad que como empresa presenta. Este estudio se realizó en el municipio de Saltillo, Coahuila, México. Adoptó esta Metodología UALAE y se difundió su opinión. El Instituto de Promoción Para el Desarrollo Rural A.C., está formado por profesionistas y productores cuya finalidad es la de contribuir al desarrollo del medio rural con proyectos de viabilidad técnica, económica y social, sobre la base de necesidades reales y al aprovechamiento sustentable del potencial de los recursos naturales. Su buen funcionamiento es indispensable e importante para el desarrollo de los productores agropecuarios principalmente, debido a que se ven muy beneficiados con todos los servicios que se les brinda, se han logrado buenos proyectos, buenas capacitaciones y un gran crecimiento de sus productos. Mediante el proceso de asistencia técnica a organizaciones de productores, se induce la formulación adecuada de proyectos viables desde el punto visto del mercado, la rentabilidad económica, las tecnologías disponibles y de la organización social.

  14. News media coverage of a women's health contraversy: how newspapers and TV outlets covered a recent debate over screening mammography. (United States)

    Steele, Whitney Randolph; Mebane, Felicia; Viswanath, K; Solomon, Janice


    Over the past decade, there have been several highly visible debates about mammography that have captured professional, public and media attention. This paper looks at newspaper and television news coverage of a controversial research letter in The Lancet by Gøtzsche and Olsen (2001) that concluded that screening mammography did not prevent deaths from breast cancer. The news pieces examined for this project were published between October 2001 and March 2002 in one of eight U.S. newspapers or aired on one of six national or cable news networks. The six-month period was divided into one-week segments; the numbers of articles published or stories aired in each week were graphed to examine patterns. Each newspaper article and television transcript was then reviewed to identify its main content area and the amount of coverage for each major event was quantified. The highest number of newspaper articles appeared to result from several events during the end of January through the beginning of February. These events included the publication of another meta-analysis of mammography that disputed the original letter's conclusion and a full-page New York Times advertisement paid for by major medical organizations stating their continued support for mammography. The greatest amount of television news coverage was devoted to the announcement of the official federal guidelines by the Secretary of Health and Human Services in late February. We conclude by discussing how the flow of news coverage of medical controversies can potentially impact the actions and reactions of the public, the medical community and health policy makers. PMID:15970577

  15. Macroeconomic news and the euro/dollar exchange rate


    Gabriele Galati; Corrinne Ho


    This paper investigates to what extent daily movements in the euro/dollar rate were driven by news about the macroeconomic situation in the United States and the euro area during the first two years of EMU.

  16. Research Results in the News: A Users Guide (United States)

    ... this page please turn Javascript on. Feature: Medical Research Research Results in the News: A Users Guide Past ... scientists the most reliable results. Where was the research done? Scientists at a medical school or large ...

  17. Politeness Strategies in Good-news Business Letters

    Institute of Scientific and Technical Information of China (English)

    毕争; 李纳


    This paper analyzes the presentation of politeness in good-news business letters at the lexical,syntactic,and discourse levels based on Leech's Politeness Principle and Brown and Levinson's Face-saving Theory.

  18. 2009 FRIENDS-OF-NCI-EGRP News Flashes (United States)

    A 2009 archive of listserv announcements sent by the Epidemiology and Genetics Research Program to FRIENDS-OF-NCI-EGRP LISTSERV subscribers to communicate information about funding opportunities, grantsmanship issues, research resources, and other relevant news.

  19. 2011 FRIENDS-OF-NCI-EGRP News Flashes (United States)

    A 2011 archive of listserv announcements sent by the Epidemiology and Genetics Research Program to FRIENDS-OF-NCI-EGRP LISTSERV subscribers to communicate information about funding opportunities, grantsmanship issues, research resources, and other relevant news.

  20. 2008 FRIENDS-OF-NCI-EGRP News Flashes (United States)

    A 2008 archive of listserv announcements sent by the Epidemiology and Genetics Research Program to FRIENDS-OF-NCI-EGRP LISTSERV subscribers to communicate information about funding opportunities, grantsmanship issues, research resources, and other relevant news.

  1. 2010 FRIENDS-OF-NCI-EGRP News Flashes (United States)

    A 2010 archive of listserv announcements sent by the Epidemiology and Genetics Research Program to FRIENDS-OF-NCI-EGRP LISTSERV subscribers to communicate information about funding opportunities, grantsmanship issues, research resources, and other relevant news.

  2. 2013 FRIENDS-OF-NCI-EGRP News Flashes (United States)

    An archive of listserv announcements sent by the Epidemiology and Genetics Research Program to FRIENDS-OF-NCI-EGRP LISTSERV subscribers to communicate information about funding opportunities, grantsmanship issues, research resources, and other relevant news.

  3. 2012 FRIENDS-OF-NCI-EGRP News Flashes (United States)

    A 2012 archive of listserv announcements sent by the Epidemiology and Genetics Research Program to FRIENDS-OF-NCI-EGRP LISTSERV subscribers to communicate information about funding opportunities, grantsmanship issues, research resources, and other relevant news.

  4. 2014 FRIENDS-OF-NCI-EGRP News Flashes (United States)

    An archive of listserv announcements sent by the Epidemiology and Genetics Research Program to FRIENDS-OF-NCI-EGRP LISTSERV subscribers to communicate information about funding opportunities, grantsmanship issues, research resources, and other relevant news.

  5. Human development of the ability to learn from bad news. (United States)

    Moutsiana, Christina; Garrett, Neil; Clarke, Richard C; Lotto, R Beau; Blakemore, Sarah-Jayne; Sharot, Tali


    Humans show a natural tendency to discount bad news while incorporating good news into beliefs (the "good news-bad news effect"), an effect that may help explain seemingly irrational risk taking. Understanding how this bias develops with age is important because adolescents are prone to engage in risky behavior; thus, educating them about danger is crucial. We reveal a striking valence-dependent asymmetry in how belief updating develops with age. In the ages tested (9-26 y), younger age was associated with inaccurate updating of beliefs in response to undesirable information regarding vulnerability. In contrast, the ability to update beliefs accurately in response to desirable information remained relatively stable with age. This asymmetry was mediated by adequate computational use of positive but not negative estimation errors to alter beliefs. The results are important for understanding how belief formation develops and might help explain why adolescents do not respond adequately to warnings. PMID:24019466

  6. News Media Consumption and Political Behavior in Latin America

    Directory of Open Access Journals (Sweden)

    Ryan Salzman


    Full Text Available News media are an important factor in any democratic society. Research focused on developed democracies has paved the way for analysis in the context of less well-developed democracies. The project endeavors to continue that investigation into whether and how news media consumption affects democratic behavior among individuals in a region comprised of developing democracies: Latin America. Employing rich survey data available from the 2008 Latin American Public Opinion Project, traditional analyses are used to test one of the most basic questions for political communication researchers: Does news media consumption motivate or depress political participation? The results indicate that, on average, news media mobilize political participation, albeit to different degrees per medium and participation type. This seems to happen because those media socialize Latin Americans to value political participation.

  7. AcEST: BP920845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 45|Adiantum capillus-veneris mRNA, clone: YMU001_000142_D08. (514 letters) Database: uniprot_sprot.fasta 412,525 seq...P7 OS=Magnapor... 33 1.0 sp|Q7VF68|SYH_HELHP Histidyl-tRNA synthetase OS=Helicobacter hep... 31 3.8 sp|P1305...90 FTGFLVLHSEPRQQPQVDL 1608 >sp|A4QX49|DBP7_MAGGR ATP-dependent RNA helicase DBP7 OS=Magnaporthe grise...T PT VT+H + T+ AC+ A+TT+ H H Sbjct: 481 PPKETKPTK------PVTNHTESTVGKACYITSAANTTITLHKLH 519 >sp|Q7VF68|SYH_HELHP His...rot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searching.................................

  8. AcEST: DK960083 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ome P450 71D7 OS=Solanum chacoense ... 96 1e-19 sp|Q9SAB6|C71AI_ARATH Cytochrome ...... 96 2e-19 sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense ... 94 5e-19 sp|Q9T0K2|C71AK_AR... paten... 176 1e-42 tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii... 176 2e-42 tr|Q40907|Q40907_POPKI Cinnamic ac...8 KVVQQSRGAWEDEALRVIQDLKA 160 >tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii GN=C4H PE=2 ...e-42 tr|A9PBZ7|A9PBZ7_POPTR Putative uncharacterized protein OS=Popul... 176 2e-4

  9. AcEST: DK955376 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0022_O23 611 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_O23. 5' end seq ... LMDETRAAGIKL 210 Query: 602 AIC 610 A+C Sbjct: 211 AVC ... 213 >tr|A9SM81|A9SM81_PHYPA Predicted protein OS=P ... C 610 VLELMD A+ KGLKVA+C Sbjct: 196 VLELMDAAREKGLKVAVC ... 213 >tr|Q8L7U1|Q8L7U1_ARATH AT4g39970/T5J17_140 OS ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q680K2|Q680K2_ARATH MRNA, complete cds, cl ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q8LAS1|Q8LAS1_ARATH Putative uncharacteriz ...

  10. AcEST: BP913416 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GCATGTAGTTTGGA CAGAGATG ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swi...AC_BACFN Uronate isomerase OS=Bacteroides fragilis (... 30 4.5 sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...C++ N IP+ M C Sbjct: 417 LSYPRHEYFRRTLCNLLGCDVENGEIPLSEMERVC 451 >sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database searc...148,809,765 total letters Searching..................................................done Score E Sequences

  11. AcEST: DK947388 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac...ids Res. 25:3389-3402. Query= DK947388|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Databa... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947388|Adiantum c...apillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Database: uniprot_trembl.fasta...-ribosylation factor 1 OS=Salix bakko GN... 268 1e-71 sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea may

  12. AcEST: BP916217 [AcEST

    Lifescience Database Archive (English)

    Full Text Available inase kinase 7-interacting protein 3 OS=Mus musculus Align length 119 Score (bit) 35.0 E-value 0.16 Report B...visiae GN... 30 6.8 >sp|Q571K4|TAB3_MOUSE Mitogen-activated protein kinase kinase kinase 7-interacting protein 3 OS=Mus musculus...protein kinase kinase kinase 7 interacting protein 3 OS=Mus musculus GN=Map3k7ip3 PE=2 SV=1 Length = 716 Sco...(3)malignant brain tumor-like 2 prot... 31 2.3 sp|P33234|ADIY_ECOLI HTH-type transcriptional regulator adiY ...ZZC3_PSEU2 Membrane protein, putative OS=Pseudomonas... 35 2.5 tr|Q5U7D5|Q5U7D5_9BACI OpuAC OS=Halobacillus trueperi GN=opu

  13. AcEST: DK953324 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |LSRR_PHOLL Transcriptional regulator lsrR OS=Photorhab... 30 6.1 sp|A0JY64|ATPB_ARTS2 ATP synthase subunit beta OS=Arthroba...cter s... 30 6.1 sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...ATP synthase subunit beta OS=Arthrobacter sp. (strain FB24) GN=atpD PE=3 SV=1 Len...KD 372 Query: 311 HLHFTHRGKQRL 346 H + R KQ L Sbjct: 373 HYNTAVRVKQIL 384 >sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  14. AcEST: DK945049 [AcEST

    Lifescience Database Archive (English)

    Full Text Available R 148 >sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=ac...|Q4EPP8|Q4EPP8_LISMO Heavy metal-binding protein OS=Listeria m... 34 3.2 tr|A6AST1|A6AST1_VIBHA Copper-trans..... 31 2.7 sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Asper... 30 4.5 sp|A2VDJ0|T131L_HUMAN Transmembran...P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti Align length 75 Score (bit) 34.7 E-val...sophila ... 30 7.8 >sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium me

  15. Relationship between Inflation News and High Frequency Stock Returns


    Sun, Lianqun


    Increases or decreases in stock prices will determine how much an investor’s wealth will shrink or grow in the stock market. One set of important factors that influences the stock market is macroeconomic indicators, like inflation news. The Consumer Price Index (CPI) and The Producer Price Index (PPI) are among the most important measures of inflation conditions and overall economic conditions. Adams, McQueen and Wood have already identified the relationship between inflation news and stock r...

  16. Impact of Macroeconomic News on Malaysian Bond Credit Spreads


    Rasidah Mohd SAID


    This study investigates the impact of scheduled macroeconomics news on credit spreads of Malaysian bonds of various maturities and rating groups. Using daily spreads from August 2006 through October 2009, the impact of macroeconomic news announcements on the Malaysian bond credit spreads is evident in this study. The results of the analyses show that prior to the release of the macroeconomic information, the persistency of volatility is lower when compared to the persistency for the whole sam...

  17. The Market for News : a Demand-Oriented Analysis




    In this paper we investigate two elements of news demand behavior: the choice between gathering information through the news market and making one's decisions on the basis of prior beliefs; the choice between consulting more than one source and relying on just one. We single out education as the main determinant of behavior, by assuming that education is inversely related to (time) opportunity cost that the individual bears when he gets informed. In our model, two sources of information compe...

  18. Macroeconomic News 'Surprises' and the Rand/Dollar Exchange Rate


    Johannes Fedderke; Philippe Flamand


    Economic theory in the context of floating exchange rates has focussed on underlying medium and long term direction of exchange rate movements. Daily volatility is less well understood. One theory that offers an explanation for short term exchange rate movements is that of the efficient market hypothesis or EMH. Its application to the forex market allows exchange rate movements to be understood as the reaction of traders to relevant news. In an efficient market traders react to news and speci...

  19. Overview of CLEF NEWSREEL 2014: News Recommendations Evaluation Labs


    Kille, Benjamin; Brodt, Torben; Heintz, Tobias; Hopfgartner, Frank; Lommatzsch, Andreas; Seiler, Jonas


    This paper summarises objectives, organisation, and results of the first news recommendation evaluation lab (NEWSREEL 2014). NEWSREEL targeted the evaluation of news recommendation algorithms in the form of a campaignstyle evaluation lab. Participants had the chance to apply two types of evaluation schemes. On the one hand, participants could apply their algorithms onto a data set. We refer to this setting as off-line evaluation. On the other hand, participants could deploy ...

  20. Mediating markets: financial news media and reputation risk management


    Masie, Desné Rentia


    The increase of interest in financial culture following the financial crisis, which started in 2008, as well as the proliferation of financial data, have sparked an emerging research agenda into the role of financial news media. Moreover, financial news media is an important research topic in finance because information released through the media has a wider audience than other information intermediating systems in the financial market. This thesis defines the financial journal...