
Sample records for acs lcid project

  1. The ACS LCID Project: overview and first results

    CERN Document Server

    Gallart, Carme


    The star formation history (SFH) of Local Group galaxies is a powerful tool for studying their evolution, including chemical enrichment histories and stellar population gradients, which in turn may shed light on the role of reionization or Supernovae feedback in galaxy formation and evolution. In particular, isolated dwarfs are ideal laboratories since their evolution has not been complicated by the vicinity of giant galaxies. In this paper, we present the project Local Cosmology from Isolated Dwarfs (LCID), aimed at deriving detailed SFHs for a sample of Local Group isolated dwarf galaxies. To accomplish this goal we have collected, using the ACS on board the HST, color-magnitude diagrams (CMD) reaching their oldest main sequence turnoff (V~28 or M_V~+3.5) with good photometric accuracy. Some preliminary results from the CMDs are shown and briefly discussed.


    International Nuclear Information System (INIS)

    We use deep HST/ACS observations to calculate the star formation history (SFH) of the Cetus dwarf spheroidal (dSph) galaxy. Our photometry reaches below the oldest main-sequence turnoffs, which allows us to estimate the age and duration of the main episode of star formation in Cetus. This is well approximated by a single episode that peaked roughly 12 ± 0.5 Gyr ago and lasted no longer than about 1.9 ± 0.5 Gyr (FWHM). Our solution also suggests that essentially no stars formed in Cetus during the past 8 Gyr. This makes Cetus' SFH comparable to that of the oldest Milky Way dSphs. Given the current isolation of Cetus in the outer fringes of the Local Group, the dominant old population implies that Cetus is a clear outlier in the morphology-Galactocentric distance relation that holds for the majority of the Milky Way dwarf satellites. Our results also show that Cetus continued forming stars until z≅ 1, long after the universe was reionized, and that there is no clear signature of the epoch of reionization in Cetus' SFH. We briefly discuss the implications of these results for dwarf galaxy evolution models. Finally, we present a comprehensive account of the data reduction and analysis strategy adopted for all galaxies targeted by the LCID (Local Cosmology from Isolated Dwarfs) project. We employ two different photometry codes (DAOPHOT/ALLFRAME and DOLPHOT), three different SFH reconstruction codes (IAC-pop/MinnIAC, MATCH, and COLE), and two stellar evolution libraries (BaSTI and Padova/Girardi), allowing for a detailed assessment of the modeling and observational uncertainties.

  3. The ACS LCID project. III. The star formation history of the Cetus dSph galaxy: a post-reionization fossil


    Monelli, M.; Hidalgo, S. L.; Stetson, P. B.; Aparicio, A.; Gallart, C.; Dolphin, A.; Cole, A. A.; Weisz, D.; Skillman, E. D.; Bernard, E; Mayer, L.; J. Navarro; Cassisi, S.; Drozdovsky, I.; Tolstoy, E.


    We use deep HST/ACS observations to calculate the star formation history (SFH) of the Cetus dwarf spheroidal (dSph) galaxy. Our photometry reaches below the oldest main sequence turn-offs, which allows us to estimate the age and duration of the main episode of star formation in Cetus. This is well approximated by a single episode that peaked roughly 12+/-0.5 Gyr ago and lasted no longer than about 1.9+/-0.5 Gyr (FWHM). Our solution also suggests that essentially no stars formed in Cetus durin...

  4. The ACS LCID project. III. The star formation history of the Cetus dSph galaxy: a post-reionization fossil

    CERN Document Server

    Monelli, M; Stetson, P B; Aparicio, A; Gallart, C; Dolphin, A; Cole, A A; Weisz, D; Skillman, E D; Bernard, E; Mayer, L; Navarro, J; Cassisi, S; Drozdovsky, I; Tolstoy, E


    We use deep HST/ACS observations to calculate the star formation history (SFH) of the Cetus dwarf spheroidal (dSph) galaxy. Our photometry reaches below the oldest main sequence turn-offs, which allows us to estimate the age and duration of the main episode of star formation in Cetus. This is well approximated by a single episode that peaked roughly 12+/-0.5 Gyr ago and lasted no longer than about 1.9+/-0.5 Gyr (FWHM). Our solution also suggests that essentially no stars formed in Cetus during the past 8 Gyrs. This makes Cetus' SFH comparable to that of the oldest Milky Way dSphs. Given the current isolation of Cetus in the outer fringes of the Local Group, this implies that Cetus is a clear outlier in the morphology-Galactocentric distance relation that holds for the majority of Milky Way dwarf satellites. Our results also show that Cetus continued forming stars through z ~ 1, long after the Universe was reionized, and that there is no clear signature of the epoch of reionization in Cetus' SFH. We discuss br...

  5. The ACS LCID project. IX. Imprints of the early Universe in the radial variation of the star formation history of dwarf galaxies


    Hidalgo, Sebastian L.; Monelli, Matteo; Aparicio, Antonio; Gallart, Carme; Skillman, Evan D.; Cassisi, Santi; Bernard, Edouard J.; Mayer, Lucio; Stetson, Peter; Cole, Andrew; Dolphin, Andrew


    Based on Hubble Space Telescope observations from the Local Cosmology from Isolated Dwarfs project, we present the star formation histories, as a function of galactocentric radius, of four isolated Local Group dwarf galaxies: two dSph galaxies, Cetus and Tucana, and two transition galaxies (dTrs), LGS-3 and Phoenix. The oldest stellar populations of the dSphs and dTrs are, within the uncertainties, coeval (~13 Gyr) at all galactocentric radii. We find that there are no significative differenc...

  6. The ACS LCID project. IX. Imprints of the early Universe in the radial variation of the star formation history of dwarf galaxies

    CERN Document Server

    Hidalgo, Sebastian L; Aparicio, Antonio; Gallart, Carme; Skillman, Evan D; Cassisi, Santi; Bernard, Edouard J; Mayer, Lucio; Stetson, Peter; Cole, Andrew; Dolphin, Andrew


    Based on Hubble Space Telescope observations from the Local Cosmology from Isolated Dwarfs project, we present the star formation histories, as a function of galactocentric radius, of four isolated Local Group dwarf galaxies: two dSph galaxies, Cetus and Tucana, and two transition galaxies (dTrs), LGS-3 and Phoenix. The oldest stellar populations of the dSphs and dTrs are, within the uncertainties, coeval ($\\sim 13 Gyr$) at all galactocentric radii. We find that there are no significative differences between the four galaxies in the fundamental properties (such as the normalized star formation rate or age-metallicity relation) of their outer regions (radii greater than four exponential scale lengths); at large radii, these galaxies consist exclusively of old ($\\geq 10.5 Gyr$) metal-poor stars. The duration of star formation in the inner regions vary from galaxy to galaxy, and the extended central star formation in the dTrs produces the dichotomy between dSph and dTr galaxy types. The dTr galaxies show promine...

  7. The ACS LCID project. IX. Imprints of the early universe in the radial variation of the star formation history of dwarf galaxies

    International Nuclear Information System (INIS)

    Based on Hubble Space Telescope observations from the Local Cosmology from Isolated Dwarfs project, we present the star formation histories, as a function of galactocentric radius, of four isolated Local Group dwarf galaxies: two dSph galaxies, Cetus and Tucana, and two transition galaxies (dTrs), LGS-3 and Phoenix. The oldest stellar populations of the dSphs and dTrs are, within the uncertainties, coeval (∼13 Gyr) at all galactocentric radii. We find that there are no significative differences between the four galaxies in the fundamental properties (such as the normalized star formation rate or age-metallicity relation) of their outer regions (radii greater than four exponential scale lengths); at large radii, these galaxies consist exclusively of old (≳ 10.5 Gyr) metal-poor stars. The duration of star formation in the inner regions varies from galaxy to galaxy, and the extended central star formation in the dTrs produces the dichotomy between dSph and dTr galaxy types. The dTr galaxies show prominent radial stellar population gradients: The centers of these galaxies host young (≲ 1 Gyr) populations, while the age of the last formation event increases smoothly with increasing radius. This contrasts with the two dSph galaxies. Tucana shows a similar, but milder, gradient, but no gradient in age is detected Cetus. For the three galaxies with significant stellar population gradients, the exponential scale length decreases with time. These results are in agreement with outside-in scenarios of dwarf galaxy evolution, in which a quenching of the star formation toward the center occurs as the galaxy runs out of gas in the outskirts.

  8. The ACS LCID Project. VIII. The short-period Cepheids of Leo A

    CERN Document Server

    Bernard, Edouard J; Gallart, Carme; Fiorentino, Giuliana; Cassisi, Santi; Aparicio, Antonio; Cole, Andrew A; Drozdovsky, Igor; Hidalgo, Sebastian L; Skillman, Evan D; Stetson, Peter B; Tolstoy, Eline


    We present the results of a new search for variable stars in the Local Group dwarf galaxy Leo A, based on deep photometry from the Advanced Camera for Surveys onboard the Hubble Space Telescope. We detected 166 bona fide variables in our field, of which about 60 percent are new discoveries, and 33 candidate variables. Of the confirmed variables, we found 156 Cepheids, but only 10 RR Lyrae stars despite nearly 100 percent completeness at the magnitude of the horizontal branch. The RR Lyrae stars include 7 fundamental and 3 first-overtone pulsators, with mean periods of 0.636 and 0.366 day, respectively. From their position on the period-luminosity (PL) diagram and light-curve morphology, we classify 91, 58, and 4 Cepheids as fundamental, first-overtone, and second-overtone mode Classical Cepheids (CC), respectively, and two as population II Cepheids. However, due to the low metallicity of Leo A, about 90 percent of the detected Cepheids have periods shorter than 1.5 days. Comparison with theoretical models ind...

  9. The ACS LCID project. X. the star formation history of IC 1613: Revisiting the over-cooling problem

    International Nuclear Information System (INIS)

    We present an analysis of the star formation history (SFH) of a field near the half-light radius in the Local Group dwarf irregular galaxy IC 1613 based on deep Hubble Space Telescope Advanced Camera for Surveys imaging. Our observations reach the oldest main sequence turn-off, allowing a time resolution at the oldest ages of ∼1 Gyr. Our analysis shows that the SFH of the observed field in IC 1613 is consistent with being constant over the entire lifetime of the galaxy. These observations rule out an early dominant episode of star formation in IC 1613. We compare the SFH of IC 1613 with expectations from cosmological models. Since most of the mass is in place at early times for low-mass halos, a naive expectation is that most of the star formation should have taken place at early times. Models in which star formation follows mass accretion result in too many stars formed early and gas mass fractions that are too low today (the 'over-cooling problem'). The depth of the present photometry of IC 1613 shows that, at a resolution of ∼1 Gyr, the star formation rate is consistent with being constant, at even the earliest times, which is difficult to achieve in models where star formation follows mass assembly.


    International Nuclear Information System (INIS)

    We present the first investigation of the Blue Straggler star (BSS) population in two isolated dwarf spheroidal galaxies of the Local Group, Cetus and Tucana. Deep Hubble Space Telescope/Advanced Camera for Surveys photometry allowed us to identify samples of 940 and 1214 candidates, respectively. The analysis of the star formation histories of the two galaxies suggests that both host a population of BSSs. Specifically, if the BSS candidates are interpreted as young main sequence stars, they do not conform to their galaxy's age-metallicity relationship. The analysis of the luminosity function and the radial distributions supports this conclusion, and suggests a non-collisional mechanism for the BSS formation, from the evolution of primordial binaries. This scenario is also supported by the results of new dynamical simulations presented here. Both galaxies coincide with the relationship between the BSS frequency and the absolute visual magnitude MV found by Momany et al. If this relationship is confirmed by larger sample, then it could be a valuable tool to discriminate between the presence of BSSs and galaxies hosting truly young populations.

  11. The ACS LCID Project: On the origin of dwarf galaxy types: a manifestation of the halo assembly bias?


    Gallart, Carme; Monelli, Matteo; Mayer, Lucio; Aparicio, Antonio; Battaglia, Giuseppina; Bernard, Edouard J.; Cassisi, Santi; Cole, Andrew A.; Dolphin, Andrew E.; Drozdovsky, Igor; Hidalgo, Sebastian L.; Navarro, Julio F; Salvadori, Stefania; Skillman, Evan D.; Stetson, Peter B


    We discuss how knowledge of the whole evolutionary history of dwarf galaxies, including details on the early star formation events, can provide insight on the origin of the different dwarf galaxy types. We suggest that these types may be imprinted by the early conditions of formation rather than only being the result of a recent morphological transformation driven by environmental effects. We present precise star formation histories of a sample of Local Group dwarf galaxies, derived from colo...

  12. The ACS LCID Project: On the origin of dwarf galaxy types: a manifestation of the halo assembly bias?

    CERN Document Server

    Gallart, C; Mayer, L; Aparicio, A; Battaglia, G; Bernard, E J; Cassisi, S; Cole, A A; Dolphin, A E; Drozdovsky, I; HIdalgo, S L; Navarro, J F; Salvadori, S; Skillman, E D; Stetson, P B; Weisz, D R


    We discuss how knowledge of the whole evolutionary history of dwarf galaxies, including details on the early star formation events, can provide insight on the origin of the different dwarf galaxy types. We suggest that these types may be imprinted by the early conditions of formation rather than being only the result of a recent morphological transformation driven by environmental effects. We present precise star formation histories of a sample of Local Group dwarf galaxies, derived from colour-magnitude diagrams reaching the oldest main-sequence turnoffs. We argue that these galaxies can be assigned to two basic types: fast dwarfs that started their evolution with a dominant and short star formation event, and slow dwarfs that formed a small fraction of their stars early and have continued forming stars until the present time (or almost). These two different evolutionary paths do not map directly onto the present-day morphology (dwarf spheroidal vs dwarf irregular). Slow and fast dwarfs also differ in their ...

  13. The ACS LCID project. X. The Star Formation History of IC 1613: Revisiting the Over-Cooling Problem

    CERN Document Server

    Skillman, Evan D; Weisz, Daniel R; Monelli, Matteo; Gallart, Carme; Aparicio, Antonio; Bernard, Edouard J; Boylan-Kolchin, Michael; Cassisi, Santi; Cole, Andrew A; Dolphin, Andrew E; Ferguson, Henry C; Mayer, Lucio; Navarro, Julio F; Stetson, Peter B; Tolstoy, Eline


    We present an analysis of the star formation history (SFH) of a field near the half light radius in the Local Group dwarf irregular galaxy IC 1613 based on deep Hubble Space Telescope Advanced Camera for Surveys imaging. Our observations reach the oldest main sequence turn-off, allowing a time resolution at the oldest ages of ~1 Gyr. Our analysis shows that the SFH of the observed field in IC 1613 is consistent with being constant over the entire lifetime of the galaxy. These observations rule out an early dominant episode of star formation in IC 1613. We compare the SFH of IC 1613 with expectations from cosmological models. Since most of the mass is in place at early times for low mass halos, a naive expectation is that most of the star formation should have taken place at early times. Models in which star formation follows mass accretion result in too many stars formed early and gas mass fractions which are too low today (the "over-cooling problem"). The depth of the present photometry of IC 1613 shows that...

  14. The ACS LCID project. V. The Star Formation History of the Dwarf Galaxy \\objectname[]{LGS-3}: Clues for Cosmic Reionization and Feedback

    CERN Document Server

    Hidalgo, Sebastian L; Skillman, Evan; Monelli, Matteo; Gallart, Carme; Cole, Andrew; Dolphin, Andrew; Weisz, Daniel; Bernard, Edouard; Cassisi, Santi; Mayer, Lucio; Stetson, Peter; Tolstoy, Eline; Ferguson, Henry


    We present an analysis of the star formation history (SFH) of the transition-type (dIrr/dSph) Local Group galaxy \\objectname[]{LGS-3} (Pisces) based on deep photometry obtained with the {\\it Advanced Camera for Surveys} onboard the {\\it Hubble Space Telescope}. Our analysis shows that the SFH of \\objectname[]{LGS-3} is dominated by a main episode $\\sim 11.7$ Gyr ago with a duration of $\\sim$ 1.4 Gyr which formed $\\sim 90%$ of the stars. Subsequently, \\objectname[]{LGS-3} continued forming stars until the present, although at a much lower rate. The lack of early chemical enrichment is in contrast to that observed in the isolated dSph galaxies of comparable luminosity, implying that the dSphs were more massive and subjected to more tidal stripping. We compare the SFH of \\objectname[]{LGS-3} with expectations from cosmological models. Most or all the star formation was produced in \\objectname[]{LGS-3} after the reionization epoch, assumed to be completed at $z\\sim6$ or $\\sim 12.7$ Gyr ago. The total mass of the ...


    International Nuclear Information System (INIS)

    We present an analysis of the star formation history (SFH) of the transition-type (dIrr/dSph) Local Group galaxy LGS-3 (Pisces) based on deep photometry obtained with the Advanced Camera for Surveys onboard the Hubble Space Telescope. Our observations reach the oldest main-sequence turnoffs at high signal to noise, allowing a time resolution at the oldest ages of σ ∼ 1.1 Gyr. Our analysis, based on three different SFH codes, shows that the SFH of LGS-3 is dominated by a main episode ∼11.7 Gyr ago with a duration of ∼1.4 Gyr. Subsequently, LGS-3 continued forming stars until the present, although at a much lower rate. Roughly 90% of the stars in LGS-3 were formed in the initial episode of star formation. Extensive tests of self-consistency, uniqueness, and stability of the solution have been performed together with the IAC-star/IAC-pop/MinnIAC codes, and these results are found to be independent of the photometric reduction package, the stellar evolution library, and the SFH recovery method. There is little evidence of chemical enrichment during the initial episode of star formation, after which the metallicity increased more steeply reaching a present-day value of Z ∼ 0.0025. This suggests a scenario in which LGS-3 first formed stars mainly from infalling fresh gas, and after about 9 Gyr ago, from a larger fraction of recycled gas. The lack of early chemical enrichment is in contrast to that observed in the isolated dSph galaxies of comparable luminosity, implying that the dSphs were more massive and subjected to more tidal stripping. We compare the SFH of LGS-3 with expectations from cosmological models. Most or all the star formation was produced in LGS-3 after the reionization epoch, assumed to be completed at z ∼ 6 or ∼12.7 Gyr ago. The total mass of the galaxy is estimated to be between 2 and 4 x 108 Msun corresponding to circular velocities between 28 km s-1 and 36 km s-1. These values are close to but somewhat above the limit of 30 km s-1 below which the UV background is expected to prevent any star formation after reionization. Feedback from supernovae (SNe) associated with the initial episode of star formation (mechanical luminosity from SNe Lw = 5.3 x 1038 erg s-1) is probably inadequate to completely blow away the gas. However, the combined effects of SN feedback and UV background heating might be expected to completely halt star formation at the reionization epoch for the low mass of LGS-3; this suggests that self-shielding is important to the early evolution of galaxies in this mass range.

  16. The ACS LCID Project XI. On the early time resolution of LG dwarf galaxy SFHs: Comparing the effects of reionization in models with observations

    CERN Document Server

    Aparicio, Antonio; Skillman, Evan; Cassisi, Santi; Mayer, Lucio; Navarro, Julio; Cole, Andrew; Gallart, Carme; Monelli, Matteo; Weisz, Daniel; Bernard, Edouard; Dolphin, Andrew; Stetson, Peter


    The analysis of the early star formation history (SFH) of nearby galaxies, obtained from their resolved stellar populations is relevant as a test for cosmological models. However, the early time resolution of observationally derived SFHs is limited by several factors. Thus, direct comparison of observationally derived SFHs with those derived from theoretical models of galaxy formation is potentially biased. Here we investigate and quantify this effect. For this purpose, we analyze the duration of the early star formation activity in a sample of four Local Group dwarf galaxies and test whether they are consistent with being true fossils of the pre-reionization era; i.e., if the quenching of their star formation occurred before cosmic reionization by UV photons was completed. Two classical dSph (Cetus and Tucana) and two dTrans (LGS-3 and Phoenix) isolated galaxies with total stellar masses between $1.3\\times 10^6$ to $7.2\\times 10^6$ M$_\\odot$ have been studied. Accounting for time resolution effects, the SFHs...

  17. The ACS LCID Project. XI. On the Early Time Resolution of SFHs of Local Group Dwarf Galaxies: Comparing the Effects of Reionization in Models with Observations (United States)

    Aparicio, Antonio; Hidalgo, Sebastian L.; Skillman, Evan; Cassisi, Santi; Mayer, Lucio; Navarro, Julio; Cole, Andrew; Gallart, Carme; Monelli, Matteo; Weisz, Daniel; Bernard, Edouard; Dolphin, Andrew; Stetson, Peter


    The analysis of the early star formation history (SFH) of nearby galaxies, obtained from their resolved stellar populations, is relevant as a test for cosmological models. However, the early time resolution of observationally derived SFHs is limited by several factors. Thus, direct comparison of observationally derived SFHs with those derived from theoretical models of galaxy formation is potentially biased. Here we investigate and quantify this effect. For this purpose, we analyze the duration of the early star formation activity in a sample of four Local Group dwarf galaxies and test whether they are consistent with being true fossils of the pre-reionization era; i.e., if the quenching of their star formation occurred before cosmic reionization by UV photons was completed. Two classical dSph (Cetus and Tucana) and two dTrans (LGS-3 and Phoenix) isolated galaxies with total stellar masses between 1.3× {10}6 and 7.2× {10}6 {M}ȯ have been studied. Accounting for time resolution effects, the SFHs peak as much as 1.25 Gyr earlier than the optimal solutions. Thus, this effect is important for a proper comparison of model and observed SFHs. It is also shown that none of the analyzed galaxies can be considered a true fossil of the pre-reionization era, although it is possible that the outer regions of Cetus and Tucana are consistent with quenching by reionization. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with program #10505.

  18. SNL software manual for the ACS Data Analytics Project.

    Energy Technology Data Exchange (ETDEWEB)

    Stearley, Jon R.; McLendon, William Clarence, III; Rodrigues, Arun F.; Williams, Aaron S.; Hooper, Russell Warren; Robinson, David Gerald; Stickland, Michael G.


    In the ACS Data Analytics Project (also known as 'YumYum'), a supercomputer is modeled as a graph of components and dependencies, jobs and faults are simulated, and component fault rates are estimated using the graph structure and job pass/fail outcomes. This report documents the successful completion of all SNL deliverables and tasks, describes the software written by SNL for the project, and presents the data it generates. Readers should understand what the software tools are, how they fit together, and how to use them to reproduce the presented data and additional experiments as desired. The SNL YumYum tools provide the novel simulation and inference capabilities desired by ACS. SNL also developed and implemented a new algorithm, which provides faster estimates, at finer component granularity, on arbitrary directed acyclic graphs.

  19. Low AC Loss in a 3 kA HTS Cable of the Dutch Project

    DEFF Research Database (Denmark)

    Chevtchenko, Oleg; Zuijderduin, Roy; Smit, Johan; Willén, Dag; Lentge, Heidi; Thidemann, Carsten; Traeholt, Chresten; Melnik, Irina; Geschiere, Alex


    Requirements for a 6km long high temperature superconducting (HTS) AC power cable of the Amsterdam project are: a cable has to fit in an annulus of 160mm, with two cooling stations at the cable ends only. Existing solutions for HTS cables would lead to excessively high coolant pressure drop in th...

  20. Accelerating positive change in e-records management : the AC+erm project at Northumbria


    McLeod, Julie; Childs, Sue


    The AC+erm project aims to investigate and critically explore issues and practical strategies for accelerating positive change in electronic records management. The project’s focus is on designing an organisational-centred architecture from three perspectives: people, process and technology. This paper introduces the project, describes the methodology (a systematic literature review, e-Delphi studies and colloquia) and presents solutions for improving ERM developed from the people and process...

  1. Project Completion Report on China's Room AC Reach Standard

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Jiang


    After much anticipation and hard work, China's reach standard for room air-conditioners was announced in September 2004, with the first tier going into effect on March 1, 2005 and the reach standard taking effect on January 1, 2009. This is a major milestone in the development of minimum energy efficiency standards in China: finally China has set a minimum standard that is meaningful and stringent. According to our preliminary analysis, the majority of room ACs products on the Chinese market in 2004 would not meet the 2009 reach standard requirement. In addition to setting the minimum requirement, China's new AC standard also include classification requirement for the newly established Energy Information Label, as well as the certification requirement for CECP's Energy Conservation Label. Highlights of the 2009 reach standard include: (1) The Chinese Reach Standard for Room AC in 2009 is tighter than American counterpart, and almost matches the efficiency of American Central Air-Conditioners; and (2) Summer peak demand reduction in 2020 due to the reach standard exceeds the capacity of the Three Gorges Project.

  2. Library Electronic Resource Sharing Among Liberal Arts Colleges: ACS Palladian Alliance Project

    Directory of Open Access Journals (Sweden)

    Wenxian Zhang


    Full Text Available 無Effective electronic resource sharing is critical to library information services of the 1990s. Explosion of data and increased cost of information force libraries to work together, and technological advancements present the library service profession a platform for resource sharing. The Palladian Alliance Project of the Associated Colleges of the South is designed to provides ACS member institutions an effective means to enhance information access for their faculty and students, and achieve significant cost containment in the years to come.

  3. Antennas Designed for Advanced Communications for Air Traffic Management (AC/ATM) Project (United States)

    Zakrajsek, Robert J.


    The goal of the Advanced Communications for Air Traffic Management (AC/ATM) Project at the NASA Glenn Research Center at Lewis Field is to enable a communications infrastructure that provides the capacity, efficiency, and flexibility necessary to realize a mature free-flight environment. The technical thrust of the AC/ATM Project is targeted at the design, development, integration, test, and demonstration of enabling technologies for global broadband aeronautical communications. Since Ku-band facilities and equipment are readily available, one of the near-term demonstrations involves a link through a Kuband communications satellite. Two conformally mounted antennas will support the initial AC/ATM communications links. Both of these are steered electronically through monolithic microwave integrated circuit (MMIC) amplifiers and phase shifters. This link will be asymmetrical with the downlink to the aircraft (mobile vehicle) at a throughput rate of greater than 1.5 megabits per second (Mbps), whereas the throughput rate of the uplink from the aircraft will be greater than 100 kilobits per second (kbps). The data on the downlink can be narrow-band, wide-band, or a combination of both, depending on the requirements of the experiment. The AC/ATM project is purchasing a phased-array Ku-band transmitting antenna for the uplink from the test vehicle. Many Ku-band receiving antennas have been built, and one will be borrowed for a short time to perform the initial experiments at the NASA Glenn Research Center at Lewis Field. The Ku-band transmitting antenna is a 254-element MMIC phased-array antenna being built by Boeing Phantom Works. Each element can radiate 100 mW. The antenna is approximately 43-cm high by 24-cm wide by 3.3-cm thick. It can be steered beyond 60 from broadside. The beamwidth varies from 6 at broadside to 12 degrees at 60 degrees, which is typical of phased-array antennas. When the antenna is steered to 60 degrees, the beamwidth will illuminate

  4. Ranking transmission projects in large scale systems using an AC power flow model; Priorizacao de obras em sistemas de grande porte usando um modelo AC da rede

    Energy Technology Data Exchange (ETDEWEB)

    Melo, A.C.G. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil); Fontoura Filho, R.N. [ELETROBRAS, Rio de Janeiro, RJ (Brazil); Peres, L.A.P. Pecorelli [FURNAS, Rio de Janeiro, RJ (Brazil); Morozowski Filho, M. [Santa Catarina Univ., Florianopolis, SC (Brazil)


    Initially, this paper summarizes the approach developed by the Brazilian Planning Criteria Working Group (GTCP/ELETROBRAS) for identifying which subset of transmission investments should be postponed to meet a pre-stablished budget constraint with the least possible impact on system performance. Next, this paper presents the main features of the computational model PRIO, which allows the application of the ranking process to large scale power systems (2,000 buses and 3,000 circuits), with as many as 100 projects to be ranked. In this model, the adequacy analysis of each system state is carried out through an AC power flow coupled to a successive linear programming based remedial actions model. Case studies with the IEEE-RTS system and a configuration of the Brazilian Southeastern are presented and discussed. (author) 7 refs., 6 figs., 5 tabs.

  5. NCDC International Best Track Archive for Climate Stewardship (IBTrACS) Project, Version 3 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The International Best Track Archive for Climate Stewardship (IBTrACS) dataset was developed by the NOAA National Climatic Data Center, which took the initial step...

  6. Design and developement of a bidirectional AC/DC battery charger for the sustainable auto rickshaws project


    Montlló i Casabayó, Ernest


    The objective of this project is to design a 3 kW nickel‐metal hydride bidirectional battery charger with power factor correction. This electronic power converter is designed to charge batteries with energy from AC mains and also from a solar or wind energy sources, therefore it must be able to transfer energy from the renewable energy source to the net in case of excess. This battery charger is designed as a part of wider project: “Sustainable Transportation Solution for Au...

  7. Field_ac: a research project on ocean modelling in coastal areas. The experience in the Catalan Sea. (United States)

    Grifoll, Manel; Pallarès, Elena; Tolosana-Delgado, Raimon; Fernandez, Juan; Lopez, Jaime; Mosso, Cesar; Hermosilla, Fernando; Espino, Manuel; Sanchez-Arcilla, Agustín


    The EU founded Field_ac project has investigated during the last three years methods and strategies for improving operational services in coastal areas. The objective has been to generate added value for shelf and regional scale predictions from GMES Marine Core Services. In this sense the experience in the Catalan Sea site has allowed to combine high-resolution numerical modeling tools nested into regional GMES services, data from intensive field campaigns or local observational networks and remote sensing products. Multi-scale coupled models have been implemented to evaluate different temporal and spatial scales of the dominant physical processes related with waves, currents, continental/river discharges or sediment transport. In this sense the experience of the Field_ac project in the Catalan Sea has permit to "connect" GMES marine core service results to the coastal (local) anthropogenic forcing (e.g. causes of morphodynamic evolution and ecosystem degradation) and will support a knowledge-based assessment of decisions in the coastal zone. This will contribute to the implementation of EU directives (e.g., the Water Framework Directive for water quality at beaches near harbour entrances or the Risk or Flood Directives for waves and sea-level at beach/river-mouth scales).

  8. Design studies for the Mead-Phoenix 500 kV AC transmission project

    Energy Technology Data Exchange (ETDEWEB)

    Thallam, R.S.; Lundquist, T.G.; Gerlach, D.W. [Salt River Project, Phoenix, AZ (United States); Atmuri, S.R. [Teshmont Consultants Inc., Winnipeg, Manitoba (Canada); Selin, D.A. [Arizona Public Service Co., Phoenix, AZ (United States)


    The Mead-Phoenix 500 kV ac line is 243 miles long and runs parallel to the existing Mead-Liberty 345 kV line. This line is planned for 70% series and 70% shunt compensation; it also incorporates the first application of a 50 kV phase shifting transformer that enables a 1,300 MW transmission capacity. This paper presents the design studies that were undertaken in arriving at the equipment ratings and insulation levels that lead to the equipment specifications. The shunt reactor switching requirements utilizing MOV across the breaker, line switching with line connected arresters and the breaker transient recovery voltage are also dealt with in the paper.

  9. Staking-out projected boundaries of natural property Vršac Mountains using the RTK GPS/glonass method

    Directory of Open Access Journals (Sweden)

    Gučević Jelena


    Full Text Available The existing topographic and cadastral maps of the former Yugoslav republics are in Gauss-Krüger projection on Bessel ellipsoid. For the collected GPS data to comply with the existing cartographic material, it is necessary to provide the transformation parameters from WGS84 to Bessel ellipsoid and according to the principles of cartographic mapping, to make mappings in the plane of the State Coordinate System (SCS. The aim of this research is to present the surveying activities necessary for the establishment and maintenance of digital cartographic basis, which is shown in the test area of “VRŠAC MOUNTAINS”, a Serbian region with outstanding characteristics. In order to establish a connection between the collected data, it is necessary to primarily calculate the parameters of transformation from WGS84 into the SCS. After the vectorisation of projected boundaries from bases made in the SCS, the transformation of vectorised boundary lines from SCS into the WGS84 is carried out, followed by staking the boundaries. To understand the fundamental differences in the methodology of using GPS receivers, it is important to emphasise that the concept of GPS determination of the coordinates is generally divided into absolute and relative positioning. If the correct procedure of GPS positioning, applied to certain environmental conditions, is not followed, the error up to 200 m could be expected. Conclusions are drawn about the selection of staking methods, related to the applied instruments and specific field conditions. The stakeout procedures are given in accordance with the principles of geodetic positioning. [Projekat Ministarstva nauke Republike Srbije, br. 043007: Istraživanje klimatskih promena i njihovog uticaja na životnu sredinu: praćenje uticaja, adaptacija i ublažavanje

  10. Selection of topologies for the PHOTONERGY{sup TM} project. Optimised design and control of inverter for photovoltaic systems: the AC-module

    Energy Technology Data Exchange (ETDEWEB)

    Baekhoej Kjaer, S.


    The PHOTONERGY{sup TM} project (also known as the former 'SolcelleInverter' project) is by this report carried into its third stage; the selection of a suitable topology for the AC-Module inverter. The selection of a suitable topology is based on State-Of-The-Art analysis a specifications and a comparison of four grid-tied inverters and nine dc/dc converters. This implies 23 possible combinations, from which nine is investigated with respect to efficiency in six working points, the number of components and to some extent also the rating of the components. The conclusion is that the target of a European efficiency of 93.7% is hard to achieve. But four of the examined, and two newly discovered, inverters are recommended for a further examination by means of estimations, calculations and simulations of: cost, complexity, robustness, efficiency and mass-production. The system-layout is also examined. The first layout implies that the PV-Module and the inverter is integrated into one unit and the second layout involves that the inverter is placed indoor. The layouts are compared with respect to cable-losses, enclosure demanding and lifetime. The conclusion is somehow ambiguous and a further investigation should be initiated in order to get a clear result. (au)

  11. Characteristics of DC or AC high-voltage grids. Contribution of the Energy research Centre of the Netherlands (ECN) to the PREGO-project; Kenmerken van gelijkstroom of wisselstroom hoogspanningsnetwerken. ECN-bijdrage aan het PREGO-project

    Energy Technology Data Exchange (ETDEWEB)

    Lako, P. [ECN Beleidsstudies, Petten (Netherlands)


    Intermittent renewable energy sources, in particular wind energy and solar energy (PV), are becoming more and more important for electricity generation in the Netherlands and abroad. Based on the current energy policies of the Dutch government it may be expected that onshore and offshore wind could supply up to 24% of the electricity in 2020, presumed that the demand would not grow. In case of increasing demand, the percentage will be lower than that. A growing capacity of onshore and offshore wind may be expected to have considerable impacts not only on electricity generation but also on electricity transmission within a few decades. In order to accommodate growing amounts of electricity generated by wind (and to a lesser extent PV), electricity transport by means of High Voltage Direct Current (HVDC) may become necessary. This technology is already applied on a wide scale for electricity transport over hundreds of km, e.g. in case of large hydropower projects in China and Brazil. Furthermore, HVDC is applied in case of crossing of straits - 23 projects built, under construction, or planned - and in case of 'back-to-back' interconnections between AC (Alternating Current) networks. Studies from the UK and Germany indicate that HVDC may be beneficial, not only in terms of lower electricity transmission costs but also because of less interdependence of grids and lower environmental impacts (avoidance of onshore HVAC lines). This study provides data with regard to onshore (subterranean) and offshore HVDC projects (crossing of straits) that may useful for prospective modelling studies of growing amounts of renewably produces electricity. [Dutch] Deze studie gaat in op de relatie tussen intermitterende energiebronnen en investeringen in het hoogspanningsnet. De intermitterende energiebronnen zonne- en windenergie hebben een grote invloed op het systeem van elektriciteitsopwekking, -transport en -distributie. De overheidsdoelstellingen met betrekking tot wind

  12. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun


    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  13. AC power supply systems

    International Nuclear Information System (INIS)

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  14. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available optera acutorost... 37 0.66 tr|B1ACS6|B1ACS6_BALBN DMP1 (Fragment) OS=Balaenoptera ...bonaerens... 37 0.66 tr|B1ACS5|B1ACS5_BALED DMP1 (Fragment) OS=Balaenoptera edeni... GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3..._BALMU DMP1 (Fragment) OS=Balaenoptera musculus ... 37 0.86 tr|B1ACS1|B1ACS1_MEGNO DMP1 (Fragment) OS=Megapt...1ACS2_BALPH DMP1 (Fragment) OS=Balaenoptera physalus ... 37 1.1 tr|B1ACT6|B1ACT6_MESPE DMP1 (Fragment) OS=Me

  15. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division


    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  16. AC1 Wing

    Directory of Open Access Journals (Sweden)

    Adrian DOBRE


    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  17. AC1 Wing


    Adrian DOBRE


    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  18. State of the Art analysis for the 'SolcelleInverter' project. Optimised design and control of inverter for photovoltaic systems: the AC-module

    Energy Technology Data Exchange (ETDEWEB)

    Baekhoej Kjaer, S.


    The 'SolcelleInverter' project starts with this state-of-the-art analysis of 27 different inverter topologies for use in photovoltaic applications. The main concern is the present status for inverters for single solar modules. Technologies for larger clusters of modules are also investigated. The possibility of combining a small decentralised and a big centralised unit is as well investigated. A series of topologies are discovered and this paper will present them. That includes solutions with and without transformers, systems for one or multiple modules, commercial solutions and solutions found in scientific papers and patents. (au)

  19. ac bidirectional motor controller (United States)

    Schreiner, K.


    Test data are presented and the design of a high-efficiency motor/generator controller at NASA-Lewis for use with the Space Station power system testbed is described. The bidirectional motor driver is a 20 kHz to variable frequency three-phase ac converter that operates from the high-frequency ac bus being designed for the Space Station. A zero-voltage-switching pulse-density-modulation technique is used in the converter to shape the low-frequency output waveform.

  20. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB


    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  1. AC/RF Superconductivity


    Ciovati, G.


    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  2. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  3. Hermetisk AC-Krets


    Hirsch, Carl; Smirnoff, Alexander


    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  4. Switching Tests of Energized GIS Disconnectors in UHV AC Pilot Demonstration Project%特高压交流试验示范工程GIS隔离开关带电操作试验

    Institute of Scientific and Technical Information of China (English)

    李志兵; 陈维江; 王浩; 孙岗; 张翠霞; 刘洪涛; 马国明; 岳功昌; 胡榕; 时卫东; 孙泽来; 张建功


    In order to verify the safety of switching of gas insulated switchgear (GIS) disconnectors energized in ultra high voltage(UHV) AC Pilot Demonstration Project, we experimentally investigated switching of all GIS disconnectors energized in Changzhi, Nanyang, and Jingmen substations, and monitored very fast transient overvoltage (VFTO) and transient enclosure voltage (TEV) generated . The tests results show that switching of UHV GIS disconnectors energized is safe, the effect of TEV on secondary equipment should be paid attention to, and damping resistor in disconnector can mitigate VFTO and TEV significantly, The tests provide technical support for the future switching of GIS disconnector energized in UHV substations.%为验证我国特高压交流试验示范工程金属封闭开关设备(gas insulated switchgear,GIS)中隔离开关带电操作的安全性,在长治、南阳和荆门变电站对所有特高压GIS隔离开关进行了带电操作试验。在前期特高压GIS和复合型气体绝缘金属封闭开关设备(hypid gas insulated switchgear,HGIS)中特快速瞬态过电压(very fast transi-ent overvoltage,VFTO)实测研究基础上,开展现场典型运行方式下隔离开关带电操作,监测产生的VFTO和暂态壳体电位(transient enclosure voltage,TEV)。试验初步得出了特高压变电站实际VFTO和TEV水平及分布,结果表明:特高压GIS隔离开关的带电操作是安全的,但应注意产生的TEV对二次设备的影响,阻尼电阻能够有效抑制VFTO和TEV。带电操作试验的开展为今后特高压GIS隔离开关的带电操作提供了依据。

  5. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar


    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  6. Superconducting ac cable

    International Nuclear Information System (INIS)

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.)

  7. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.


    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and The objective of the project is to investigate the accuracy of most up to date...... cable models, perform highly accurate field measurements for validating the model and identifying possible disadvantages of the cable model. Furthermore the project suggests and implements improvements and validates them against several field measurements. It is shown in this paper how a new method for...... calculating the frequency dependent cables impedance greatly improves the modeling procedure and gives a highly accurate result for high frequency simulations....

  8. Ac Hybrid Charge Controller

    Directory of Open Access Journals (Sweden)

    Shalini S. Durgam


    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  9. AcEST: BP920072 [AcEST

    Lifescience Database Archive (English)


  10. Induction Motor Control through AC/DC/AC Converters


    Elfadili, Abderrahim; Giri, Fouad; Ouadi, Hamid; El Magri, Abdelmounime; Dugard, Luc; Abouloifa, Abdelmajid


    We consider the problem of controlling inductions motors driven through AC/DC rectifiers and DC/AC inverters. The control objectives are threefold: (i) forcing the motor speed to track a reference signal, (ii) regulating the DC Link voltage, (iii) assuring a satisfactory power factor correction (PFC) with respect to the power supply net. First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a nonlinear multi-loop controller is synthesized using th...

  11. AcEST: BP920905 [AcEST

    Lifescience Database Archive (English)


  12. AcEST: DK950147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0007_O05 706 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_O05. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  13. AcEST: DK959344 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0004_G23 714 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_G23. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  14. AcEST: DK949716 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0006_L20 613 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_L20. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  15. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Energy Technology Data Exchange (ETDEWEB)

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))


    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  16. AcTA: Accessdatabase Telen met toekomst - Alterra


    Smit, A.; Zwart, K.B.


    Binnen het project Telen met toekomst wordt een groot aantal metingen verricht, die op een overzichtelijke manier moeten worden opgeslagen. Er is gekozen voor en relationele database in MS-Access. De database zal AcTA worden genoemd (Access-database voor Telen met toekomst Alterra). Dit rapport bevat de beschrijving van de structuur van de database.

  17. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV......) levels are still not seen as possibility, the future expansion of transmission grids are dependent on new solutions with lessened environment impact, especially with regard to the visual impact. In the present Thesis, composite materials and composite based overhead line components are presented and...... analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  18. AcEST: DK955197 [AcEST

    Lifescience Database Archive (English)


  19. AcEST: BP915640 [AcEST

    Lifescience Database Archive (English)


  20. Reliability of emergency ac power systems at nuclear power plants

    International Nuclear Information System (INIS)

    Reliability of emergency onsite ac power systems at nuclear power plants has been questioned within the Nuclear Regulatory Commission (NRC) because of the number of diesel generator failures reported by nuclear plant licensees and the reactor core damage that could result from diesel failure during an emergency. This report contains the results of a reliability analysis of the onsite ac power system, and it uses the results of a separate analysis of offsite power systems to calculate the expected frequency of station blackout. Included is a design and operating experience review. Eighteen plants representative of typical onsite ac power systems and ten generic designs were selected to be modeled by fault trees. Operating experience data were collected from the NRC files and from nuclear plant licensee responses to a questionnaire sent out for this project

  1. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar


    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  2. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R


    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  3. Case Studies and Codes of Ethics: The Relevance of the ACS Experience to ALIA (United States)

    Ferguson, Stuart; Salmond, Rachel; Al-Saggaf, Yeslam; Bowern, Mike; Weckert, John


    This paper comments on a recent "Code of Ethics" project conducted on behalf of the Australian Computer Society, and proposes a similar project for the Australian Library and Information Association (ALIA). It reviews the scope and methodology of the project, which developed a comprehensive set of case studies and related them to the ACS "Code of…

  4. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O


    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  5. AcEST: BP920800 [AcEST

    Lifescience Database Archive (English)


  6. AcEST: DK945549 [AcEST

    Lifescience Database Archive (English)


  7. AcEST: BP917632 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000103_D10 554 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D10. BP917632 - Show ... YSKCKIHQKALELLVLML 154 Query: 466 KDSLEPDEVTYLNVLKACARE EDLKV 543 +D++ P+ TY +VL++C D+++ Sbjct: 155 RDNVRPN ... 185 Query: 415 GHSDSS--KEALKLLTQMRKDSLEPDEVTYLNVLKACARE EDLK 540 + EA KL +M+ ++ PDE+ N++ AC R +++ Sbjct: 18 ...

  8. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  9. AcEST: DK946687 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0013_G11 544 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_G11. 5' end seq ... + G P+ TY+ + AC+ E Sbjct: 97 YSFNYMIRGLTNTWN-------DHEA ---ALSLYRRMKFSGLKPDKFTYNFVFIACAKLE 146 Query: 214 A ... Sbjct: 71 LIPKAVELGDFNYSSFLFSVTEEPNHYSFNYMIRGLTNTWNDHEA ALSLYRRMKFSGLKP 130 Query: 469 DGATFSCVLRACGNVGALDV ...

  10. AcEST: DK949372 [AcEST

    Lifescience Database Archive (English)


  11. Evaluating conversion of AC power transmission lines to DC

    Energy Technology Data Exchange (ETDEWEB)

    Edris, A. [EPRI, Palo Alto, CA (United States); Barthold, L. [IMod Inc., Lafayette, LA (United States); Douglass, D. [Power Delivery Consultants, Ballston Lake, NY (United States); Litzenberger, W. [Litzenberger Consultant (United States); Woodford, D. [Electranix, Winnipeg, MB (Canada)


    Conversion of alternating current (AC) transmission lines has been of significant interest for several years but has never been implemented to expand transmission line capacity or improve system security. This paper outlined the procedures necessary to identify and assess feasibility of specific AC to direct current (DC) conversion opportunities, with special focus on emerging DC transmission technologies. The paper outlined the process for investigating the conversion of an AC transmission line to DC. The investigation examined both bipole and tripole applications. A summary of the characteristics for alternative DC conversion configuration was presented. These characteristics included maximum transfer capability; redundancy; losses; overhead ratio; switching requirements; reactive power requirement; and accommodation of taps. The challenges and objectives of the project were also described. The paper provided a summary of the cost and benefit analysis for the various AC to DC conversion technologies for the Grand Coulee to Olympia transmission line. It was concluded that the project was particularly timely in that current work on the prospect of major North American system segmentation could benefit substantially, both technically and economically by having inter-system links take fuller advantage of the inherent DC capability of the circuits involved, thereby encouraging greater inter-regional energy exchange and providing the basis for lower energy supply costs. 12 refs., 2 tabs., 3 figs., 1 appendix.

  12. Energy saving in ac generators (United States)

    Nola, F. J.


    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  13. Apuntes de Acústica


    Martín Domingo, Agustín


    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  14. SSTI Clark ACS Technology Demonstrations


    Freesland, Douglas


    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  15. AcEST: DK950895 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |A7SFA3|A7SFA3_NEMVE Predicted protein OS=Nematostella vectens... 210 5e-53 tr|Q0CVA9|Q0CVA9_ASPTN ATP-citrate synthase subunit...stX Result : Swiss-Prot sp_hit_id Q54YA0 Definition sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos...PIDYSWAQELGLIRKPAAFISTI 404 >sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora cras...IRKPASFMTSI 844 >sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe G....done Score E Sequences producing significant alignments: (bits) Value sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos

  16. AcEST: BP914304 [AcEST

    Lifescience Database Archive (English)


  17. AcEST: BP911793 [AcEST

    Lifescience Database Archive (English)


  18. AcEST: BP921649 [AcEST

    Lifescience Database Archive (English)


  19. AcEST: BP919669 [AcEST

    Lifescience Database Archive (English)


  20. AcEST: DK957916 [AcEST

    Lifescience Database Archive (English)


  1. AcEST: DK956923 [AcEST

    Lifescience Database Archive (English)


  2. AcEST: BP921492 [AcEST

    Lifescience Database Archive (English)


  3. DC System Control Strategy for 500 kV AC Line Automatic Reclosing in China-Russia Back to Back Project%中国—俄罗斯背靠背联网工程500 kV交流出线具有自动重合闸的直流控制策略

    Institute of Scientific and Technical Information of China (English)

    马为民; 曹燕明; 蒋维勇


    为提高中俄直流联网黑河换流站跨国联网工程运行的可靠性,提出了修改故障期间直流控制策略的方案,以使工程原设计方案中未设置的自动重合闸功能恢复使用.采用EMTDC仿真软件建立模型进行典型工况计算,并对重合闸期间产生的交流母线过电压、交流母线避雷器和阀避雷器的耐受能力进行了校核比较.仿真结果表明,新的控制策略应限制故障期间功率水平在300 MW(标幺值为0.4)以内.修改后的控制策略在黑河换流站实施后,通过兴福变至黑河变(兴黑线)故障后重合闸的实践检验,证明了策略的可行性和可靠性.所得出的直流控制策略对研究弱交流系统条件下换流站仅有1回交流出线时采用自动重合闸功能有重要指导意义.%To improve the operation reliability of Heihe converter station at China-Russia back to back(BTB) project,we proposed a modified DC system control strategy during line faults in order to recover the automatic reclosing function,which was not adopted in original design of the project.Models of the software EMTDC were used to simulate typical cases,through which the AC bus's over-voltage and the arrester energy of AC bus arrester and valve arrester during faults were compared and checked.The simulation results show that,from the new strategy,the power at the level of 300 MW (0.4 in per unit value) should be limited during a line fault.Feasibility and reliability of the modified control strategy have been proved by the successful reclosing in HeiHe station with the proposed strategy implemented under a failure on Xingfu Station to Heihe Station(Xinghei line) section.Thus the proposed DC control strategy is proven to be of great significance for studying the adopting automatic reclosing function in future converter station with only one AC line under weak AC system condition.

  4. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)


    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  5. Simultaneous distribution of AC and DC power (United States)

    Polese, Luigi Gentile


    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  6. AcEST: DK948526 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0003_I19 675 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_I19. 5' end seq ... IAMVRTTTPVYV 214 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 215 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 254 >sp|Q09138|AAKG1_PIG 5'-AMP-acti ... IAMVRTTTPVYV 215 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 216 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 255 >sp|O54950|AAKG1_MOUSE 5'-AMP-ac ...

  7. AcEST: DK962916 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0015_C06 596 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_C06. 5' end seq ... NA. clone: TST39A01NGRL0015_C06. 5' end sequence. Acce ssion DK962916 Tissue type prothallia with plantlet ... 2 Query: 317 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 335 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 326 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 454 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  8. AcEST: DK955705 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0023_N02 635 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_N02. 5' end seq ... NA. clone: TST39A01NGRL0023_N02. 5' end sequence. Acce ssion DK955705 Tissue type prothallia with plantlet ... 2 Query: 296 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 314 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 305 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 433 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  9. AcEST: DK961330 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FWVPCMHTPIKQEKHTHA 405 +AR P W +++PI+ ++C++ P + AK+ PL DVTH+F+V + +QE Sbjct: 61 VARRTRP-SWHEDNPINYVQCDISDPDD...+IL +D PGGPWKVYG Sbjct: 4 WWAGAIGAAKKKLEEDDAPPKHS---SVALIVGVTGIIGNSLAEILPLADTPGGP...AWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTCANR--STEPENCE 117 Query: 406 MATHMFENIIGVLLTHAPNLQHVCMQTSDKHY-... : Swiss-Prot sp_hit_id Q7MXT7 Definition sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac...lue sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-... 34 0.62 sp|P60369|KR103_HUMAN Kerati

  10. AcEST: BP913772 [AcEST

    Lifescience Database Archive (English)


  11. AcEST: DK952954 [AcEST

    Lifescience Database Archive (English)


  12. AcEST: BP912540 [AcEST

    Lifescience Database Archive (English)


  13. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques


    Rakan Kh Antar


       This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time fo...

  14. Blades and discs in gas turbines. Behaviour of material and components. Project department A-C. Final report; Schaufeln und Scheiben in Gasturbinen. Werkstoff- und Bauteilverhalten. Projektbereiche A bis C. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)



    The special research area 339 `Blades and discs in gas turbines, behaviour of material and components` was carried on from 1988 to the end of 1196. This final report deals with the work in the years 1994, 1995 and 1996. In the project area A `Development of material` manufacturing processes both for metallic and ceramic high temperature materials were developed, tested and optimised. In the area of optimising casting structure, it was shown that the making grains finer up to the medium temperature range can be a suitable means for significantly raising the resistance to LCF loading with nearly unchanged heat and creep strength properties. Another main point was the characterisation and optimisation of sprayed ceramic layers on metallic substrates (heat insulating layers) and compound ceramic materials. In project area B `Material behaviour` the mechanisms were studied, which, particularly in metallic high temperature materials such as nickel-based superalloys, lead to failure of the material under thermo-mechanical stresses. In project area C `Component design`, on the one hand models for estimating service life for metallic high temperature materials under different thermo-mechanical stresses were developed. [Deutsch] Der Sonderforschungsbereich 339, `Schaufeln und Scheiben in Gasturbinen - Werkstoff- und Bauteilverhalten` wurde von 1988 bis Ende 1996 gefoerdert. Dieser Abschlussbericht behandelt die Arbeiten der Jahre 1994, 1995 und 1996. Im Projektbereich A `Werkstoffentwicklung` wurden Herstellungsverfahren sowohl fuer metallische als auch fuer keramische Hochtemperaturwerkstoffe entwickelt, erprobt und optimiert. Auf dem Gebiet der Gussgefuegeoptimierung konnte gezeigt werden, dass die Kornfeinung bis in den mittleren Temperaturbereich ein geeignetes Mittel sein kann, um den Widerstand gegen LCF-Belastung bei annaehernd unveraenderten Warm- und Kriechfestigkeitseigenschaften signifikant zu erhoehen. Einen weiteren Schwerpunkt bildete die Charakterisierung und

  15. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas


    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  16. Short term dynamic aperture with AC dipoles

    CERN Document Server

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department


    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  17. AC drive control system design in Guofeng 1 450 mm hot strip mill project%国丰1450热连轧交流传动系统设计

    Institute of Scientific and Technical Information of China (English)

    粟欣; 杨溪林; 刘朝锋; 李光威; 张栋


    唐山国丰钢铁有限公司1450热连轧2^#生产线主传动均采用交交变频控制方式,其主传动电动机均为大功率凸极交流同步电动机,采用全数字交交变频矢量控制的交流调速装置。每套交交变频装置由3台电网自然换流无环流可逆变流器、整流变压器、励磁主回路及矢量控制调速系统组成;控制回路采用Siemens的TDC和Simadyn D相结合的控制模式,既保证了控制系统的可靠性和快速性,同时也极大提高了系统扩展性,方便了与其他生产设备的连接。此外多个TDC组成的GDM网络也为全线重要控制系统软硬件的整合和统一管理提供了平台。系统投入使用以来,主传动控制系统故障率低、维护量小、运行平稳可靠,各项传动系统性能指标均达到设计目标,对同类配置主传动解决方案具有一定的指导借鉴意义。%In the project of Guofeng Iron & Steel Co., Ltd. 1 450 mm hot strip mill, a new cycloconverter system based on vector control is applied to the main drive controlling for each synchronous motor. Cycloconverter system consists of power units and control unit. The power units are composed of 3 thyristor converters for the 3 phases of the motor stator, transformer, the excitation circuit, and some other auxiliary devices. The control unit is constituted with Simadyn D (SD) and TDC digital controller. The integration of the TDC and SD improves the reliability, running speed and expansibility of the control system. In addition, the GDM bus supplied by TDC controllers for different functions, provides a unified software and hardware platform for different solutions and managements in the project. Since applied with this new integration as the control unit, the main drive systems have achieved all the designing goals and performed quite steady and reliable. Besides, the system' s trouble shooting time has greatly decreased. Due to the advantages of this new

  18. ac electroosmosis in rectangular microchannels. (United States)

    Campisi, Michele; Accoto, Dino; Dario, Paolo


    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310


    Directory of Open Access Journals (Sweden)

    Alfredo Aguilar Valdés


    Full Text Available El objetivo de este trabajo fue analizar el diagnostico situacional de una Empresa de Servicios Profesionales en el caso de: Instituto de Promoción Para el Desarrollo Rural A.C., a través de la Metodología “UALAE” así como la oportunidad que como empresa presenta. Este estudio se realizó en el municipio de Saltillo, Coahuila, México. Adoptó esta Metodología UALAE y se difundió su opinión. El Instituto de Promoción Para el Desarrollo Rural A.C., está formado por profesionistas y productores cuya finalidad es la de contribuir al desarrollo del medio rural con proyectos de viabilidad técnica, económica y social, sobre la base de necesidades reales y al aprovechamiento sustentable del potencial de los recursos naturales. Su buen funcionamiento es indispensable e importante para el desarrollo de los productores agropecuarios principalmente, debido a que se ven muy beneficiados con todos los servicios que se les brinda, se han logrado buenos proyectos, buenas capacitaciones y un gran crecimiento de sus productos. Mediante el proceso de asistencia técnica a organizaciones de productores, se induce la formulación adecuada de proyectos viables desde el punto visto del mercado, la rentabilidad económica, las tecnologías disponibles y de la organización social.

  20. AcEST: BP920845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 45|Adiantum capillus-veneris mRNA, clone: YMU001_000142_D08. (514 letters) Database: uniprot_sprot.fasta 412,525 seq...P7 OS=Magnapor... 33 1.0 sp|Q7VF68|SYH_HELHP Histidyl-tRNA synthetase OS=Helicobacter hep... 31 3.8 sp|P1305...90 FTGFLVLHSEPRQQPQVDL 1608 >sp|A4QX49|DBP7_MAGGR ATP-dependent RNA helicase DBP7 OS=Magnaporthe grise...T PT VT+H + T+ AC+ A+TT+ H H Sbjct: 481 PPKETKPTK------PVTNHTESTVGKACYITSAANTTITLHKLH 519 >sp|Q7VF68|SYH_HELHP His...rot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searching.................................

  1. AcEST: DK960083 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ome P450 71D7 OS=Solanum chacoense ... 96 1e-19 sp|Q9SAB6|C71AI_ARATH Cytochrome ...... 96 2e-19 sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense ... 94 5e-19 sp|Q9T0K2|C71AK_AR... paten... 176 1e-42 tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii... 176 2e-42 tr|Q40907|Q40907_POPKI Cinnamic ac...8 KVVQQSRGAWEDEALRVIQDLKA 160 >tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii GN=C4H PE=2 ...e-42 tr|A9PBZ7|A9PBZ7_POPTR Putative uncharacterized protein OS=Popul... 176 2e-4

  2. AcEST: DK955376 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0022_O23 611 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_O23. 5' end seq ... LMDETRAAGIKL 210 Query: 602 AIC 610 A+C Sbjct: 211 AVC ... 213 >tr|A9SM81|A9SM81_PHYPA Predicted protein OS=P ... C 610 VLELMD A+ KGLKVA+C Sbjct: 196 VLELMDAAREKGLKVAVC ... 213 >tr|Q8L7U1|Q8L7U1_ARATH AT4g39970/T5J17_140 OS ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q680K2|Q680K2_ARATH MRNA, complete cds, cl ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q8LAS1|Q8LAS1_ARATH Putative uncharacteriz ...

  3. AcEST: BP913416 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GCATGTAGTTTGGA CAGAGATG ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swi...AC_BACFN Uronate isomerase OS=Bacteroides fragilis (... 30 4.5 sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...C++ N IP+ M C Sbjct: 417 LSYPRHEYFRRTLCNLLGCDVENGEIPLSEMERVC 451 >sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database searc...148,809,765 total letters Searching..................................................done Score E Sequences

  4. AcEST: DK947388 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac...ids Res. 25:3389-3402. Query= DK947388|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Databa... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947388|Adiantum c...apillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Database: uniprot_trembl.fasta...-ribosylation factor 1 OS=Salix bakko GN... 268 1e-71 sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea may

  5. AcEST: BP916217 [AcEST

    Lifescience Database Archive (English)

    Full Text Available inase kinase 7-interacting protein 3 OS=Mus musculus Align length 119 Score (bit) 35.0 E-value 0.16 Report B...visiae GN... 30 6.8 >sp|Q571K4|TAB3_MOUSE Mitogen-activated protein kinase kinase kinase 7-interacting protein 3 OS=Mus musculus...protein kinase kinase kinase 7 interacting protein 3 OS=Mus musculus GN=Map3k7ip3 PE=2 SV=1 Length = 716 Sco...(3)malignant brain tumor-like 2 prot... 31 2.3 sp|P33234|ADIY_ECOLI HTH-type transcriptional regulator adiY ...ZZC3_PSEU2 Membrane protein, putative OS=Pseudomonas... 35 2.5 tr|Q5U7D5|Q5U7D5_9BACI OpuAC OS=Halobacillus trueperi GN=opu

  6. AcEST: DK953324 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |LSRR_PHOLL Transcriptional regulator lsrR OS=Photorhab... 30 6.1 sp|A0JY64|ATPB_ARTS2 ATP synthase subunit beta OS=Arthroba...cter s... 30 6.1 sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...ATP synthase subunit beta OS=Arthrobacter sp. (strain FB24) GN=atpD PE=3 SV=1 Len...KD 372 Query: 311 HLHFTHRGKQRL 346 H + R KQ L Sbjct: 373 HYNTAVRVKQIL 384 >sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  7. AcEST: DK945049 [AcEST

    Lifescience Database Archive (English)

    Full Text Available R 148 >sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=ac...|Q4EPP8|Q4EPP8_LISMO Heavy metal-binding protein OS=Listeria m... 34 3.2 tr|A6AST1|A6AST1_VIBHA Copper-trans..... 31 2.7 sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Asper... 30 4.5 sp|A2VDJ0|T131L_HUMAN Transmembran...P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti Align length 75 Score (bit) 34.7 E-val...sophila ... 30 7.8 >sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium me

  8. Efficient Lightweight AC-AC Power Control for Solar UAV Project (United States)

    National Aeronautics and Space Administration — A highly efficient and lightweight dual bridge matrix power controller development is proposed that will provide high performance to a solar powered high altitude...



    M.A INAYATHULLAAH,; Dr. R. Anita


    The proposed topology reduces the total harmonic distortion (THD) of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with ...

  10. Advanced reliability improvement of AC-modules (ARIA)

    International Nuclear Information System (INIS)

    are fully or partially shaded. Alpha Real has conducted considerable testing of shading and temperature rises of up to 180C have been observed. Such a temperature rise will influence the lifetime and reliability of the module, and it is therefore common practice to protect modules from these conditions by using by-pass diodes. Having now an active element on the back of the module, such as a module integrated inverter, new possibilities are offered for new concepts for hot-spot prevention. The main conclusions of the ARIA project are: Both the AC module inverters, Sunmaster 130S and Edisun E230721G, withstood the electrical immunity tests successfully; The Sunmaster 130S passed the accelerated reliability tests with good results; The Edisun E230721G passed the temperature cycling test and a humidity-freezing test; The ANIT s.r.l. ARIA modules met all requirements of the CEI/IEC 61215 standard; The voltage comparison method is a most promising principle for hot spot detection. It is implemented into both the Solcolino E230721G and the Sunmaster 130S. The costs for a 200W module are about $1. to $2.5, where the costs for by-pass diodes are $4 to $15; Measurements at different locations in three countries have shown that the new Hot Spot Detector (HSD) by comparing the voltages operates. Computer simulations show that if the current through the shaded cell is less than or equal to the current generated by the shaded cell, the shaded cell will not become reverse biased. 10 refs

  11. Characterization of AcMNPV with a deletion of ac69 gene

    Directory of Open Access Journals (Sweden)

    Jianhao Ke


    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  12. Noise reduction in AC-coupled amplifiers


    Serrano Finetti, Roberto Ernesto; Pallàs Areny, Ramon


    AC-coupled amplifiers are noisier than dc-coupled amplifiers because of the thermal noise of the resistor(s) in the ac-coupling network and the increased contribution of the amplifier input noise current i(n). Both contributions, however, diminish if the corner frequency f(c) of the high-pass filter observed by the signal is lowered, the cost being a longer transient response. At the same time, the presence of large resistors in the ac-coupling network suggests that the use of FET-input ampli...

  13. Ac loss characteristics of YBCO superconducting tapes fabricated by TFA-MOD technique

    International Nuclear Information System (INIS)

    We investigated the ac loss properties of a YBCO superconducting tape fabricated by TFA-MOD technique. The thickness of the YBCO layer is 1.2 μm. A 6-tape stack of 50 mm in length and 10 mm in width was inserted into a saddle-shaped pickup coil. The ac loss was measured at 35-77 K by applying an external ac magnetic field. The magnetic field angle was changed by rotating the sample stack around its longitudinal axis. The effective penetration field, which corresponds to the breaking point of an ac loss curve, decreased with increasing field angle though it was much smaller than that which was estimated for a superconducting slab with the same thickness as the width of a tape. As a result, the ac loss increased monotonically with an increasing field angle against the wide surface for any amplitude. The observed field angular dependence of the ac loss agreed with the theoretically predicted one by using the observed ac losses in perpendicular magnetic field. Anyway the ac loss for a larger amplitude than the effective penetration field was proportional to the critical current density and the projective width of a tape in the direction of the applied magnetic field for any field angle and any temperature as well known. In addition we estimated the magnetic field, B, dependence of the critical current, I c, from the observed magnetization curves. It was shown that zero-field I c appeared to be a linear function of temperature and I c-B characteristics was scaled with zero-field I c. We also discussed a difference in I c-B characteristics and its temperature dependence between TFA-MOD tapes and IBAD-PLD ones

  14. Ac loss characteristics of YBCO superconducting tapes fabricated by TFA-MOD technique (United States)

    Iwakuma, Masataka; Nigo, Masahiro; Inoue, Daisuke; Miyamoto, Naoya; Kiss, Takanobu; Funaki, Kazuo; Iijima, Yasuhiro; Saitoh, Takashi; Izumi, Teruo; Yamada, Yutaka; Shiohara, Yuu


    We investigated the ac loss properties of a YBCO superconducting tape fabricated by TFA-MOD technique. The thickness of the YBCO layer is 1.2 μm. A 6-tape stack of 50 mm in length and 10 mm in width was inserted into a saddle-shaped pickup coil. The ac loss was measured at 35-77 K by applying an external ac magnetic field. The magnetic field angle was changed by rotating the sample stack around its longitudinal axis. The effective penetration field, which corresponds to the breaking point of an ac loss curve, decreased with increasing field angle though it was much smaller than that which was estimated for a superconducting slab with the same thickness as the width of a tape. As a result, the ac loss increased monotonically with an increasing field angle against the wide surface for any amplitude. The observed field angular dependence of the ac loss agreed with the theoretically predicted one by using the observed ac losses in perpendicular magnetic field. Anyway the ac loss for a larger amplitude than the effective penetration field was proportional to the critical current density and the projective width of a tape in the direction of the applied magnetic field for any field angle and any temperature as well known. In addition we estimated the magnetic field, B, dependence of the critical current, Ic, from the observed magnetization curves. It was shown that zero-field Ic appeared to be a linear function of temperature and Ic-B characteristics was scaled with zero-field Ic. We also discussed a difference in Ic-B characteristics and its temperature dependence between TFA-MOD tapes and IBAD-PLD ones.

  15. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    International Nuclear Information System (INIS)

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  16. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Directory of Open Access Journals (Sweden)

    Ibekwe B.E


    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  17. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System


    Marian GAICEANU; Emil ROSU


    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  18. Transport AC losses in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)


    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  19. Engineering Design of the ITER AC/DC Power Supplies

    International Nuclear Information System (INIS)

    To design high power pulse power supplies, especially in huge power supplies have not designed till now, it is necessary to analyze a system's characteristics and relations with another systems as well as to know high voltage, high current control technologies. Contents of this project are; - Study for the engineering designs changed recently by ITER Organization(IO) and writing specifications for the power supplies to reduce project risk. - Detailed analysis of the AC/DC Converters and writing subtask reports on the Task Agreement. - Study for thyristor numbers, DCR's specifications for Korea-China sharing meetings. - Study for the grounding systems of the ITER power supply system. The results may used as one of reference for practical designs of the high power coil power supplies and also may used in various field such as electroplating, plasma arc furnaces, electric furnaces

  20. Cost effective second generation AC-modules: Development and testing aspects

    International Nuclear Information System (INIS)

    In the framework of the European research project PV2GO, a new AC-module inverter was developed, taking into account all relevant aspects from a European market's point of view (standards, market, application, and research and development goals). The project goal was to achieve the overall system costs of 3 Euro per Wp for a modular plug-and-play photovoltaic system. For the photovoltaic-module, a standard 130-Wp Eurosolare module was chosen. The research and development (R and D) goal was to develop an advanced DC-control system consisting of a state-of-the-art programmable digital device and an Application Specific Integrated Circuit (ASIC) for the AC-control of the inverter. According to the topology concept, thermal and magnetic designs were optimized with regard to production technology and packaging for large-scale production. The new AC-modules were tested in a number of field-test sites in various parts of Europe and their reliability was assessed through Highly Accelerated Stress Tests. Efficiency and power quality have been tested in the laboratory. Further in the PV2GO project an optimization study of the manufacturing process of the new generation of AC-modules for high volume output was done. Another task was the pre-certification procedure to assure compliance with the European guidelines and standards

  1. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.


    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  2. AC losses in filamentary YBCO/hastelloy

    International Nuclear Information System (INIS)

    Full text: The AC hysteresis loss of a long YBCO thin-film superconducting strip in a perpendicular AC magnetic field can be reduced by subdividing the film into narrow parallel strips (filaments). The hysteresis loss depends on the film critical current density Jc, the film thickness d, the filament width 2a and the lateral spacing L between filaments as well as on the AC magnetic field amplitude Hm. In addition, if the film is deposited onto a YSZ/hastelloy substrate to form a flexible tape, eddy current loss occurs in the hastelloy metal. The eddy current loss depends on the resistivity p of the hastelloy, the width 2w and thickness dm of the hastelloy substrate as well as on the frequency f and amplitude Hm. We have calculated the hysteresis and eddy current losses as a function of Jc, d, 2a, L, p, w, dm, f, and Hm to find optimal design parameters for a YBCO/hastelloy tape. As the AC loss is related to the loss component X'' of the AC susceptibility, we have measured X'' at different frequencies f and amplitudes Hm for several filamentary designs of YBCO/hastelloy tapes and compared our experimental results with our model calculations

  3. Low AC Loss YBCO Coated Conductor Geometry by Direct Inkjet Printing

    Energy Technology Data Exchange (ETDEWEB)

    Rupich, Martin, Dr. [American Superconductor Corporation; Duckworth, Robert, Dr. [Oak Ridge National Laboratory


    The second generation (2G) high temperature superconductors (HTS) wire offers potential benefits for many electric power applications, including ones requiring filamentized conductors with low ac loss, such as transformers and fault current limiters. However, the use of 2G wire in these applications requires the development of both novel multi-filamentary conductor designs with lower ac losses and the development of advanced manufacturing technologies that enable the low-cost manufacturing of these filamentized architectures. This Phase I SBIR project focused on testing inkjet printing as a potential low-cost, roll-to-roll manufacturing technique to fabricate potential low ac loss filamentized architectures directly on the 2G template strips.

  4. ACS production: optimal design of solar thermal power plants; Produccion de ACS. Optimizacion del dimensionado de instalaciones de energia solar termica

    Energy Technology Data Exchange (ETDEWEB)

    Platon Arias, L.; San Jose Alonso, F.


    The aim of this project is to develop a program to size solar thermal power plants for the production of the company ACS, which enable optimum value calculations of the different influence parameters (surface, inclination, orientation, energy input) advising diverse circumstances and requirements. The energy input calculation has been effected according to f-chart method. For the solar radiation on inclined and oriented surfaces calculation, has been applied the Klein Method. (Author) 14 refs.

  5. AC loss performance of CS insert coil

    International Nuclear Information System (INIS)

    The ITER Central Solenoid (CS) model coil and the CS insert coil were fabricated, and the test was carried out. The AC loss measurement of the coil is one of the most important tests to determine coil performance. The AC loss of a short sample conductor for the CS insert coil was measured by using the calorimetric method, and the coupling time constants of the conductor were estimated to be 30 ms and 20 ms for pulse and discharge tests, respectively. The AC loss of the CS insert coil was measured by using the calorimetric method for pulse and discharge tests. The coupling time constant estimated from the result of the pulse tests was 34 ms and almost equal to that of the short sample. The coupling time constant for the discharge test was estimated to be 140 ms and about 4 times that of the pulse test. (author)

  6. ac propulsion system for an electric vehicle (United States)

    Geppert, S.


    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  7. AC loss in superconducting tapes and cables (United States)

    Oomen, Marijn Pieter

    High-temperature superconductors are developed for use in power-transmission cables, transformers and motors. The alternating magnetic field in these devices causes AC loss, which is a critical factor in the design. The study focuses on multi-filament Bi-2223/Ag tapes exposed to a 50-Hz magnetic field at 77 K. The AC loss is measured with magnetic, electric and calorimetric methods. The results are compared to theoretical predictions based mainly on the Critical-State Model. The loss in high- temperature superconductors is affected by their characteristic properties: increased flux creep, high aspect ratio and inhomogeneties. Filament intergrowths and a low matrix resistivity cause a high coupling-current loss especially when the filaments are fully coupled. When the wide side of the tape is parallel to the external magnetic field, the filaments are decoupled by twisting. In a perpendicular field the filaments can be decoupled only by combining a short twist pitch with a transverse resistivity much higher than that of silver. The arrangement of the inner filaments determines the transverse resistivity. Ceramic barriers around the filaments cause partial decoupling in perpendicular magnetic fields at power frequencies. The resultant decrease in AC loss is greater than the accompanying decrease in critical current. With direct transport current in alternating magnetic field, the transport-current loss is well described with a new model for the dynamic resistance. The Critical- State Model describes well the magnetisation and total AC loss in parallel magnetic fields, at transport currents up to 0.7 times the critical current. When tapes are stacked face-to-face in a winding, the AC-loss density in perpendicular fields is greatly decreased due to the mutual shielding of the tapes. Coupling currents between the tapes in a cable cause an extra AC loss, which is reduced by a careful cable design. The total AC loss in complex devices with many tapes is generally well

  8. ACS air bearing test-bed design


    Glitt, Sascha


    This thesis is about the construction and design of a new air bearing test-bed to verify the programmed ACS attitude control algorithm and to validate the ACS MATLAB/SimuLink¬ model of NPSAT1, the second small satellite currently under development at the Naval Postgraduate School Space Systems Academic Group. The software was already verified and validated using a comparable air bearing test-bed. But due to changes in hardware from commercial magnetic torque rods to custom, NPS-built, magneti...

  9. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing


    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  10. Design and development of the EGRET-ACS (Energetic Gamma Ray Telescope Anticoincidence Subsystem) for the GRO (Gamma Ray Observatory)

    International Nuclear Information System (INIS)

    According to the above mentioned contract under appointment of the DFVLR and in cooperation with MPE, MBB has developed and manufactured the EGRET-ACS to guarantee the best effort of the GSFC spark-chamber. The MBB part of the ACS was the development and manufacturing of the structure and the Veto-Dome. The ACE (Anticoincidence Electronic) was DFVLR provided hardware and has been integrated and tested at MBB. The ACE will not be part of this final report. It has been demonstrated in manifold tests that the existing ACS complies with the experiment requirements and has been handed over to NASA at GSFC after a successful final acceptance test. Due to excellent cooperation with the customer (DFVLR) and the experimentator (MPE) it was obtained that delays in the project-schedule have been avoided with regard to the ACS-structure and the DFVLR provided hardware. With 2 refs., 4 tabs., 48 figs

  11. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S


    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)


    Directory of Open Access Journals (Sweden)



    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  13. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769. (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming


    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx. PMID:26672449

  14. AC power generation from microbial fuel cells (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason


    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  15. Performance of Halbach magnetized brushless AC motors


    Zhu, Z.Q.; Xia, Z.P.; Shi, Y.F.; Howe, D.; Pride, A.; X. J. Chen


    The steady-state performance of Halbach magnetized brushless ac machines when operated in constant torque and flux-weakening modes is investigated both theoretically and experimentally, with particular emphasis on the influence of cross-coupling magnetic saturation on the torque capability.

  16. Ac-dc converter firing error detection

    International Nuclear Information System (INIS)

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  17. AC loss in superconducting tapes and cables

    NARCIS (Netherlands)

    Oomen, Marijn Pieter


    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  18. FLUXCAP: A flux-coupled ac/dc magnetizing device

    CERN Document Server

    Gopman, Daniel B; Kent, Andrew D


    We report on an instrument for applying ac and dc magnetic fields by capturing the flux from a rotating permanent magnet and projecting it between two adjustable pole pieces. This can be an alternative to standard electromagnets for experiments with small samples or in probe stations in which an applied magnetic field is needed locally, with advantages that include a compact form-factor, very low power requirements and dissipation as well as fast field sweep rates. This flux capture instrument (FLUXCAP) can produce fields from -400 to +400 mT, with field resolution less than 1 mT. It generates static magnetic fields as well as ramped fields, with ramping rates as high as 10 T/s. We demonstrate the use of this apparatus for studying the magnetotransport properties of spin-valve nanopillars, a nanoscale device that exhibits giant magnetoresistance.

  19. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)


    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  20. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Directory of Open Access Journals (Sweden)

    Pawel Szczesniak


    Full Text Available In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two modelling techniques are applied to a same AC-AC converter called matrix-reactance frequency converter based on buck-boost topology. These techniques are compared on the basis of their rapidity, quantity of calculations and transformations and its limitations.

  1. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte (United States)

    Abbas, Qamar; Béguin, François


    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  2. Rapid cycling synchrotron magnet with separate ac and dc circuit

    International Nuclear Information System (INIS)

    In present rapid cycling synchrotron magnets ac and dc currents flow in the same coil to give the desired field. The circuit reactance is made zero at dc and the operating frequency by running the magnet in series with an external parallel resonant LC current. We propose to return the ac flux in a gap next to the synchrotron. The dc coil encloses the ac magnetic circuit and thus links no ac flux. A shorted turn between the dc coil and ac flux enhances the separation of the two circuits. Several interesting developments are possible. The dc coil could be a stable superconductor to save power. The ac flux return gap could be identical with the synchrotron gap and contain a second synchrotron. This would double the output of the system. If the return flux gap were used for a booster, the ac coil power could be greatly reduced or radiation hardening of the ac coil could be simplified

  3. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique


    Sagar.S.Pawar; Prakash.T.Patil


    This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  4. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Directory of Open Access Journals (Sweden)

    Sagar. S. Pawar


    Full Text Available This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  5. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters


    Pawel Szczesniak


    In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two m...

  6. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.


    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  7. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter


    S. Arumugam S. Ramareddy M. Sridhar


    This paper presents a novel soft-switching pulse width modulation (PWM) utility frequency AC to high frequency (HF) AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which ...

  8. Adaptive Nonlinear Control of Induction Motors through AC/DC/AC Converters


    Elfadili, Abderrahim; Giri, Fouad; El Magri, Abdelmounime; Dugard, Luc; Chaoui, Fatima Zara


    The problem of controlling induction motors, together with associated AC/DC rectifiers and DC/AC inverters, is addressed. The control objectives are threefold: (i) the motor speed should track any reference signal despite mechanical parameter uncertainties and variations; (ii) the DC Link voltage must be tightly regulated; (iii) the power factor correction (PFC) w.r.t. the power supply net must be performed in a satisfactory way. First, a nonlinear model of the whole controlled system is deve...

  9. Robust control of synchronous motors through AC/DC/AC converters


    El Magri, Abdelmounime; Giri, Fouad; Abouloifa, Abdelmajid; Chaoui, Fatima Zara


    The problem of controlling synchronous motors, driven through AC/DC rectifiers and DC/AC inverters is addressed. The control objectives are three fold: (i) forcing the motor speed to track a varying reference signal in presence of motor parameter uncertainties;(ii) regulating the DC Link voltage; (iii )assuring a satisfactory power factor correction (PFC) with respect to the power supply net .First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a...

  10. A new class of hybrid AC/AC direct power converters


    Klumpner, Christian; Wijekoon, Thiwanka; Wheeler, Patrick


    Variable voltage and variable frequency conversion of electrical energy from an AC source to an AC load is done in traditional power converters via a DC-link where an energy storage element (electrolytic capacitors) is situated. Despite its well-known benefits, it has the disadvantage of being bulky and to limit the converter lifetime. On the other hand, Direct Power Conversion (DPC) is an attractive concept, which doesn’t need an energy storage buffer, but has two main disadvantages: reduced...

  11. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.


    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...... will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration....

  12. AC losses in a HTS coil carrying DC current in AC external magnetic field

    International Nuclear Information System (INIS)

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  13. 21 CFR 880.5500 - AC-powered patient lift. (United States)


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or...

  14. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊


    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  15. S4AC Case Study: Enhancing Underserved Seniors' Access to Health Promotion Programs. (United States)

    Koehn, Sharon; Habib, Sanzida; Bukhari, Syeda


    The Seniors Support Services for South Asian Community (S4AC) project was developed in response to the underutilization of available recreation and seniors' facilities by South Asian seniors who were especially numerous in a suburban neighbourhood in British Columbia. Addressing the problem required the collaboration of the municipality and a registered non-profit agency offering a wide range of services and programs to immigrant and refugee communities. Through creative outreach and accommodation, the project has engaged more than 100 Punjabi-speaking seniors annually in diverse exercise activities. Case study research methods with staff and current and former senior participants of S4AC include participant observation, individual interviews, and focus groups. Viewed through the critical interpretive lens of the "candidacy framework", findings reveal the myriad ways in which access to health promotion and physical activity for immigrant older adults is a complex iterative process of negotiation at multiple levels. PMID:26731695

  16. Dicty_cDB: FCL-AC08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC08 (Link to dictyBase) - - - Contig-U15080-1 FCL-AC08P ...(Link to Original site) FCL-AC08F 616 FCL-AC08Z 291 FCL-AC08P 907 - - Show FCL-AC08 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL Representative seq. ID FCL-AC08P (Link to Original site) Representative DNA sequence >FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-...ignificant alignments: (bits) Value FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-AC/FCL-AC08Q.Seq.d/ 1322 0.0 SFA226 (S

  17. AC Stark cooling of C 2 - ion in penning trap using Simbuca

    CERN Document Server

    Cui, Hao


    This article is going to summarize work I did in my 2 month project on AC Stark cooling simulation, and the object is to help my colleague carry on it and make further progress. In this article, I will meanly explain the formula I used, the content and flowchart of my c++ code, some conclusion and knowledge we obtained about cooling efficiency from our simulation, and some important tips we noticed before.

  18. A.c. impedance and constant current chronopotentiometry in detection of changes in protein structures

    Czech Academy of Sciences Publication Activity Database

    Ostatná, Veronika; Paleček, Emil

    Třesť, 2008. s. 1. [41st Heyrovský Discussion on Electrochemical Impedance Analysis. 15.06.2008-19.06.2008, Třešť] R&D Projects: GA ČR(CZ) GP202/07/P497; GA MŠk(CZ) LC06035 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : a.c. impedance * constant current chronopotentiometry * denaturation and aggregation Subject RIV: BO - Biophysics

  19. Analysis of critical state response in thin films by AC susceptibility measurements

    Czech Academy of Sciences Publication Activity Database

    Youssef, A.; Švindrych, Z.; Hadač, J.; Janů, Zdeněk


    Roč. 18, č. 2 (2008), s. 1589-1592. ISSN 1051-8223 R&D Projects: GA ČR GA102/05/0942 Institutional research plan: CEZ:AV0Z10100520 Keywords : AC susceptibility * critical state * harmonics * thin film * axial magnetic-field * superconductor disks * cylinders Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.919, year: 2008

  20. Characteristics of AC capillary discharge produced in electrically conductive water solution

    Czech Academy of Sciences Publication Activity Database

    De Baerdemaeker, F.; Šimek, Milan; Schmidt, Jiří; Leys, C.


    Roč. 16, č. 2 (2007), s. 341-354. ISSN 0963-0252 R&D Projects: GA AV ČR IAA1043102 Institutional research plan: CEZ:AV0Z20430508 Keywords : water breakdown * capillary * AC discharge * conductive liquid * optical emission * decay time * vapour bubble * breakdown mechanism Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.120, year: 2007

  1. Marketingová strategie fotbalového klubu AC Sparta Praha


    Lacinová, Jana


    The main purpose of this thesis is the description and subsequent analysis of the present marketing strategy of football club AC Sparta Prague. The work is focused on marketing communications and projects of this club. The practical part contains the results of the marketing survey; the aim was to find out the awareness of the football supporters of this Czech club and its marketing activities. In conclusion there are suggested potential changes and improvements for the future development of ...

  2. Use of Activated Carbon in Sediment Remediation : AC quantification techniques and remediation effects



    Studies have demonstrated that hydrophobic organic compounds (HOC) show strong sorption to black carbon (BC). Therefore presence of BC in HOC contaminated sediment reduces the in situ freely dissolved aqueous concentration hence decrease uptake in biota. In connection with the research project “stability of polluted sediment” by the Norwegian Geotechnical Institute (NGI), sediment remediation with use of activated carbon (AC), which is a type of BC, is investigated. This thesis concentrates o...

  3. Fractional ac Josephson effect in unconventional superconductors

    International Nuclear Information System (INIS)

    For certain orientations of Josephson junctions between two px-wave or two d-wave superconductors, the subgap Andreev bound states produce a 4π-periodic relation between the Josephson current I and the phase difference ψ: I propor to sin(ψ/2) . Consequently, the ac Josephson current has the fractional frequency eV/h where V is the dc voltage. In the tunneling limit, the Josephson current is proportional to the first power (not square) of the electron tunneling amplitude. Thus, the Josephson current between unconventional superconductors is carried by single electrons, rather than by Cooper pairs. The fractional ac Josephson effect can be observed experimentally by measuring frequency spectrum of microwave radiation from the junction

  4. AC motor drive system for electric cars

    Energy Technology Data Exchange (ETDEWEB)

    Morohoshi, Yukinobu; Yoshinori, Naoto; Naito, Hironobu (Fuji Electric Co., Ltd., Tokyo, (Japan))


    Various main circuit equipment with large capacity GTO thyristors are outlined for AC and DC electric cars. The configuration of a PWM converter system is presented for the AC main motor drive system of the Shinkansen trains, and its following features are described: the high power factor control capable of keeping a power factor 100% constantly, energy saving by power regenerative braking, the small triple structure with large capacity reverse-conducting GTO thyristors of 4,500V/3,000A, and the reduction of equivalent interfering current and harmonic current by three phase-triple phase difference operation. Furthermore, a control logic equipment with 16 bit MPU and a main transformer are outlined, and the verification test results of the control logic equipment by an analog model simulation and the combinational test results of the commercial equipment are reported. Prototype VVVF inverter system for DC electric cars is also presented. 6 refs., 13 figs., 3 tabs.

  5. β-delayed fission from 230Ac

    International Nuclear Information System (INIS)

    ThO2 is irradiated with 60 MeV/u 18O beams. 230Ra is produced via the multi-nucleon transfer and dissipative fragmentation reactions of the target. 230Ra is radio-chemical separated from ThO2 and the other reaction products. The thin Ra sources are prepared. The mica fission track detectors are exposed to the Ra sources. γ-rays of Ra decay in the sources are measured by a HPGe detector. The mica foil is etched in HF solution. The etched mica foil is scanned with an optical microscope. The fission tracks that should come from β-delayed fission of 230Ac are observed. The β-delayed fission probability of 230Ac is determined to be (1.19 +- 0.85) x 10-8

  6. AC Dielectrophoresis Using Elliptic Electrode Geometry


    S. M. Rezaul Hasan; Aanan Khurma


    This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number) fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of...

  7. Lazy AC-Pattern Matching for Rewriting

    CERN Document Server

    Belkhir, Walid; 10.4204/EPTCS.82.3


    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  8. Entropy production in ac-calorimetry


    Garden, Jean-Luc; Richard, Jacques


    In calorimetry and particularly in heat capacity measurements, different characteristic relaxation time constants may perturb the experiment which cannot be considered at thermodynamic equilibrium. In this case, thermodynamics of irreversible processes has to be taken into account and the calorimetric measurements must be considered as dynamic. In a temperature modulated experiment, such as ac-calorimetry, these non-equilibrium experiments give rise to the notion of frequency dependent comple...

  9. Simulation Environment for Power Management and Distribution Development Project (United States)

    National Aeronautics and Space Administration — The overall objective of this research project is to investigate an autonomous and online control structure for finite-inertia power systems (dc and ac) with a...

  10. Development of a hardware-based AC microgrid for AC stability assessment (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  11. Design and implementation of IEEE 802.11ac MAC controller in 65 nm CMOS process (United States)

    Peng, Cheng; Bin, Wu; Yong, Hei


    An IEEE-802.11ac-1*1 wireless LAN system-on-a-chip (SoC) that integrates an analog front end, a digital base-band processor and a media access controller has been implemented in 65 nm CMOS technology. It can provide significantly increased throughput, high efficiency rate selection, and fully backward compatibility with the existing 802.11a/n WLAN protocols. Especially the measured maximum throughput of UDP traffic can be up to 267 Mbps. Project supported by the National Great Specific Project of China (No. 2012ZX03004004_001).

  12. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    Directory of Open Access Journals (Sweden)

    S. Arumugam S. Ramareddy M. Sridhar


    Full Text Available This paper presents a novel soft-switching pulse width modulation (PWM utility frequency AC to high frequency (HF AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which includes HFAC power regulation ranges and actual efficiency characteristics based on zero voltage soft switching operation ranges.. The simulation circuits are models are developed and they are simulated using ORCAD.

  13. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application


    Oliveira, J. G.; Schettino, H.; Gama, V; Carvalho, R.; H. Bernhoff


    An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel...



    Sorrentino, Vincenzo


    In the last years the renewable energy sources have known a state of their advanced diffusion considering their advantages compared to the traditional energy sources like fossil fuels. For this reason the combined heat and power (CHP) plant fueled by renewable sources are widely used. The purpose of this Ph.D. thesis is the design of a new Grid-connected Double-Stage AC-DC/DC-AC Power Converter (DSACPC) for a Concentrating Solar plant for Combined generation of Heat and Power (CS-CHP), th...

  15. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credit s ] BLAST Search Image Search Home About Archive Update History Contact us AcEST AcEST C ... Data acquisit ion method - Data analysis method - Number of data ... entries 4,298 entries Data it em Description Contig ID ID of contig sequence of A ... ris Number of clones The number of EST clones constit uting the contig sequence of Adiantum capillus-vene ... ris Definit ion Definit ion Link to clone list In the TogoDB edi ...

  16. Realization of a Direct Soft Switching AC/AC Converter for Wireless Power Transfer Applications


    Vuorsalo, Simo


    This thesis describes the design, realization and testing of a three-phase to one-phase direct AC/AC converter, also known as the matrix converter. The switching is using the soft-switching strategy which is also known in the literature as the Zero Current Switching strategy. To achieve ZCS, the circuit needs resonant behavior which is achieved by the transmitter primary side that is an LC circuit. This circuit acts as a tank circuit and the switching frequency is the resonant frequency of th...

  17. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;


    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled to...... low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper....

  18. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;


    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled to...... semiconductor commutations, and hence, no increase in switching losses. The proposed converter therefore offers a low-cost alternative to applications that need to ride through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is...

  19. Dicty_cDB: FCL-AC03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC03 (Link to dictyBase) - - - Contig-U16477-1 FCL-AC03P ...(Link to Original site) FCL-AC03F 538 FCL-AC03Z 570 FCL-AC03P 1108 - - Show FCL-AC03 Library FCL (Link to library) Clone ID FCL-...7-1 Original site URL Representative seq. ID FCL-AC03P (Link to Original site) Representative DNA sequence >FCL-AC03 (FCL-AC03Q) /CSM/FCL/FCL-...AC/FCL-AC03Q.Seq.d/ AATTTTTAAAAAAAAAAGAAAATAAAAAAAAAAATAATATTTTATTAGTCATTATAAAAT TGTGAAT

  20. Dicty_cDB: FCL-AC20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC20 (Link to dictyBase) - - - Contig-U15117-1 FCL-AC20Z ...(Link to Original site) - - FCL-AC20Z 600 - - - - Show FCL-AC20 Library FCL (Link to library) Clone ID FCL-A... Representative seq. ID FCL-...AC20Z (Link to Original site) Representative DNA sequence >FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-

  1. Levantamiento del campo acústico de una fuente sonora subacuática en el tanque hidroacústico del Instituto de Acústica


    Ranz Guerra, Carlos; Cobo, Pedro


    6 pp.-- PACS nrs.: 43.30.Jx, 43.30.Sf.-- Comunicación presentada en los siguientes congresos: Acústica 2000, II Congreso Iberoamericano de Acústica. XXXI Congreso Nacional de Acústica: TecniAcústica 2000. II Congreso Ibérico de Acústica. II Jornadas Iberoamericanas de Acústica. EAA Symposium on Architectural Acoustics.

  2. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)



    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  3. Mapa acústico parcial de Benetusser




    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental.

  4. An ac biased superconducting flux transformer

    International Nuclear Information System (INIS)

    The coupled motion of the vortex lattice of two electrically insulated, superimposed, superconducting thin films (primary and secondary) in a perpendicular magnetic field, is predicted to exhibit a Josephson-like behavior. For a dc applied current flowing in the primary film, the voltage difference between the time-averaged primary and secondary flux flow voltages obeys the equations of a resistively shunted junction model. If an ac current is superimposed on the dc current. Shapiro-type steps are predicted in the current-voltage characteristic. In contrast to the conventional Josephson effect, the voltage positions of these steps can be tuned by the applied magnetic field. (orig.)

  5. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash


    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  6. Comparative Study of DC and AC Microgrids in Commercial Buildings Across Different Climates and Operating Profiles: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Fregosi, D.; Ravula, S.; Brhlik, D.; Saussele, J.; Frank, S.; Bonnema, E.; Scheib, J.; Wilson, E.


    Bosch has developed and demonstrated a novel DC microgrid system designed to maximize utilization efficiency for locally generated photovoltaic energy while offering high reliability, safety, redundancy, and reduced cost compared to equivalent AC systems. Several demonstration projects validating the system feasibility and expected efficiency gains have been completed and additional ones are in progress. This work gives an overview of the Bosch DC microgrid system and presents key results from a large simulation study done to estimate the energy savings of the Bosch DC microgrid over conventional AC systems. The study examined the system performance in locations across the United States for several commercial building types and operating profiles and found that the Bosch DC microgrid uses generated PV energy 6%–8% more efficiently than traditional AC systems.

  7. Estudio acústico del Conservatorio de Piles




    El objetivo de este proyecto es realizar un estudio acústico general de la "Casa de la Cultura" de Piles, sobre todo de los recintos que más lo requieren, como la sala principal de música. El edificio, al tratarse de una construcción antigua, no reúne las especificaciones acústicas establecidas en el Código Técnico vigente en la actualidad. En primer lugar, se realiza el estudio del acondicionamiento acústico de la sala principal, entendiéndose como acondicionamiento acústico la definición de...

  8. AC Own Motion Percentage of Randomly Sampled Cases (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  9. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad


    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  10. Study of AC electrical conduction mechanisms in an epoxy polymer (United States)

    Jilani, Wissal; Mzabi, Nissaf; Gallot-Lavallée, Olivier; Fourati, Najla; Zerrouki, Chouki; Zerrouki, Rachida; Guermazi, Hajer


    The AC conductivity of an epoxy resin was investigated in the frequency range 10^{-1} - 106 Hz at temperatures ranging from -100 to 120 °C. The frequency dependence of σ_{ac} was described by the law: σ_{ac}=ω \\varepsilon0\\varepsilon^''_{HN}+Aωs. The study of temperature variation of the exponent (s) reveals two conduction models: the AC conduction dependence upon temperature is governed by the small polaron tunneling mechanism (SPTM) at low temperature (-100 -60 °C) and the correlated barrier hopping (CHB) model at high temperature (80-120 °C).

  11. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)


    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  12. An improved AC-amplifier for electrophysiology

    Directory of Open Access Journals (Sweden)

    Jorgovanović Nikola


    Full Text Available We present the design, simulation and test results of a new AC amplifier for electrophysiological measurements based on a three op-amp instrumentation amplifier (IA. The design target was to increase the common mode rejection ratio (CMRR, thereby improving the quality of the recorded physiological signals in a noisy environment. The new amplifier actively suppresses the DC component of the differential signal and actively reduces the common mode signal in the first stage of the IA. These functions increase the dynamic range of the amplifier's first stage of the differential signal. The next step was the realization of the amplifier in a single chip technology. The design and tests of the new AC amplifier with a differential gain of 79.2 dB, a CMRR of 130 dB at 50 Hz, a high-pass cutoff frequency at 0.01 Hz and common mode reduction in the first stage of the 49.8 dB are presented in this paper.

  13. Dicty_cDB: FCL-AC29 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC29 (Link to dictyBase) - - - Contig-U15392-1 FCL-AC29P ...(Link to Original site) FCL-AC29F 104 FCL-AC29Z 591 FCL-AC29P 695 - - Show FCL-AC29 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL Representative seq. ID FCL-AC29P (Link to Original site) Representative DNA sequence >FCL-AC29 (FCL-AC29Q) /CSM/FCL/FCL-...roducing significant alignments: (bits) Value VSC293 (VSC293Q) /CSM/VS/VSC2-D/VSC293Q.Seq.d/ 1063 0.0 FCL-AC29 (FCL-

  14. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Directory of Open Access Journals (Sweden)

    Abdelhafid Ait Elmahjoub


    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  15. [Intestinal occlusion and abdominal compartment syndrome (ACS)]. (United States)

    Stagnitti, Franco


    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  16. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.; Nasirian, Vahidreza; Davoudi, Ali


    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... different control parameters. This paper introduces a cooperative algorithm that regulates the system frequency while maintaining the power sharing properties of droop control. Dynamic consensus protocol is used to estimate the average of normalized active powers in the entire MG. This estimation is then...... added to primary control, compensating the frequency drop caused by the droop mechanism. The proposed controller is fully distributed, meaning that each source exchange information with only its direct neighbors through a sparse communication network. This controller has a unique feature that it does...

  17. Mapa Acústico del Gran Madrid


    Santiago Páez, José Salvador; Perera, P


    El desarrollo urbanístico de Madrid desde los años 1980 a finales de la década de los 90 hizo que su Ayuntamiento, que ya había promovido la realización entre 1985 y 1991 de un Mapa Acústico parcial de la ciudad, pensase en extender el ámbito de éste a todo el término municipal. Siguiendo el mismo criterio anterior, se superpuso una cuadrícula sobre el plano de Madrid, y se llevaron a cabo registros sonoros de 5 minutos en cada vértice de la misma, en los puntos de medición fuera del área ant...

  18. Josephson arrays for dc and ac metrology

    International Nuclear Information System (INIS)

    Large series arrays of underdamped SIS tunnel junctions are the basic element of the primary dc voltage standards used at present. The development of versatile quantum voltmeters for dc and ac metrology requires the preparation of large and perfect series arrays of overdamped Josephson junctions. Overdamped junctions can be realized by externally shunted SIS junctions or by internally shunted SNS or SINIS junctions. Arrays of up to 8000 SINIS junctions or 30000 SNS junctions were successfully operated at the 1 V dc level. In addition to being used in large arrays for voltage metrology and oscillators, the described junction types may become very useful for the preparation of highly integrated single-flux-quantum digital devices. (author)

  19. An ac bridge readout for bolometric detectors (United States)

    Rieke, F. M.; Lange, A. E.; Beeman, J. W.; Haller, E. E.


    The authors have developed a bolometer readout circuit which greatly improves the low-frequency stability of bolometric detectors. The circuit uses an ac bias voltage and two matched bolometers and allows stable dc bolometer operation for integration times greater than 10 s. In astronomical applications the readout allows for qualitatively different observation modes (e.g. staring or slow-drift scanning) which are particularly well suited for space observations and for the use of arrays. In many applications the readout can increase sensitivity. The authors present noise spectra for 4He temperature bolometers with no excess noise at frequencies greater than 0.1 Hz. The measured optical responsivity of a bolometer operated with the present readout is the same as that of a bolometer operated with a conventional readout.

  20. Effective ac response in weakly nonlinear composites

    Energy Technology Data Exchange (ETDEWEB)

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)


    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  1. Nonlinear ac conductivity of interacting 1d electron systems


    Rosenow, Bernd; Nattermann, Thomas


    We consider low energy charge transport in one-dimensional (1d) electron systems with short range interactions under the influence of a random potential. Combining RG and instanton methods, we calculate the nonlinear ac conductivity and discuss the crossover between the nonanalytic field dependence of the electric current at zero frequency and the linear ac conductivity at small electric fields and finite frequency.

  2. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application (United States)


    ... will transfer to AWN all remaining tangible and intangible assets owned, leased or held by ACS Wireless.... \\6\\ ACS Group will cause certain of its other subsidiaries to transfer wireless spectrum licenses and...'' as the power to exercise a controlling influence over the management or policies of a company,...

  3. Operation of AC Adapters Visualized Using Light-Emitting Diodes (United States)

    Regester, Jeffrey


    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  4. Search for β-delayed fission of 228Ac

    International Nuclear Information System (INIS)

    Radium was radiochemically separated from natural thorium. Thin 228Ra→β-228Ac sources were prepared and exposed to mica fission track detectors, and measured by an HPGe γ-ray detector. The β-delayed fission events of 228Ac were observed and its β-delayed fission probability was found to be (5±2)x10-12

  5. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    DEFF Research Database (Denmark)

    Qin, Zian

    proposed new active power decoupling method, the ripple power in the converter can be compensated in a more efficient and more compact way. Then, Chapter 5 changes the scope of the thesis to three-phase converters, and the nine-switch converter, as a reduced switch version of two three-phase full......-bridges connected back-to-back, is studied. Application criteria of the nine-switch converter are investigated for reducing the relatively high stress introduced by the less number of switches. In Chapter 6 a rotating speed controller design method is proposed for improving the thermal loading of the three...... to users. Their performances including cost, efficiency, reliability, and so on, therefore are more important concerns than they were. The objective of this thesis is to study and propose advanced design methods for robust ac-dc-ac converters, which are widely used interfaces in energy conversion...

  6. 40 CFR 86.162-00 - Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. (United States)


    ... Procedures § 86.162-00 Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. The alternative air conditioning test procedures AC1 and AC2 are approved by the Administrator... requirements of paragraph (a) of this section and meet the requirements of § 86.163-00. Air conditioning...

  7. Determination for β-delayed fission probability of 230Ac

    Institute of Scientific and Technical Information of China (English)

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝


    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  8. Development of YBCO HTS cable with low AC loss

    International Nuclear Information System (INIS)

    High temperature superconducting (HTS) cables using YBCO tapes are expected to be more economical because AC losses will be much smaller than conventional cables. To reduce AC loss, 10 mm wide YBCO tapes were divided into five strips using a YAG laser. Using narrower strips and optimizing the space between the strips were effective in reducing AC loss. A 1 m conductor was fabricated, and AC loss was 0.048 W/m at 1 kA and 50 Hz. Based on the successful AC loss reduction in the 1 m conductor, we will fabricate a 10 m HTS cable with a three-layer HTS conductor, electrical insulation, and a one-layer HTS shield and cupper protection layer for overcurrent. In addition, we have developed a prototype of the HTS cable joint that can withstand an overcurrent condition of 31.5 kA for 2 s

  9. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;


    performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...... bladder 18 ± 3% (15–21%). The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of...... the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction....

  10. Ac response of a coupled double quantum dot

    Institute of Scientific and Technical Information of China (English)

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang


    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  11. UHV A.C. transmission: Technology and prospects

    International Nuclear Information System (INIS)

    At the beginning of the 70's, UHV transmission was regarded as imminent in many countries in view of the expected concentration of generating units (possibly of the nuclear type and grouped together in a few large plants, each of several GW), and research projects were therefore launched in the U.S.A., Canada, Italy, Japan, USSR, etc. Nowadays, the expected introduction of UHV transmission seems remote due to the slowdown in electricity growth and to the tendency towards distributed generation. Nevertheless, there are exceptions: the 1,200 kV 2,400 km-long transmission system in operation in Siberia-Kazahkstan-Urals, and the 1,100 kV 200 km double-circuit line under construction in Japan (which will, however, be operated at 500 kV up to the end of the century). In addition, in Italy, the research programme of a 1000 kV project has now been completed and a 1,050 kV pilot plant is under construction in Tuscany, consisting of a short 1,050kV line and a 420/1,050 kV 1,200 MVA substation. The technology of UHV AC transmission has therefore been proved effective and may represent an available option for the power systems of the next century. From the power system planning point-of-view, UHV's favourable characteristics lie in the possibility of transmitting large amount of power, of the order of 5 GW per circuit, with lower costs, reduced losses, and less land occupation than in the case of EHV lines

  12. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Directory of Open Access Journals (Sweden)

    Marian GAICEANU


    Full Text Available In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller 30 MIPS 32-bit fixed-point digital signal processor (DSP, were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this way a small DC link capacitor is required to handle the dc voltage error control. The feed-forward (Sul and Lipo, 1990 current component provides fast correction of the reference control to load power variation. In order to obtain the feed-forward current component, the load power must to be known. In this paper the load power is estimated from the dc link, indirectly, through a dc load current estimator. In this way the author overcomes the use of the serial communication between control boards (Gaiceanu, 2004 in order to deliver the load power information from the inverter side. The load current estimator is based on the DC link voltage and on the load current of the supply converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feed-forward current component has no ripple, no additional hardware, and more fast control response. Through simulation and experimental results the performances of the proposed load current estimator scheme are demonstrated.

  13. Sustainable AC/AC hybrid electrochemical capacitors in aqueous electrolyte approaching the performance of organic systems (United States)

    Abbas, Qamar; Babuchowska, Paulina; Frąckowiak, Elżbieta; Béguin, François


    A high energy hybrid AC/AC electrochemical capacitor has been realized in aqueous Li2SO4+KI electrolyte mixture. Owing to the redox processes associated with the 2I-/I2 system, the positive electrode operates in narrow potential range and displays high capacity. During prolonged potentiostatic floating at 1.6 V, the hybrid cell demonstrates remarkably stable capacitance and resistance. Analyses by temperature programmed desorption after floating at 1.6 V proved that oxidation of the positive AC electrode is prevented by the use of Li2SO4+KI, which enables the maximum potential of this electrode to be shifted below the water oxidation potential. When charged at 0.2 A g-1 up to U = 1.6 V, the hybrid cell displays a high capacitance of 75 F g-1 (300 F g-1 per mass of one electrode) compared to 47 F g-1 (188 F g-1 per mass of one electrode) for a symmetric cell in Li2SO4. At 0.2 A g-1 up to 1.6 V, the hybrid capacitor in Li2SO4+KI displays an energy density of 26 Wh kg-1 which approaches the energy density of 30.9 Wh kg-1 measured when the same carbon is implemented in a capacitor using TEABF4/ACN electrolyte and charged up to 2.5 V.

  14. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.


    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not...

  15. La acústica submarina y su desarrollo desde la creación del Instituto de Acústica


    Ranz Guerra, Carlos; Cobo, Pedro; Carbó, Rafael; Santiago Páez, José Salvador; Soler, A. M.; Briones, J. M.; Jimeno, I.; Muñoz, N; Camarasa, M.; Recuero López, Manuel


    PACS: 43.30.Xm; 43.30.Yj; 43.30.Vh; 43.30.Nb; 43.30.Ma.-- Publicado en el Vol. XXXI, núm. 3-4, tercer y cuarto trimestre 2000 de la Revista de Acústica: Número especial dedicado al XXV Aniversario del Instituto de Acústica del C.S.I.C.

  16. Probe for AC magnetic susceptibility in YBa2Cu3O7-x

    International Nuclear Information System (INIS)

    It was projected and built a probe for AC (3KHz) differential measurements of the magnetic susceptibility of high Tc superconductors. Samples of YBa sub(2) Cu sub(3) O sub(7-x) were tested in the 77 - 110K interval, It was measured the real (X') and imaginary part (X'') of the magnetic susceptibility and these results were correlated with X rays difratograms. The ceramic samples were then transformed into powder form and the real and imaginary part of the magnetic susceptibility again measured. These results will be discussed. (author)

  17. Metrological traceability for AC High-Voltage in Inmetro up to 40 kV (United States)

    Vitorio, P. C. O.; de Lima, V. R.; Borges Filho, O.; de Souza, L. A. A.; Asencios, O. W. G.


    This paper refers to a project carried out in Inmetro aiming to provide internal metrological traceability for 60 Hz AC High-Voltage up to 40 kV. It presents details about the method used, its equations and obtained results. A capacitance and tanb bridge, with a built-in current comparator, was used in combination with two standard capacitors to calibrate a standard potential transformer (PT), both in ratio and phase angle. The results obtained by Inmetro showed good agreement with PTB ones, for the same PT. The maximum estimated uncertainty was 0,0049% for ratio error and 104 μrad for phase angle error.

  18. Decommissioning of TA-21-153, a 227Ac contaminated old filter building

    International Nuclear Information System (INIS)

    An exhaust air filter building contaminated with 227Ac was decommissioned at the Los Alamos National Laboratory, Los Alamos, New Mexico, in 1978. The building was constructed in the late 1940s to clean exhaust air from several buildings at TA-21, DP Site. It was in service until March 1970. The project involved preliminary decontamination, dismantling the building, and burying the debris at an on-site waste disposal/storage area. This report presents the details on the decommissioning procedures, health physics, waste management, environmental surveillance, and costs for the operation

  19. The SIP project of Chernobylsk

    International Nuclear Information System (INIS)

    The SIP (shelter implementation plan) project aims at stabilizing the sarcophagus of the Chernobylsk unit 4 and to improve its confinement. 5 priority axis have been defined: i) the reinforcement of the sarcophagus, ii) the reduction of the consequences of the ruin of the sarcophagus, iii) the improvement of radiation safety (management of radioactive water...), iv) the improvement of the security of workers (particularly fire protection and radiation protection), and v) the clearing away of the corium. The project is scheduled to cover 8 years but only half the funding is collected. International bids have been launched and the participants have been chosen. (A.C.)

  20. Design of a DC-AC Link Converter for 500W Residential Wind Generator

    Directory of Open Access Journals (Sweden)

    Riza Muhida


    Full Text Available  As one of alternative sources of renewable energy, wind energy has an excellence prospect in Indonesia, particularly in coastal and hilly areas which have potential wind to generate electricity for residential uses. There is urgent need to locally develop low cost inverter of wind generator system for residential use. Recent developments in power electronic converters and embedded computing allow improvement of power electronic converter devices that enable integration of microcontrollers in its design. In this project, an inverter circuit with suitable control scheme design was developed. The circuit was to be used with a selected topology of Wind Energy Conversion System (WECS to convert electricity generated by a 500W direct-drive permanent magnet type wind generator which is typical for residential use. From single phase AC output of the generator, a rectifier circuit is designed to convert AC to DC voltage. Then a DC-DC boost converter is used to step up the voltage to a nominal DC voltage suitable for domestic use. The proposed inverter then will convert the DC voltage to sinusoidal AC. The duty cycle of sinusoidal Pulse-Width Modulated (SPWM signal controlling switches in the inverter was generated by a microcontroller. The lab-scale experimental rig involves simulation of wind generator by running a geared DC motor coupled with 500W wind generator where the prototype circuit was connected at the generator output. The experimental circuit produced single phase 240V sinusoidal AC voltage with frequency of 50Hz. Measured total harmonics distortion (THD of the voltage across load was 4.0% which is within the limit of 5% as recommended by IEEE Standard 519-1992.

  1. Numerical estimation of AC loss in superconductors with ripple current

    International Nuclear Information System (INIS)

    Highlights: •The loss energy density with ripple current is numerically calculated. •Irie–Yamafuji model is used for magnetic field dependence of critical current. •Calculated result of cylindrical superconductor agrees with theoretical result. •AC loss of strip superconductor becomes large at small ripple current amplitude. •Strip superconductor should be used as a form of hollow cylinder to reduce AC loss. -- Abstract: The loss energy density (AC loss) with ripple current is numerically calculated by finite element method for cylindrical and strip superconductors based on Irie–Yamafuji model in which the magnetic field dependence of the critical current density is taken into account for design of DC transmission cable system. It is confirmed that calculated result of the AC loss in the cylindrical superconductor with the ripple current agrees well with theoretical estimation which was reported in the previous work. On the contrary, the AC loss in the strip superconductor with the ripple current is obtained only by numerical calculation. It is found that the AC loss in the strip superconductor of the ripple current becomes larger than that without DC current at small ripple current amplitude, since the penetration depth of magnetic field becomes large. Therefore, it is recommended that strip superconductor is better to use as cylindrical hollow superconductor for DC transmission cable system to reduce the AC loss

  2. Importance of Attenuation Correction (AC for Small Animal PET Imaging

    Directory of Open Access Journals (Sweden)

    Henrik H. El Ali


    Full Text Available The purpose of this study was to investigate whether a correction for annihilation photon attenuation in small objects such as mice is necessary. The attenuation recovery for specific organs and subcutaneous tumors was investigated. A comparison between different attenuation correction methods was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7 were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II. CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%, for kidneys 20 ± 1% (19–21%, and for bladder 18 ± 3% (15–21%. The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction.

  3. Analytical description of AC losses for high temperature superconductors

    International Nuclear Information System (INIS)

    Full text: AC losses for high temperature superconductors have been calculated by considering the effects of the temperature distribution and the flux flow resistance. Maxwell's equations and thermal diffusion equation are used to calculate the distribution of magnetic field and the temperature inside the superconductors, respectively. The flux flow effect on the AC losses is calculated by using the extended critical state model. An analytical expression of the AC losses is obtained using a superposition approximation in which the cases of complete and incomplete magnetic field penetration have been distinguished. The expression can well explain the experimental observations of the frequency dependence of the AC losses per cycle in high temperature superconductors. It is clearly shown from the analytical expression that the effect of the thermal distribution inside the superconductors is different from the effect caused by flux flow resistance. In the case of incomplete magnetic penetration, the temperature distribution results in the increase of the AC losses per cycle upon frequency whereas the flux flow leads to the decrease of the AC losses per cycle upon frequency. In the case of complete magnetic penetration the results are opposite to those in the previous case. Due to the extremely strong flux flow in high temperature superconducting materials, the effect of the flux flow on the AC losses is dominant, and the overall dependence of AC losses per cycle upon frequency is controlled by the flux flow. On the other hand, because the inhomogeneous distribution of the temperature inside the superconductors which is normal higher in the center than near the edge, there is an upper limit for the frequency beyond which the superconductivity will be totally destroyed by AC losses. Analytical expressions for the critical frequency, distributions of magnetic field and critical current density are also obtained

  4. Methylation analysis of histone H4K12ac-associated promoters in sperm of healthy donors and subfertile patients

    Czech Academy of Sciences Publication Activity Database

    Vieweg, M.; Dvořáková-Hortová, Kateřina; Dudková, B.; Waliszewski, P.; Otte, M.; Oels, B.; Hajimohammad, A.; Schorsch, M.; Schuppe, H.M.; Weidner, W.; Steger, K.; Paradowska-Dogan, A.


    Roč. 7, č. 31 (2015). ISSN 1868-7083 R&D Projects: GA ČR(CZ) GA14-05547S; GA MŠk(CZ) CZ1.05/1.1.00/02.0109 Institutional support: RVO:86652036 Keywords : H4K12ac in spermatozoa * μChIP * promoter methylation * pyrosequencing * subfertility Subject RIV: EB - Gene tics ; Molecular Biology Impact factor: 4.543, year: 2014

  5. Histone H4K12ac in sperm chromatin represents a potential factor for epigenetic mediated subfertility

    Czech Academy of Sciences Publication Activity Database

    Dvořáková-Hortová, Kateřina; Vieweg, M.; Dudková, B.; Waliszewski, P.; Otte, M.; Oels, B.; Hajimohammad, A.; Turley, H.; Schorsch, M.; Schuppe, H.C.; Weidner, W.; Steger, K.; Paradowska-Dogan, A.

    Madison: Society for the Study of Reproduction , 2015. s. 115-116. [48th Annual Meeting of the Society for the Study of reproduction . 18.06.2015-22.06.2015, San Juan] R&D Projects: GA ČR(CZ) GA14-05547S; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:86652036 Keywords : histone H4K12ac * DNA methylation * pyrosequencing Subject RIV: EB - Genetics ; Molecular Biology

  6. Operation of AC Adapters Visualized Using Light-Emitting Diodes (United States)

    Regester, Jeffrey


    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current (AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For educational purposes, however, an LED-based rectifier is ideal because it allows students to literally see the rectifier operating. Here I'll discuss the practical aspects of building a full AC adapter incorporating an LED-based rectifier and ideas on how to use it in class.

  7. Theoretical analysis of ac losses in high temperature superconducting bulks

    International Nuclear Information System (INIS)

    Ac loss behavior in HTS bulk materials is studied by developing an analytic method. The self-heating effect on the distributions of temperature in HTS bulks has been calculated. A critical frequency which sets the upper limit for driving frequency of the external field in sustaining a superconducting state is obtained. Our model provides useful information of understanding the experimental phenomena, including an anomalous ac loss behavior, a retardation of the inner field respect to the external ac field, etc., in HTS bulk materials

  8. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin


    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  9. Analysis of Input and Output Ripples of PWM AC Choppers

    Directory of Open Access Journals (Sweden)

    Pekik Argo Dahono


    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  10. An Improved AC-BM Algorithm for Monitoring Watch List

    Directory of Open Access Journals (Sweden)

    Mo Yiwen


    Full Text Available With the expanding of database of the watch list of anti-money laundering, improving the speed in matching between the watch list and the database of account holders and clients’ transaction is especially important. This paper proposes an improved AC-BM Algorithm, a matching algorithm of subsection, to improve the speed of matching. Experiment results show the time performance of the improved algorithm is better than traditional BM algorithm, AC algorithm and the AC-BM algorithm. It can improve the efficiency of on-line monitoring of anti-money laundering.  

  11. DC and AC biasing of a transition edge sensor microcalorimeter

    International Nuclear Information System (INIS)

    We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

  12. Study on radioimmunoassay of Bt Cry1Ac protein

    International Nuclear Information System (INIS)

    Bt Cry1Ac protein was extracted from incubation of Bacillus thuringiensis HD-73, and cutting into more specific protein segment with high insect-resistance. High-affinity multi-colonial antibodies of Bt Cry1 Ac protein were obtained after injected it into New Zealand rabbits. By 125I labeling of Bt Cry1 Ac protein, a RIA kit was established. In this method, centrifuge for separation was not necessary due to the use of magnetic micro-particle and the specifications of the kit were found equal to those of imported ELISA. (authors)

  13. Stochastic Dynamics of DC and AC Driven Dislocation Kinks (United States)

    Vardanyan, A.; Kteyan, A.


    Dynamics of a pinned dislocation kink controlled by the acting DC and AC forces is studied analytically. The motion of the kink, described by sine-Gordon (sG) equation, is explored within the framework of McLaughlin-Scott perturbation theory. Assuming weakness of the acting AC force, the equation of motion of the dislocation kink in the pinning potential is linearized. Based on the equations derived, we study stochastic behavior of the kink, and determine the probability of its depinning. The dependencies of the depinning probability on DC and AC forces are analyzed in detail.

  14. Observation of β-delayed fission from 230Ac

    International Nuclear Information System (INIS)

    β-delayed fission for 230Ac was searched. 230Ra was produced via multinucleon transfer reaction by 60 MeV/u 18O ion irradiation of 232Th target. Thin 230Ra→230Ac sources of 108 atoms were acquired through radiochemical separations. The mica track detectors were used to record the fission events. The β-delayed fission nucleus 230Ac was identified via the observed two fission events and the measured γ-ray spectra. Its β-delayed fission probability was obtained to be (1.19 +- 0.85) x 10-8

  15. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo


    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  16. AC Impedance Behaviour of Black Diamond Films

    Institute of Scientific and Technical Information of China (English)

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN


    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  17. Dicty_cDB: FCL-AC22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC22 (Link to dictyBase) - G03266 DDB0186811 Contig-U14995-1 FCL-...AC22P (Link to Original site) FCL-AC22F 430 FCL-AC22Z 521 FCL-AC22P 951 - - Show FCL-AC22 Library FC...L (Link to library) Clone ID FCL-AC22 (Link to dictyBase) Atlas ID - NBRP ID G03266 dictyBase ID DDB0186811 ...Link to Contig Contig-U14995-1 Original site URL Representative seq. ID FCL-AC22P (Link to Original site) Representative DNA sequence >FCL-

  18. Dicty_cDB: FCL-AC23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC23 (Link to dictyBase) - G01760 DDB0186002 Contig-U16043-1 FCL-...AC23P (Link to Original site) FCL-AC23F 132 FCL-AC23Z 582 FCL-AC23P 714 - - Show FCL-AC23 Library FC...L (Link to library) Clone ID FCL-AC23 (Link to dictyBase) Atlas ID - NBRP ID G01760 dictyBase ID DDB0186002 ...Link to Contig Contig-U16043-1 Original site URL Representative seq. ID FCL-AC23P (Link to Original site) Representative DNA sequence >FCL-

  19. Absorption and Attenuation Coefficients Using the WET Labs ac-s in the Mid-Atlantic Bight: Field Measurements and Data Analysis (United States)

    Ohi, Nobuaki; Makinen, Carla P.; Mitchell, Richard; Moisan, Tiffany A.


    Ocean color algorithms are based on the parameterization of apparent optical properties as a function of inherent optical properties. WET Labs underwater absorption and attenuation meters (ac-9 and ac-s) measure both the spectral beam attenuation [c (lambda)] and absorption coefficient [a (lambda)]. The ac-s reports in a continuous range of 390-750 nm with a band pass of 4 nm, totaling approximately 83 distinct wavelengths, while the ac-9 reports at 9 wavelengths. We performed the ac-s field measurements at nine stations in the Mid-Atlantic Bight from water calibrations to data analysis. Onboard the ship, the ac-s was calibrated daily using Milli Q-water. Corrections for the in situ temperature and salinity effects on optical properties of water were applied. Corrections for incomplete recovery of the scattered light in the ac-s absorption tube were performed. The fine scale of spectral and vertical distributions of c (lambda) and a (lambda) were described from the ac-s. The significant relationships between a (674) and that of spectrophotometric analysis and chlorophyll a concentration of discrete water samples were observed.

  20. A precursor of β-delayed fission:230Ac

    Institute of Scientific and Technical Information of China (English)


    The 230Ra has been produced via multinucleon transfer and dissipativefragmentation of heavy target in the 60 MeV/u 18O ion reaction with natural thorium.The radium was radiochemically separated from irradiated thorium targets. 230Acwas obtained by 230Ra β-→ 230Ac. Thin Ra sources were prepared for observing fissionfragments from β-delayed fission of 230Ac. The sources were exposed to the micafission track detectors and measured by a HPGe γ detector. The two fission eventswere obtained and could been assigned to theβ-delayed fission of 230Ac. The β-delayedfission probability of 230Ac was determined to be (1.19+0.85) × 10-8.

  1. AC susceptibility of polycrystalline (Bi-Pb 2223 superconductors

    Directory of Open Access Journals (Sweden)

    H. Salamati


    Full Text Available   The temperature dependence of ac susceptibility of (Bi-Pb2223 polycrystalline samples was measured as a function of frequency and ac field amplitude. Analysis of the temperature dependence of the AC susceptibility near the transition temperature (Tc has been done employing Bean’s critical state model. The observed variation of intergranular critical current densities (Jc with temperature indicates that the weak links are superconductor- normal metal-superconductor (SNS type for this sample. The frequency effect on AC susceptibility was also measured. As the frequency increases, (TP shifts to higher temperatures. This effect can be interpreted in terms of flux creep. The temperature T, and field, , dependence of activation energy obtained from the Arrhenius plot for the frequency ( f and ( TP , can be described as: U(Hac,T=U0(1-T/TCHac-0.18

  2. Performance of an x-ray microcalorimeter under ac biasing

    International Nuclear Information System (INIS)

    Frequency domain multiplexing (FDM) is an attractive option for the readout of imaging arrays of microcalorimeters. Implementation of FDM requires ac biasing of the individual microcalorimeters. In this letter we present a small signal model for the behavior of a microcalorimeter under ac bias. Moreover, we have measured the behavior of the same microcalorimeter under ac (at 46 kHz) and dc bias. These experiments show that the performance of the device is very similar in terms of energy resolution, pulse shapes, and current-voltage characteristics. The measured energy resolution at 5.89 keV is 6.9 eV for ac bias and 5.5 eV for dc bias. The effective time constant in both cases is 100 μs

  3. Dc to ac converter operates efficiently at low input voltages (United States)


    Self-oscillating dc to ac converter with transistor switching to produce a square wave output is used for low and high voltage power sources. The converter has a high efficiency throughout a wide range of loads.

  4. Ferromagnetic resonance driven by an ac current: a brief review

    International Nuclear Information System (INIS)

    Excitation of ferromagnetic resonance (FMR) by an ac current has been observed in macroscopic ferromagnetic films for decades and typically relies on the ac Oersted field of the current to drive magnetic moments into precession and classical rectification of ac signals to detect the resonance. Recently, current-driven ferromagnetic resonances have attracted renewed attention with the discovery of the spin-transfer torque (STT) effect due to its potential applications in magnetic memory and microwave technologies. Here STT associated with the ac current is used to drive magnetodynamics on the nanoscale that enables FMR studies in sample volumes smaller by a factor of 1000 compared to conventional resonance techniques. In this paper, we briefly review the basics of STT-FMR technique and the results of various STT-FMR experiments.

  5. c-axis ac susceptibility in high-Tc superconductors

    International Nuclear Information System (INIS)

    We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi2Sr2CaCu2O8 and YBa2Cu3O7 single crystals at low external fields. The ac field was applied perpendicular to the CuO2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO2 planes passes a threshold field Hth. Hth is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society

  6. Fabrication of alumina films with laminated structures by ac anodization

    International Nuclear Information System (INIS)

    Anodization techniques by alternating current (ac) are introduced in this review. By using ac anodization, laminated alumina films are fabricated. Different types of alumina films consisting of 50–200 nm layers were obtained by varying both the ac power supply and the electrolyte. The total film thickness increased with an increase in the total charge transferred. The thickness of the individual layers increased with the ac voltage; however, the anodization time had little effect on the film thickness. The laminated alumina films resembled the nacre structure of shells, and the different morphologies exhibited by bivalves and spiral shells could be replicated by controlling the rate of increase of the applied potentials. (paper)

  7. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  8. Muc5ac mucin expression during rat skin development


    V. Ferretti; Á. Segal-Eiras; Barbeito, C.G.; Croce, M. V.


    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days...

  9. Dynamics of a nanowire superlattice in an ac electric field


    Zhang, Aizhen; Voon, L. C. Lew Yan; M. Willatzen


    With a one-band envelope function theory, we investigate the dynamics of a finite nanowire superlattice driven by an ac electric field by solving numerically the time-dependent Schroedinger equation. We find that for an ac electric field resonant with two energy levels located in two different minibands, the coherent dynamics in nanowire superlattices is much more complex as compared to the standard two-level description. Depending on the energy levels involved in the transitions, the coheren...

  10. Fractal AC circuits and propagating waves on fractals

    CERN Document Server

    Akkermans, Eric; Dunne, Gerald; Rogers, Luke G; Teplyaev, Alexander


    We extend Feynman's analysis of the infinite ladder AC circuit to fractal AC circuits. We show that the characteristic impedances can have positive real part even though all the individual impedances inside the circuit are purely imaginary. This provides a physical setting for analyzing wave propagation of signals on fractals, by analogy with the Telegrapher's Equation, and generalizes the real resistance metric on a fractal, which provides a measure of distance on a fractal, to complex impedances.

  11. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi;


    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment....

  12. AC resistivity of d-wave ceramic superconductors


    Li, Mai Suan; Dominguez, Daniel


    We model d-wave ceramic superconductors with a three-dimensional lattice of randomly distributed $\\pi$ Josephson junctions with finite self-inductance. The linear and nonlinear ac resistivity of the d-wave ceramic superconductors is obtained as function of temperature by solving the corresponding Langevin dynamical equations. We find that the linear ac resistivity remains finite at the temperature $T_p$ where the third harmonics of resistivity has a peak. The current amplitude dependence of t...

  13. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe


    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments....

  14. Development of an in-line filter to prevent intrusion of NO2 toxic vapors into A/C systems (United States)

    Meneghelli, Barry; Mcnulty, R. J.; Springer, Mike; Lueck, Dale E.


    The hypergolic propellant nitrogen tetroxide (N2O4 or NTO) is routinely used in spacecraft launched at Kennedy Space Center (KSC) and Cape Canaveral Air Station (CCAS). In the case of a catastrophic failure of the spacecraft, there would be a release of the unspent propellant in the form of a toxic cloud. Inhalation of this material at downwind concentrations which may be as high as 20 parts per million (ppm) for 30 minutes in duration, may produce irritation to the eyes, nose and respiratory tract. Studies at both KSC and CCAS have shown that the indoor concentrations of N2O4 during a toxic release may range from 1 to 15 ppm and depend on the air change rate (ACR) for a particular building and whether or not the air conditioning (A/C) system has been shut down or left in an operating mode. This project was initiated in order to assess how current A/C systems could be easily modified to prevent personnel from being exposed to toxic vapors. A sample system has been constructed to test the ability of several types of filter material to capture the N2O4 vapors prior to their infiltration into the A/C system. Test results will be presented which compare the efficiencies of standard A/C filters, water wash systems, and chemically impregnated filter material in taking toxic vapors out of the incoming air stream.

  15. ISTTOK upgrade towards AC and remote operation

    International Nuclear Information System (INIS)

    ISTTOK has performed one of the earliest experiments of AC tokamak operation showing that long discharges could be produced merely with inductive current drive. However, due to the design of the machine, the data acquisition system and the power supplies, a limit of 250 ms (six times the nominal forward shot duration) is currently imposed.In this paper the relevant constrains to attain current operation up to the limit of the stable toroidal magnetic field (3s) are discussed and the work being carried out to achieve this goal is presented.The conditions that shall be accomplished are: (i) removing the power deposited on the limiters; (ii) density control through gas puffing and monitoring the recycling from the walls; (iii) assessment of the free magnetic flux available on the iron core (Wmax=0.2 Vs); (iv) reformulation of the data acquisition system towards an event driven philosophy maintaining the actual distributed architecture but allowing a real-time control; (v) active control of the equilibrium magnetic fields implementing a digital plasma position estimator and actuator through new power supplies for the poloidal magnetic fields. As a new high level software was needed to implement all this features, the ISTTOK data acquisition system and control has been totally redesigned in JAVA/SQL database technology and time stamps events were adopted to catalogue the data. This software has been design keeping in mind the needs for remote participation and operation of the machine. Therefore, a cooperative environment has been implemented where several persons can be connected together to the platform, programming their own devices and exchanging knowledge or opinions through an embedded chat

  16. ISTTOK upgrade towards AC and remote operation (United States)

    Fernandes, H.; Silva, C.; Carvalho, B.; Sousa, J.; Valcárcel, D.; Neto, A.; Fortunato, J.; Carvalho, I.; Varandas, C. A. F.


    ISTTOK has performed one of the earliest experiments of AC tokamak operation showing that long discharges could be produced merely with inductive current drive. However, due to the design of the machine, the data acquisition system and the power supplies, a limit of 250 ms (six times the nominal forward shot duration) is currently imposed. In this paper the relevant constrains to attain current operation up to the limit of the stable toroidal magnetic field (3s) are discussed and the work being carried out to achieve this goal is presented. The conditions that shall be accomplished are: (i) removing the power deposited on the limiters; (ii) density control through gas puffing and monitoring the recycling from the walls; (iii) assessment of the free magnetic flux available on the iron core (Wmax=0.2 Vs); (iv) reformulation of the data acquisition system towards an event driven philosophy maintaining the actual distributed architecture but allowing a real-time control; (v) active control of the equilibrium magnetic fields implementing a digital plasma position estimator and actuator through new power supplies for the poloidal magnetic fields. As a new high level software was needed to implement all this features, the ISTTOK data acquisition system and control has been totally redesigned in JAVA/SQL database technology and time stamps events were adopted to catalogue the data. This software has been design keeping in mind the needs for remote participation and operation of the machine. Therefore, a cooperative environment has been implemented where several persons can be connected together to the platform, programming their own devices and exchanging knowledge or opinions through an embedded chat.

  17. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Directory of Open Access Journals (Sweden)

    Kerry N. Allahar


    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  18. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi; /Texas U.


    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f {approx} 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  19. Controlo de um conversor AC-DC-AC para turbinas eólicas baseadas no PMSG


    Bulhosa, João Paulo Rodrigues


    A dissertação teve como objectivo o estudo e implementação do controlo de um conversor AC-DC-AC, constituído por um conversor DC/DC elevador e um inversor de tensão monofásico, para efectuar a ligação à rede de turbinas eólicas baseadas no gerador síncrono de ímanes permanentes. O controlo global do conversor AC-DC-AC seguiu uma estratégia na qual o controlo do conversor elevador e do inversor de tensão monofásico é implementado de modo independente. O primeiro visa maximizar a potência ex...

  20. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.


    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  1. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax development in the Indian malaria vector Anopheles culicifacies (Diptera: culicidae)

    Indian Academy of Sciences (India)

    Manoj Chugh; B R Gulati; S K Gakhar


    A repertoire of monoclonal antibodies (mAbs) was generated against the midgut proteins of Anopheles culicifacies mosquitoes. The mAbs AC-43 and AC-29 significantly inhibited Plasmodium vivax development inside the mosquito midgut. The number of oocysts that developed was reduced by 78.6% when mosquitoes ingested a combination of these two mAbs along with the blood meal. AC-43 mAb binds to the epitope common in 97, 80 and 43 kDa polypeptides from the midgut protein extract, as indicated by western blot analysis. Similarly, the mAb AC-29 recognized 52, 44, 40 and 29 kDa polypeptides. These female midgut-specific polypeptides are shared between An. culicifacies and An. stephensi, two major vectors of malaria in India. Deglycosylation assays revealed that -linked carbohydrates are the major components in epitopes corresponding to AC-43 and AC-29. Gold particle labelling revealed that both these mAbs preferentially bind to glycoproteins at the apical microvilli and the microvillus-associated network present inside transverse sections of the gut epithelium. These regions are particularly known to have receptors for ookinetes, which enable them to cross this epithelial barrier and provide them with certain necessary chemicals or components for further development into oocysts. Therefore, these glycoproteins appear to be potential candidates for a vectordirected transmission-blocking vaccine (TBV).

  2. Temas de Física para Ingeniería: Acústica


    Beléndez Vázquez, Augusto


    Acústica, fluidos y termodinámica: "Acústica". Ondas sonoras, propagación. Sonidos puros, sonidos complejos y ruidos. Velocidad de propagación del sonido. Intensidad del sonido y potencia acústica. Impedancia acústica y transmisión del sonido. Medición del campo acústico: niveles. Audición. Interferencia de ondas sonoras y pulsaciones. Tubos sonoros. Efecto Doppler.

  3. Analysis of AC loss in superconducting power devices calculated from short sample data


    Rabbers, J.J.; Haken, ten, Bennie; Kate, ten, F.J.W.


    A method to calculate the AC loss of superconducting power devices from the measured AC loss of a short sample is developed. In coils and cables the magnetic field varies spatially. The position dependent field vector is calculated assuming a homogeneous current distribution. From this field profile and the transport current, the local AC loss is calculated. Integration over the conductor length yields the AC loss of the device. The total AC loss of the device is split up in different compone...

  4. Behaviour analysis of AC-600 passive safety systems

    International Nuclear Information System (INIS)

    Southwest Center of Reactor Engineering Research and Design has finished the first step conceptual design of 600 mwe advanced PWR (AC-600). The main research emphases of AC-600 conceptual design include the advanced reactor core, the passive safety systems and the simplification. The passive safety systems of AC-600 consist of two reactor make up water tanks, two accumulators, two emergency feedwater tanks, two emergency natural draft air condensers, a containment water jacket and an enhanced primary cycle natural circulation flow system. 25% of the rated reactor power can be removed by the natural circulation cooling. The full pressure reactor make up water tanks are able to provide enough borated water which would be injected into the reactor coolant system during small LOCA. The coolant natural circulations can be established in the primary system and the passive secondary emergency feedwater system, removing residual heat from the reactor core to the atmosphere when station blackout occurs. It is indicated from analysis that the containment diameter of AC-600 is about 35 m. The large tanks and the large vertical distances between the tanks and reactor core are the main reason of using the big containment. It is also indicated from analysis that the low head safety injection pumps are required in AC-600 design to assure the recirculation system operation when large LOCA occurs. The reliability of AC-600 engineered safety systems is increased because the function of the passive safety systems is conducted through the immutable natural laws. The paper discusses the natural circulation ability and safety behavior of the passive safety systems during LOCA or station blackout for AC-600. The passive limits to excess reactivity and thermal hydraulic transients are also preliminarily discussed. Figs and tabs

  5. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede


    these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...... to minimize the overall energy cost or in case of special applications, to improve the system redundancy. Also, having a generator that can simultaneously feed fractions of its power into multiple grids which are not coupled (different voltage, frequency, displacement angle) and continuously adjust...

  6. Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

    Directory of Open Access Journals (Sweden)



    Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

  7. The Olkiluoto 3 project

    International Nuclear Information System (INIS)

    This series of slides presents the Olkiluoto 3 project involving the EPR (European Pressurized water Reactor). This EPR is the first reactor of third generation to have be put into construction. The contract was signed between the Areva-Siemens consortium and the Tvo Finn company in december 2003. The construction of the first-off reactor is always a big challenge but also opens the way for its industrial development as it brings knowledge and experience: Olkiluoto is the first international licensing of the EPR, a valuable feedback experience has been acquired on both the fabrication of the primary components and the qualification of the suppliers. A point on the state of the construction works is made at the first term 2009. (A.C.)

  8. Modelling ac ripple currents in HTS coated conductors (United States)

    Xu, Zhihan; Grilli, Francesco


    Dc transmission using high temperature superconducting (HTS) coated conductors (CCs) offers a promising solution to the globally growing demand for effective, reliable and economic transmission of green energy up to the gigawatt level over very long distances. The credible estimation of the losses and thereby the heat dissipation involved, where ac ripples (introduced in rectification/ac-dc conversion) are viewed as a potential source of notable contribution, is highly essential for the rational design of practical HTS dc transmission cables and corresponding cryogenic systems to fulfil this demand. Here we report a targeted modelling study into the ac losses in a HTS CC subject to dc and ac ripple currents simultaneously, by solving Maxwell’s equations using the finite element method (FEM) in the commercial software package COMSOL. It is observed that the instantaneous loss exhibits only one peak per cycle in the HTS CC subject to sinusoidal ripples, given that the amplitude of the ac ripples is smaller than approximately 20% of that of the dc current. This is a distinct contrast to the usual observation of two peaks per cycle in a HTS CC subject to ac currents only. The unique mechanism is also revealed, which is directly associated with the finding that, around any local minima of the applied ac ripples, the critical state of -J c is never reached at the edges of the HTS CC, as it should be according to the Bean model. When running further into the longer term, it is discovered that the ac ripple loss of the HTS CC in full-wave rectification decays monotonically, at a speed which is found to be insensitive to the frequency of the applied ripples within our targeted situations, to a relatively low level of approximately 1.38 × 10-4 W m-1 in around 1.7 s. Comparison between this level and other typical loss contributions in a HTS dc cable implies that ac ripple currents in HTS CCs should only be considered as a minor source of dissipation in superconducting dc

  9. AC Zeeman potentials for atom chip-based ultracold atoms (United States)

    Fancher, Charles; Pyle, Andrew; Ziltz, Austin; Aubin, Seth


    We present experimental and theoretical progress on using the AC Zeeman force produced by microwave magnetic near-fields from an atom chip to manipulate and eventually trap ultracold atoms. These AC Zeeman potentials are inherently spin-dependent and can be used to apply qualitatively different potentials to different spin states simultaneously. Furthermore, AC Zeeman traps are compatible with the large DC magnetic fields necessary for accessing Feshbach resonances. Applications include spin-dependent trapped atom interferometry and experiments in 1D many-body physics. Initial experiments and results are geared towards observing the bipolar detuning-dependent nature of the AC Zeeman force at 6.8 GHz with ultracold 87Rb atoms trapped in the vicinity of an atom chip. Experimental work is also underway towards working with potassium isotopes at frequencies of 1 GHz and below. Theoretical work is focused on atom chip designs for AC Zeeman traps produced by magnetic near-fields, while also incorporating the effect of the related electric near-fields. Electromagnetic simulations of atom chip circuits are used for mapping microwave propagation in on-chip transmission line structures, accounting for the skin effect, and guiding impedance matching.

  10. Aragonite coating solutions (ACS) based on artificial seawater (United States)

    Tas, A. Cuneyt


    Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  11. AC losses in circular arrangements of parallel superconducting tapes

    DEFF Research Database (Denmark)

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred; Olsen, Søren Krüger; Tønnesen, Ole

    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  12. AC losses in circular arrangements of parallel superconducting tapes

    DEFF Research Database (Denmark)

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred;


    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  13. Development project of small accelerator

    CERN Document Server

    Yamada, S


    The object of this project is demonstration of a small proton and heavy ion synchrotron and a small hard X-ray photon radiation source by using new technology and application of them to therapy, diagnosis, material science and life science. In this paper, a part of small proton and heavy ion synchrotron is discussed. Nine organizations joined in this project. There are four development themes such as optimization of laser-ion 100 TW class source target, beam storage and cooling device, small synchrotron ring and FFAG accelerator. Outline and contents of development of them are explained. This project is planning to generate a few MeV/u carbon ions in fully ionized states by impact of laser with about 100 TW output. 3 T maximum bending magnetic field using normal conduction AC magnet will be actualized for synchrotron with 200 MeV proton beam. (S.Y.)

  14. Intending Projects

    Institute of Scientific and Technical Information of China (English)


    Project name: 90,000t/a BR device and auxiliary projects Construction unit: Sinopec Beijing Yanshan Petrochemical Company Total investment: 2.257 billion yuan Project description: It will cover an area of 14. lha.

  15. System and method for determining stator winding resistance in an AC motor using motor drives

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Bin; Habetler, Thomas G; Zhang, Pinjia


    A system and method for determining the stator winding resistance of AC motors is provided. The system includes an AC motor drive having an input connectable to an AC source and an output connectable to an input terminal of an AC motor, a pulse width modulation (PWM) converter having switches therein to control current flow and terminal voltages in the AC motor, and a control system connected to the PWM converter. The control system generates a command signal to cause the PWM converter to control an output of the AC motor drive corresponding to an input to the AC motor, selectively generates a modified command signal to cause the PWM converter to inject a DC signal into the output of the AC motor drive, and determines a stator winding resistance of the AC motor based on the DC signal of at least one of the voltage and current.

  16. Development of a New Class of Low Cost, High Frequency Link Direct DC to AC Converters for Solid Oxide Fuel Cells (SOFC)

    Energy Technology Data Exchange (ETDEWEB)

    Prasad Enjeti; J.W. Howze


    This project proposes to design and develop a new class of power converters (direct DC to AC) to drastically improve performance and optimize the cost, size, weight and volume of the DC to AC converter in SOFC systems. The proposed topologies employ a high frequency link; direct DC to AC conversion approach. The direct DC to AC conversion approach is more efficient and operates without an intermediate dc-link stage. The absence of the dc-link, results in the elimination of bulky, aluminum electrolytic capacitors, which in turn leads to a reduction in the cost, volume, size and weight of the power electronic converter. The feasibility of two direct DC to AC converter topologies and their suitability to meet SECA objectives will be investigated. Laboratory proto-type converters (3-5kW) will be designed and tested in Phase-1. A detailed design trade-off study along with the test results will be available in the form of a report for the evaluation of SECA Industrial partners. This project proposes to develop a new and innovative power converter technology suitable for Solid Oxide Fuel Cell (SOFC) power systems in accordance with SECA objectives. The proposed fuel cell inverter (FCI) employs state of the art power electronic devices configured in two unique topologies to achieve direct conversion of DC power (24-48V) available from a SOFC to AC power (120/240V, 60Hz) suitable for utility interface and powering stand alone loads. The primary objective is to realize cost effective fuel cell converter, which operates under a wide input voltage range, and output load swings with high efficiency and improved reliability.

  17. On the Application of TLS Techniques to AC Electrical Drives

    Directory of Open Access Journals (Sweden)

    M. Cirrincione


    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  18. Voltage drop of the SACLA AC power supply

    International Nuclear Information System (INIS)

    We installed the AC power supply of SACLA by construction. The AC power supply is connected to an inverter power supply. Because of charge and discharge to a modulator, it is necessary to supply pulsatile electricity. The total consumption electricity of approximately 70 modulators extends to 5,000kVA. A severe electric current flows, and repeats relaxing. The influence of the voltage change by the impedance of the distribution system grows big, too. In SACLA, we designed the voltage regulation at less than 10%. SACLA succeeded in laser oscillation in this June. Because we was able to put it in the predetermined voltage regulation in the machine AC power supply, I report the details. (author)

  19. Neural network based PWM AC chopper fed induction motor drive

    Directory of Open Access Journals (Sweden)

    Venkatesan Jamuna


    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  20. Microdischarges of AC-coupled silicon strip sensors

    International Nuclear Information System (INIS)

    Microdischarge at the edges of strips in AC-coupled silicon strip sensors has been investigated. A steep increase in the leakage current (breakdown) and a sudden onset of burst noise were observed at a low reverse-bias voltage when the bias potential was across the AC-coupling capacitor. This can be explained by the occurrence of microdischarges along the edges of strips. These discharges have been confirmed by observing IR light emission. A calculation of the field strength at the strip edge suggests that a fringe field of the external electrode generates the microdischarge at the strip edge when the bias voltage is 50-80 V. This is consistent with our observations. We discuss a design for AC-coupled sensors that eliminates this discharge problem. (orig.)

  1. Analysis of ac Surface Photovoltages in Accumulation Region (United States)

    Munakata, Chusuke


    Equations for ac surface photovoltages (SPVs) excited with a chopped photon beam (PB) in the accumulation region are proposed for such semiconductors as silicon and germanium. Following the previously reported half-sided junction model for the depleted or inverted region, equations for photocurrent density and surface impedance per unit area have been newly deduced. When the surface potential is highly negative in p-type semiconductors, the maximum ac SPV in the accumulation region is limited by the conductance due to majority carrier diffusion flow. This is compared with the strong inversion region, where the mathematically maximum SPV depends upon the minority carrier diffusion flow. The voltage ratio between the two maximum ac SPVs is the same as that previously reported using the different models for dc SPVs excited with a continuous PB.

  2. Experiments on Corona Discharge Under AC and DC Composite Voltage

    Institute of Scientific and Technical Information of China (English)

    ZHU Zhengyi; LI Ruihai; WANG Guoli; CHEN Can; JIA Zhidong; GUAN Zhicheng


    Converter transformers are one of the most important electrical apparatuses in the ultra high voltage(UHV) DC transmission systems.The valve side and the low voltage(LV) bushing are stressed by long-term AC and DC composite voltage leading to significant partial discharge(PD) and posing great danger to the insulation system.In this paper AC and DC composite voltage is applied on a metal needle-plate model to produce PD signal sequences,and then the pulse waveshape and frequency spectrum are analyzed and compared with PD signals under conventional AC or DC voltage.In the end,the phase-resolved distribution is analyzed to depict the new characteristics of PD under this composite voltage.

  3. Encapsulation of α-Particle–Emitting 225Ac3+ Ions Within Carbon Nanotubes (United States)

    Matson, Michael L.; Villa, Carlos H.; Ananta, Jeyarama S.; Law, Justin J.; Scheinberg, David A.; Wilson, Lon J.


    225Ac3+ is a generator of α-particle–emitting radionuclides with 4 net α-particle decays that can be used therapeutically. Targeting 225Ac3+ by use of ligands conjugated to traditional bifunctional chelates limits the amount of 225Ac3+ that can be delivered. Ultrashort, single-walled carbon nanotubes (US-tubes), previously demonstrated as sequestering agents of trivalent lanthanide ions and small molecules, also successfully incorporate 225Ac3+. Methods Aqueous loading of both 225Ac3+ ions and Gd3+ ions via bath sonication was used to construct 225Ac@gadonanotubes (225Ac@GNTs). The 225Ac@GNTs were subsequently challenged with heat, time, and human serum. Results US-tubes internally loaded with both 225Ac3+ ions and Gd3+ ions show 2 distinct populations of 225Ac3+ ions: one rapidly lost in human serum and one that remains bound to the US-tubes despite additional challenge with heat, time, and serum. The presence of the latter population depended on cosequestration of Gd3+ and 225Ac3+ ions. Conclusion US-tubes successfully sequester 225Ac3+ ions in the presence of Gd3+ ions and retain them after a human serum challenge, rendering 225Ac@GNTs candidates for radioimmunotherapy for delivery of 225Ac3+ ions at higher concentrations than is currently possible for traditional ligand carriers. PMID:25931476

  4. Initial experience with AcQsim CT simulator

    International Nuclear Information System (INIS)

    Purpose: We recently replaced our university developed CT simulator prototype with a commercial grade spiral CT simulator (Picker AcQsim) that is networked with three independent virtual simulation workstations and our 3D radiation therapy planning (3D-RTP) system multiple workstations. This presentation will report our initial experience with this CT simulation device and define criteria for optimum clinical use as well as describe some potential drawbacks of the current system. Methods and Materials: Over a 10 month period, 210 patients underwent CT simulation using the AcQsim. An additional 127 patients had a volumetric CT scan done on the device with their CT data and target and normal tissue contours ultimately transferred to our 3D-RTP system. We currently perform the initial patient localization and immobilization in the CT simulation suite by using CT topograms and a fiducial laser marking system. Immobilization devices, required for all patients undergoing CT simulation, are constructed and registered to a device that defines the treatment table coordinates. Orthogonal anterior and lateral CT topograms document patient alignment and the position of a reference coordinate center. The volumetric CT scan with appropriate CT contrast materials administered is obtained while the patient is in the immobilization device. On average, more than 100 CT slices are obtained per study. Contours defining tumor, target, and normal tissues are drawn on a slice by slice basis. Isocenter definition can be automatically defined within the target volume and marked on the patient and immobilization device before leaving the initial CT simulation session. Virtual simulation is then performed on the patient data set with the assistance of predefined target volumes and normal tissue contours displayed on rapidly computed digital reconstructed radiographs (DRRs) in a manner similar to a conventional fluoroscopic radiotherapy simulator. Lastly, a verification simulation is

  5. AC power losses in Bi-2223/Ag HTS tapes

    International Nuclear Information System (INIS)

    Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude Im of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ Imn for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour

  6. Aligned Immobilization of Proteins Using AC Electric Fields. (United States)

    Laux, Eva-Maria; Knigge, Xenia; Bier, Frank F; Wenger, Christian; Hölzel, Ralph


    Protein molecules are aligned and immobilized from solution by AC electric fields. In a single-step experiment, the enhanced green fluorescent proteins are immobilized on the surface as well as at the edges of planar nanoelectrodes. Alignment is found to follow the molecules' geometrical shape with their longitudinal axes parallel to the electric field. Simultaneous dielectrophoretic attraction and AC electroosmotic flow are identified as the dominant forces causing protein movement and alignment. Molecular orientation is determined by fluorescence microscopy based on polarized excitation of the proteins' chromophores. The chromophores' orientation with respect to the whole molecule supports X-ray crystal data. PMID:26779699

  7. AC transport in graphene-based Fabry-Perot devices


    Rocha, Claudia G; Torres, Luis E. F. Foa; Cuniberti, Gianaurelio


    We report on a theoretical study of the effects of time-dependent fields on electronic transport through graphene nanoribbon devices. The Fabry-P\\'{e}rot interference pattern is modified by an ac gating in a way that depends strongly on the shape of the graphene edges. While for armchair edges the patterns are found to be regular and can be controlled very efficiently by tuning the ac field, samples with zigzag edges exhibit a much more complex interference pattern due to their peculiar elect...

  8. A.C. losses in current-carrying superconductors

    International Nuclear Information System (INIS)

    The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)

  9. AC Loss Analysis on the Superconducting Coupling Magnet in MICE

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Hong; Wang, Li; Green, Michael; Li, LanKai; Xu, FengYu; Liu, XiaoKun; Jia, LinXinag


    A pair of coupling solenoids is used in MICE experiment to generate magnetic field which keeps the muons within the iris of thin RF cavity windows. The coupling solenoids have a 1.5-meter inner diameter and will produce 7.4 T peak magnetic field. Three types of AC losses in coupling solenoid are discussed. The affect of AC losses on the temperature distribution within the cold mass during charging and rapid discharging process is analyzed also. The analysis result will be further confirmed by the experiment of the prototype solenoid for coupling solenoid, which will be designed, fabricated and tested at ICST.

  10. Comportamiento acústico de espacios cubiertos con estructuras textiles


    Maya Simoes, Flavio


    En el presente trabajo estudiamos el comportamiento acústico de espacios cubiertos con textiles. Presentamos una reseña histórica de usos de textiles en la arquitectura, de la prehistoria hasta hoy. Realizamos una búsqueda bibliográfica y presentamos los resultados encontrados. Presentamos la metodología actual de análisis acústico que se utiliza en ensayos de laboratorio, simulaciones y mediciones. Estudiamos la absorción sonora de los materiales de las cubiertas textiles, en ensayos de labo...

  11. Interplay between electron overheating and ac Josephson effect (United States)

    De Cecco, A.; Le Calvez, K.; Sacépé, B.; Winkelmann, C. B.; Courtois, H.


    We study the response of high-critical-current proximity Josephson junctions to a microwave excitation. Electron overheating in such devices is known to create hysteretic dc voltage-current characteristics. Here we demonstrate that it also strongly influences the ac response. The interplay of electron overheating and ac Josephson dynamics is revealed by the evolution of the Shapiro steps with the microwave drive amplitude. Extending the resistively shunted Josephson junction model by including a thermal balance for the electronic bath coupled to phonons, a strong electron overheating is obtained.

  12. EHV AC undergrounding electrical power performance and planning

    CERN Document Server

    Benato, Roberto


    EHV AC Undergrounding Electrical Power discusses methods of analysis for cable performance and for the behaviour of cable, mixed and overhead lines. The authors discuss the undergrounding of electrical power and develop procedures based on the standard equations of transmission lines. They also provide technical and economical comparisons of a variety of cables and analysis methods, in order to examine the performance of AC power transmission systems. A range of topics are covered, including: energization and de-energization phenomena of transmission lines; power quality; and cable safety cons

  13. Geodetska dela pri izgradnji AC priključka Naklo


    Pavc, Iztok


    V diplomski nalogi sem predstavil geodetska dela pri izgradnji AC priključka Naklo. Opisana so dela pred, med in po izgradnji objekta. V prvem poglavju sem predstavil smernice in načrte nove ureditve priključka na avtocesto ter obseg gradnje AC priključka Naklo. Nadaljeval sem z geodetskimi deli pred gradnjo, ki so potrebni za pripravo dobrega izhodišča za nadaljnja delo med gradnjo. Opisani so vsi postopki, ki so bili opravljeni pred pripravo projekta za gradbeno dovoljenje (PGD) in tudi pre...

  14. Dynamic conductivity of ac-dc-driven graphene superlattice (United States)

    Kukhar', E. I.; Kryuchkov, S. V.; Ionkina, E. S.


    The dynamic conductivity of graphene superlattice in the presence of ac electric field and dc electric field with longitudinal and transversal components with respect to superlattice axis was calculated. In the case of strong transversal component of dc field conductivity of graphene superlattice was shown to be such as if the electrons had got the effective mass. In the case of weak transversal component of dc field conductivity was shown to change its sign if the frequency of ac field was an integer multiple of half of Bloch frequency.

  15. Development of an AC Module System: Final Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Suparna Kadam; Miles Russell


    The GreenRay Inc. program focused on simplifying solar electricity and making it affordable and accessible to the mainstream population. This was accomplished by integrating a solar module, micro-inverter, mounting and monitoring into a reliable, 'plug and play' AC system for residential rooftops, offering the following advantages: (1) Reduced Cost: Reduction in installation labor with fewer components, faster mounting, faster wiring. (2) Maximized Energy Production: Each AC Module operates at its maximum, reducing overall losses from shading, mismatch, or module downtime. (3) Increased Safety. Electrical and fire safety experts agree that AC Modules have significant benefits, with no energized wiring or live connections during installation, maintenance or emergency conditions. (4) Simplified PV for a Broader Group of Installers. Dramatic simplification of design and installation of a solar power system, enabling faster and more efficient delivery of the product into the market through well-established, mainstream channels. This makes solar more accessible to the public. (5) Broadened the Rooftop Market: AC Modules enable solar for many homes that have shading, split roofs, or obstructions. In addition, due to the smaller building block size of 200W vs. 1000W, homeowners with budget limitations can start small and add to their systems over time. Through this DOE program GreenRay developed the all-in-one AC Module system with an integrated PV Module and microinverter, custom residential mounting and performance monitoring. Development efforts took the product from its initial concept, through prototypes, to a commercial product sold and deployed in the residential market. This pilot deployment has demonstrated the technical effectiveness of the AC Module system in meeting the needs and solving the problems of the residential market. While more expensive than the traditional central inverter systems at the pilot scale, the economics of AC Modules become

  16. Stretched exponential relaxation and ac universality in disordered dielectrics

    DEFF Research Database (Denmark)

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens


    This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are...... stretched exponential character of dielectric relaxation, power-law power spectral density, and anomalous dependence of ac conduction coefficient on frequency. We propose a self-consistent model of dielectric relaxation in which the relaxations are described by a stretched exponential decay function...

  17. L’acétaminophène chez les enfants (United States)

    Goldman, Ran D.


    Résumé Question Je suggère fréquemment aux parents d’utiliser de l’acétaminophène comme traitement de la fièvre et de la douleur pour leurs enfants. J’ai récemment reçu un enfant à mon cabinet qui s’est présenté avec une éruption cutanée sous forme de lésions en cibles une journée après avoir pris de l’acétaminophène. L’éruption s’est résorbée 3 jours après qu’on ait arrêté l’administration d’acétaminophène. L’acétaminophène comporte-t-elle des risques d’événements indésirables comme celui-ci? Réponse Comme les autres médicaments ou substances actives, les préparations d’acétaminophène pourraient poser des risques d’événements indésirables. Au cours des dernières années, on a procédé à une investigation concernant une association potentielle entre l’acétaminophène et l’asthme et la Food and Drug Administration des États-Unis a récemment publié un avertissement à propos de réactions cutanées éventuelles, graves mais rares, associées à l’acétaminophène. Même si l’acétaminophène est principalement un médicament sûr, les professionnels de la santé devraient être alertes et informer les parents à propos de la possibilité d’événements indésirables rares mais sévères.

  18. Programmable Power Supply for AC Switching Magnet of Proton Accelerator

    CERN Document Server

    Jeong, Seong-Hun; Kang Heung Sik; Lee, Chi-Hwan; Lee, Hong-Gi; Park, Ki-Hyeon; Ryu, Chun-Kil; Sik Han, Hong; Suck Suh, Hyung


    The 100-MeV PEFP proton linac has two proton beam extraction lines for user' experiment. Each extraction line has 5 beamlines and has 5 Hz operating frequency. An AC switching magnet is used to distribute the proton beam to the 5 beamlines, An AC switching magnet is powered by PWM-controlled bipolar switching-mode converters. This converter is designed to operate at ±350A, 5 Hz programmable step output. The power supply is employed IGBT module and has controlled by a DSP (Digital Signal Process). This paper describes the design and test results of the power supply.

  19. Dicty_cDB: FCL-AC27 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tnkqktsdesashkylc kiyi**iliflfilfsc*slsdfpnikkkkkkkk Homology vs CSM-cDNA Score E Sequences pr... Representativ...e seq. ID FCL-AC27Z (Link to Original site) Representative DNA sequence >FCL-AC27 (FCL-AC27Q) /CSM/FCL/FCL-A...VDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPP ERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tnkqktsdesas.../CSM/SF/SFJ3-A/SFJ302Q.Seq.d/ 1045 0.0 own update 2004.12.25 Homology vs DNA Score E Sequences producing sig

  20. Dicty_cDB: FCL-AC10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Representativ...e seq. ID FCL-AC10Z (Link to Original site) Representative DNA sequence >FCL-AC10 (FCL-AC10Q) /CSM/FCL/FCL-A...LTALAPSTMKIKIIAPP ERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tiktsdesashtnkyi* my...GNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPP ERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tiktsdesashtnkyi* mynnnki....00 m_ : 1.00 40.0 %: nuclear 36.0 %: cytoplasmic 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> pre

  1. Impacts on Power Factor of AC Voltage Controllers Under Non-Sinusoidal Conditions

    Directory of Open Access Journals (Sweden)

    Mukhtiar Ahmed Mahar


    Full Text Available AC-AC conversion is obtained with the help of Cyclo-converters, DC Link converters and AC Voltage Controllers. AC voltage controllers are also referred to as voltage regulators. Main issue concerned to these converters is that they generate harmonics due to periodic variable structure system. The generated harmonics create disturbances and degrade the performance of converter. The power factor of supply side is affected due to these harmonics. This paper focuses on source side power factor of ac voltage controllers under nonsinusoidal conditions. In order to observe the power factor, measurement tool of power factor and simulation model of ac voltage controller is also developed in MATLAB software.

  2. The ACS Survey of Galactic Globular Clusters. I. Overview and Clusters Without Previous HST Photometry

    CERN Document Server

    Sarajedini, A; Chaboyer, B; Dotter, A; Siegel, M; Anderson, J; Aparicio, A; King, I; Majewski, S; Marin-Franch, A; Piotto, G; Reid, I N; Rosenberg, A L; Sarajedini, Ata


    We present the first results of a large ACS Survey of Galactic globular clusters. This Hubble Space Telescope (HST) Treasury project is designed to obtain photometry with S/N > ~10 for main sequence stars with masses > ~0.2Msun in a sample of globulars using the Advanced Camera for Surveys (ACS) Wide Field Channel. Here we focus on clusters without previous HST imaging data. These include NGC 5466, 6779, 5053, 6144, Palomar 2, E 3, Lynga 7, Palomar 1, and NGC 6366. Our CMDs extend reliably from the horizontal branch to as much as seven magnitudes fainter than the main sequence turnoff and represent the deepest CMDs published to-date for these clusters. Using fiducial sequences for three standard clusters (M92, NGC 6752, and 47 Tuc) with well-known metallicities and distances, we perform main sequence fitting on the target clusters in order to obtain estimates of their distances and reddenings. These comparisons along with fitting the cluster main sequences to theoretical isochrones yield ages for the target c...

  3. Design of a Temperature Sensitive Voltage Regulator for AC Load using RTD

    Directory of Open Access Journals (Sweden)

    Tasnuva Chowdhury,


    Full Text Available Voltage regulation of an electrical load has always been a necessity with the variation of atmospheric temperature. Human body undergoes troubles and sufferings when there is a certain change arises in the surrounding temperature and he or she might not be able to cope up with the sudden environmental change. To make life easier and better adjusted to the natural temperature change, a temperature sensitive voltage regulator have been designed and implemented in this work. Here a temperature sensor called Resistor Temperature Detector (RTD is used for temperature sensing purpose which delivers its output to the input of a voltage controller circuit and can subsequently control the speed of any light AC electrical load according to the variable temperature. In our project , the RTD was able to take the reading from 26oC to 38oC accurately. Moreover, the room temperature is also made visible by two 7-segment display. The circuit is synchronized and tested with the cheapest AC load (bulb availablein the market.

  4. Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Eriko Kage-Nakadai

    Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

  5. NRT Atmospheric Water Vapour Retrieval on the Area of Poland at IGG WUELS AC (United States)

    Kaplon, Jan; Bosy, Jaroslaw; Sierny, Jan; Hadas, Tomasz; Rohm, Witold; Wilgan, Karina; Ryczywolski, Marcin; Oruba, Artur; Kroszczynski, Krzysztof


    Global Navigation Satellite Systems (GNSS) are designed for positioning, navigation and amongst other possible applications it can also be used to derive information about the state of the atmosphere. Continuous observations from GNSS receivers provide an excellent tool for studying the neutral atmosphere, currently in near real-time. The Near Real-Time (NRT) neutral atmosphere and water vapour distribution models are currently obtained with high resolution from Ground Base Augmentation Systems (GBAS), where reference stations are equipped with GNSS and meteorological sensors. The Poland territory is covered by dense network of GNSS stations in the frame of GBAS system called ASG-EUPOS ( This system was established in year 2008 by the Head Office of Geodesy and Cartography in the frame of the EUPOS project ( for providing positioning services. The GNSS data are available from 130 reference stations located in Poland and neighbour countries. The ground meteorological observations in the area of Poland and neighbour countries are available from ASG-EUPOS stations included in EUREF Permanent Network (EPN) stations, airports meteorological stations (METAR messages stations), and stations managed by national Institute of Meteorology and Water Management (SYNOP messages stations). Institute of Geodesy and Geoinformatics (IGG) of Wroclaw University of Environmental and Life Sciences had created permanent NRT service of ZTD (Zenith Total Delay) estimation for the area of Poland from GPS observations called IGGHZG. The first part of the paper presents the methodology of NRT GNSS data processing for ASG-EUPOS stations for ZTD estimation and its comparison to the results coming from EPN ACs and Military University of Technology in Warsaw AC (MUT AC). Second part covers the procedure of IWV (atmospheric Integrated Water Vapour content) estimation at IGG from IGGHZG product and ZHD (Zenith Hydrostatic Delay) derived from Saastamoinen formula (1972

  6. Effect of combining a DC bias current with an AC transport current on AC losses in a High Temperature Superconductor


    Dolez, Patricia; Ligneris, Benoit des; Aubin, Marcel; Zhu, When; Cave, Julian


    Creating complex flux configurations by superposing a dc current or magnetic field onto the ac current in a type II superconducting tape should lead to a variety of peculiar behaviors. An example is the appearance of the Clem valley, a minimum in the ac losses as a function of the dc bias amplitude, which has been theoretically studied by LeBlanc et al., in the continuation of Clem's calculations. These situations have been investigated by applying a dc current to a silver-gold sheathed Bi-22...



    Wang, Kunrong


    The generic concept of quasi-single-stage (QSS) power conversion topology for ac-dc rectification and dc-ac inversion is proposed. The topology is reached by direct cascading and synchronized switching of two variety of buck or two variety of boost switching networks. The family of QSS power converters feature single-stage power processing without a dc-link low-pass filter, a unidirectional pulsating dc-link voltage, soft-switching capability with minimal extra commutation circuitry, simple...

  8. Project Management

    DEFF Research Database (Denmark)

    Project Management Theory Meets Practice contains the proceedings from the 1st Danish Project Management Research Conference (DAPMARC 2015), held in Copenhagen, Denmark, on May 21st, 2015.......Project Management Theory Meets Practice contains the proceedings from the 1st Danish Project Management Research Conference (DAPMARC 2015), held in Copenhagen, Denmark, on May 21st, 2015....

  9. Define Project

    DEFF Research Database (Denmark)

    Munk-Madsen, Andreas


    "Project" is a key concept in IS management. The word is frequently used in textbooks and standards. Yet we seldom find a precise definition of the concept. This paper discusses how to define the concept of a project. The proposed definition covers both heavily formalized projects and informally...... organized, agile projects. Based on the proposed definition popular existing definitions are discussed....

  10. Context based computational analysis and characterization of ARS consensus sequences (ACS) of Saccharomyces cerevisiae genome. (United States)

    Singh, Vinod Kumar; Krishnamachari, Annangarachari


    Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS) requires an essential consensus sequence (ACS) for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC) denoted as ORC-ACS and non-replicating ACS sequences (nrACS), that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme. PMID:27508123

  11. Autographa californica multiple nucleopolyhedrovirus gene ac81 is required for nucleocapsid envelopment. (United States)

    Dong, Fang; Wang, Jinwen; Deng, Riqiang; Wang, Xunzhang


    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is a highly pathogenic Baculoviridae that targets insects, whose core gene, ac81, has an unknown function. To determine the role of ac81 in the life cycle of AcMNPV, an ac81-knockout (Ac-81KO-GP) was constructed through homologous recombination in Escherichia coli. We determined that no budded virions were produced in Ac-81KO-GP-transfected Sf9 cells, while there was no effect on viral DNA replication. Electron microscopy (EM) analysis revealed that occlusion-derived virions (ODVs) envelopment and the subsequent embedding of virions into occlusion bodies (OBs) were aborted due to ac81 deletion. Interestingly, confocal microscopy and immunofluorescence analysis revealed that Ac81 was predominantly localized to the ring zone of nuclei during the late phase of infection. In addition, Ac81 was localized to the mature and premature ODVs in virus-infected cells within the ring zone as revealed by immuno-electron microscopy (IEM) analysis. Furthermore, we determined that Ac81 contained a functional hydrophobic transmembrane (TM) domain, whose deletion resulted in a phenotype similar to that of Ac-81KO-GP. These results suggest that Ac81 might be a TM protein that played an important role in nucleocapsid envelopment. PMID:27212683

  12. Biocontrol activity of Paenibacillus polymyxa AC-1 against Pseudomonas syringae and its interaction with Arabidopsis thaliana. (United States)

    Hong, Chi Eun; Kwon, Suk Yoon; Park, Jeong Mee


    Paenibacillus polymyxa AC-1 (AC-1) is a plant growth-promoting rhizobacterium (PGPR) that has been used as a soil inoculant for biocontrol of plant pathogenic fungi and to promote plant growth. In this study, we examine the effects of AC-1 on the bacterial phytopathogen Pseudomonas syringae and internal colonization of AC-1 by counting bacterial populations that colonize plants. AC-1 inhibited the growth of both P. syringae pv. tomato DC3000 (Pst) and P. syringae pv. tabaci (Pta) in a concentration-dependent manner in in vitro assays. Upon treatment of AC-1 dropping at root tip of axenically grown Arabidopsis, we found that most of the AC-1 was detected in interior of leaves of Arabidiopsis plants rather than roots after 5 days post infection, indicating systemic spreading of AC-1 occur. We examined further AC-1 colonization patterns in Arabidopsis mutants deficient in phytohormone signaling pathways. These results indicated that abscisic acid (ABA) and jasmonic acid (JA) signaling pathways positively and negatively contributed, respectively, to AC-1 colonization of leaves, whereas epiphytic accumulation of AC-1 around root tissues was not affected. This study shows that AC-1 is an effective biocontrol agent to suppress P. syringae growth, possibly owing to its colonization patterns as a leaf-inhabiting endophyte. The results showed in this work will help to expand our understanding of the mode of action of AC-1 as a biological control agent and consequently, its application in agriculture. PMID:26946374

  13. Expression and immunocytochemical analysis of Autographa californica nucleopolyhedrovirus (AcMNPV) orf74 gene

    Institute of Scientific and Technical Information of China (English)



    Autographa californica nucleopolyhedrovirus orf74 (Ac74) is located between 62 311 and 63 108bp in the AcMNPV genome, which encodes 265 amino acid residues with a predicted 31 kDa molecular weight. The homologues of Ac74 were searched using BLASTP in protein databases, GenBank/EMBL and SWISS-PROT. The result revealed that deduced Ac74 protein was homologous to the predicted products from 10 lepidoptera NPV ORFs. The multiple sequence alignments of Ac74 and its 10 homologues manifested only one amino acid residue was completely conserved. The transcript analysis revealed that the transcript of Ac74 was detected from 24-72 hours post-infection (hpi). The product of Ac74was detected at 24 hpi and lasted until 72 bpi by Western blot using anti-Ac74 antiserum,consistent with reverse transcriptase polymerase chain reaction results. These results suggested Ac74 was expressed during the later stages of infection. The product of Ac74 was 31 kDa in size, consistent with predicted molecular weight. The subcellular localization of Ac74 proteins manifested Ac74 protein in the cytoplasm, and was hardly present in the nucleus at 24 bpi. The fluorescence was also observed in polyhedra, except cytoplasm at 72hpi. Together, Ac74 is a functional protein with 31kDa molecular weight and is located in the cytoplasm and the polyhedra.

  14. Project Management

    DEFF Research Database (Denmark)

    Pilkington, Alan; Chai, Kah-Hin; Le, Yang


    This paper identifies the true coverage of PM theory through a bibliometric analysis of the International Journal of Project Management from 1996-2012. We identify six persistent research themes: project time management, project risk management, programme management, large-scale project management......, project success/failure and practitioner development. These differ from those presented in review and editorial articles in the literature. In addition, topics missing from the PM BOK: knowledge management project-based organization and project portfolio management have become more popular topics...

  15. Project financing

    International Nuclear Information System (INIS)

    Project financing was defined ('where a lender to a specific project has recourse only to the cash flow and assets of that project for repayment and security respectively') and its attributes were described. Project financing was said to be particularly well suited to power, pipeline, mining, telecommunications, petro-chemicals, road construction, and oil and gas projects, i.e. large infrastructure projects that are difficult to fund on-balance sheet, where the risk profile of a project does not fit the corporation's risk appetite, or where higher leverage is required. Sources of project financing were identified. The need to analyze and mitigate risks, and being aware that lenders always take a conservative view and gravitate towards the lowest common denominator, were considered the key to success in obtaining project financing funds. TransAlta Corporation's project financing experiences were used to illustrate the potential of this source of financing

  16. Heat Transfer Analysis for Industrial AC Electric Arc Furnace

    Institute of Scientific and Technical Information of China (English)

    (U)nal (C)amdali; Murat Tun(c)


    The heat transfer analysis was performed for an AC electric arc furnace (EAF). Heat losses by conduction, convection and radiation from outer surface, roof, bottom and electrodes of EAF were determined in detail. Some suggestions about decreasing heat losses were presented.

  17. Current Control of Grid Converters Connected with Series AC Capacitor

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Blaabjerg, Frede; Loh, Poh Chiang;


    The series ac capacitor has recently been used with the transformerless grid-connected converters in the distribution power grids. The capacitive characteristic of the resulting series LC filter restricts the use of conventional synchronous integral or stationary resonant current controllers. Thus...

  18. Offshore windfarm connection with low frequency AC transmission technology

    DEFF Research Database (Denmark)

    Qin, Nan; Xu, Zhao; You, Shi;


    This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared to the c...

  19. Combined AC electroosmosis and dielectrophoresis for controlled rotation of microparticles. (United States)

    Walid Rezanoor, Md; Dutta, Prashanta


    Electrorotation is widely used for characterization of biological cells and materials using a rotating electric field. Generally, multiphase AC electric fields and quadrupolar electrode configuration are needed to create a rotating electric field for electrorotation. In this study, we demonstrate a simple method to rotate dielectrophoretically trapped microparticles using a stationary AC electric field. Coplanar interdigitated electrodes are used to create a linearly polarized nonuniform AC electric field. This nonuniform electric field is employed for dielectrophoretic trapping of microparticles as well as for generating electroosmotic flow in the vicinity of the electrodes resulting in rotation of microparticles in a microfluidic device. The rotation of barium titanate microparticles is observed in 2-propanol and methanol solvent at a frequency below 1 kHz. A particle rotation rate as high as 240 revolutions per minute is observed. It is demonstrated that precise manipulation (both rotation rate and equilibrium position) of the particles is possible by controlling the frequency of the applied electric field. At low frequency range, the equilibrium positions of the microparticles are observed between the electrode edge and electrode center. This method of particle manipulation is different from electrorotation as it uses induced AC electroosmosis instead of electric torque as in the case of electrorotation. Moreover, it has been shown that a microparticle can be rotated along its own axis without any translational motion. PMID:27014394

  20. Evolution of ac conductivity in nonequilibrium warm dense gold

    International Nuclear Information System (INIS)

    Using a chirped pulse probe technique, we have obtained single-shot measurements of temporal evolution of ac conductivity at 1.55 eV (800 nm) during electron energy relaxation in nonequilibrium warm dense gold with energy densities up to 4.1 MJ/kg (8*1010 J/m3). The results uncover important changes that have been masked in an earlier experiment. Equally significant, they provide valuable tests of an ab initio model for the calculation of electron heat capacity, electron-ion coupling, and ac conductivity in a single, first principles framework. While measurements of the real part of ac conductivity corroborate our theoretical temperature-dependent electron heat capacity, they point to an electron-ion coupling factor of 2.2*1016 W/m3K, significantly below that predicted by theory. In addition, measurements of the imaginary part of ac conductivity reveal the need to improve theoretical treatment of intraband contributions at very low photon energy. (authors)

  1. Exchange anisotropy determined by magnetic field dependence of ac susceptibility (United States)

    Rodríguez-Suárez, R. L.; Vilela Leão, L. H.; de Aguiar, F. M.; Rezende, S. M.; Azevedo, A.


    ac susceptibility measurements of ferromagnetic/antiferromagnetic (FM/AF) bilayers are usually performed as a function of the temperature. In this work we describe measurements of transverse biased ac susceptibility (χt) of FM/AF bilayers as a function of the applied magnetic field H0. The measurements were carried out at room temperature by means of an ac magneto-optical Kerr effect susceptometer. The χt-1(H0) dependence, at the saturation magnetization regime, exhibits a linear behavior with the applied field parallel and perpendicular to the exchange bias direction. The linear extrapolation of χt-1 versus H0 cuts the abscissa at asymmetrical values of field due to the exchange bias coupling. The inverse susceptibility is calculated in the saturation regime by a model, which takes into account the free energy of both layers plus a term corresponding to the interfacial coupling. The exchange coupling field (HE) and uniaxial anisotropy (HU) are extracted from the best fit to the experimental results. The results obtained are crosschecked by those obtained from ferromagnetic resonance (FMR) and dc magnetometry. The measurements of the exchange bias and the uniaxial field in all of the three analyzed bilayers gave values that are consistently lower when measured by FMR than those obtained by ac and dc magnetometry. It is argued that the apparently discrepant values of HE and HU, obtained by different techniques, might be explained by existence of unstable AF grains at the AF/FM interface.

  2. Introducing AC Inductive Reactance with a Power Tool (United States)

    Bryant, Wesley; Baker, Blane


    The concept of reactance in AC electrical circuits is often non-intuitive and difficult for students to grasp. In order to address this lack of conceptual understanding, classroom exercises compare the predicted resistance of a power tool, based on electrical specifications, to measured resistance. Once students discover that measured resistance…

  3. Droop-free Distributed Control for AC Microgrids

    DEFF Research Database (Denmark)

    Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.;


    A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A spars...

  4. On Conformal Field Theories With Extremal a/c Values

    CERN Document Server

    Zhiboedov, Alexander


    Unitary conformal field theories (CFTs) are believed to have positive (non-negative) energy correlators. Energy correlators are universal observables in higher-dimensional CFTs built out of integrated Wightman functions of the stress-energy tensor. We analyze energy correlators in parity invariant four-dimensional CFTs. The goal is to use the positivity of energy correlators to further constrain unitary CFTs. It is known that the positivity of the simplest one-point energy correlator implies that 1/3 <= a/c <= 31/18 where a and c are the Weyl anomaly coefficients. We use the positivity of higher point energy correlators to show that CFTs with extremal values of a/c have trivial scattering observables. More precisely, for a/c=1/3 and a/c=31/18 all energy correlators are fixed to be the ones of the free boson and the free vector theory correspondingly. Similarly, we show that the positivity and finiteness of energy correlators together imply that the three-point function of the stress tensor in a CFT cann...

  5. Magnetophoresis of neutral particles in AC electric field


    Ovchinnikov, A. A.


    It has been shown that under joint action of DC magnetic and AC electric fields neutral particles (atoms,molecules,nano-size particles etc.) nearby interface move with permanent velocity along the surface. The driving force depends on non-linear dynamical properties of polarization of the particles and a coupling between the polarisation and the position of the particles on a surface.

  6. A simple technique for a.c. conductivity measurements

    Indian Academy of Sciences (India)

    R Padma Suvarna; K Raghavendra Rao; K Subbarangaiah


    An inexpensive, indigenous and a simple electronic instrument based on voltage follower, current–to–voltage converter, zero crossing detector and a phase detector has been developed for measurement of a.c. conductivity. Real and imaginary parts of complex impedance are determined for a given sample as a function of frequency and the given sample is represented by a pure electronic model.

  7. Acústica, fluidos y termodinámica


    Beléndez Vázquez, Augusto


    Acústica. Estática de fluidos. Dinámica de fluidos y fluidos reales. Temperatura y propagación del calor. Primer principio de la Termodinámica. Gases ideales. Segundo principio de la Termodinámica.

  8. Dielectric relaxation and ac conductivity of sodium tungsten phosphate glasses

    Indian Academy of Sciences (India)

    B Singh; P S Tarsikka; L Singh


    Studies of dielectric relaxation and ac conductivity have been made on three samples of sodium tungsten phosphate glasses over a temperature range of 77–420 K. Complex relative permittivity data have been analyzed using dielectric modulus approach. Conductivity relaxation frequency increases with the increase of temperature. Activation energy for conductivity relaxation has also been evaluated. Measured ac conductivity (m()) has been found to be higher than dc at low temperatures whereas at high temperature m() becomes equal to dc at all frequencies. The ac conductivity obeys the relation ac() = A over a considerable range of low temperatures. Values of exponent are nearly equal to unity at about 78 K and the values decrease non-linearly with the increase of temperature. Values of the number density of states at Fermi level ((F)) have been evaluated at 80 K assuming values of electron wave function decay constant to be 0.5 (Å)-1. Values of (F) have the order 1020 which are well within the range suggested for localized states. Present values of (F) are smaller than those for tungsten phosphate glasses.

  9. Financial Analysis - AC Sparta Praha a.s.


    Mayer, David


    This thesis analyzes and assesses the financial situation of the Czech football club AC Sparta Praha football, a. s. There are used the classical methods of financial analysis in this thesis, taking into account the specifics of the business environment. Considerable attention is paid to comparison with Czech and foreign football clubs.

  10. Solid-state fast voltage compensator for pulsed power applications requiring constant AC power consumption

    CERN Document Server

    Magallanes, Francisco Cabaleiro; Viarouge, Philippe; Cros, Jérôme


    This paper proposes a novel topological solution for pulsed power converters based on capacitor-discharge topologies, integrating a Fast Voltage Compensator which allows an operation at constant power consumption from the utility grid. This solution has been retained as a possible candidate for the CLIC project under study at CERN, which requires more than a thousand synchronously-operated klystron modulators producing a total pulsed power of almost 40 GW. The proposed Fast Voltage Compensator is integrated in the modulator such that it only has to treat the capacitor charger current and a fraction of the charging voltage, meaning that its dimensioning power and cost are minimized. This topology can be used to improve the AC power quality of any pulsed converters based on capacitor-discharge concept. A prototype has been built and exploited to validate the operating principle and demonstrate the benefits of the proposed solution.

  11. Measurements of light transmission in deep sea with the AC9 trasmissometer

    International Nuclear Information System (INIS)

    The NEMO Collaboration aims to construct an underwater Cherenkov detector in the Mediterranean Sea, able to act as a neutrino telescope. One of the main tasks of this project, which implies difficult technological challenges, is the selection of an adequate marine site. In this framework the knowledge of light transmission properties in deep seawater is extremely important. The collaboration has measured optical properties in several marine sites near the Italian coasts, at depths >3000 m, using a setup based on a AC9, a commercial trasmissometer, manufactured by WETLabs. The results obtained for the two sites reported in this paper (Alicudi and Ustica), show that deep seawater optical properties are comparable to those of the clearest waters

  12. Measurements of light transmission in deep sea with the AC9 trasmissometer

    CERN Document Server

    Capone, A; Grimaldi, A; Habel, R; Presti, D L; Migneco, E; Masullo, R; Moro, F; Petruccetti, M; Petta, C; Piattelli, P; Randazzo, N; Riccobene, G; Salusti, E; Sapienza, P; Sedita, M; Trasatti, L; Ursella, L; Capone, Antonio; Digaetano, Tullio; Grimaldi, Antonio; Habel, Roberto; Presti, Domenico Lo; Migneco, Emilio; Masullo, Rocco; Moro, Fulvio; Petruccetti, Marco; Petta, Catia; Piattelli, Paolo; Randazzo, Nunzio; Riccobene, Giorgio; Salusti, Ettore; Sapienza, Piera; Sedita, Mario; Trasatti, Luciano; Ursella, Laura


    The NEMO Collaboration aims to construct an underwater Cerenkov detector in the Mediterranean Sea, able to act as a neutrino telescope. One of the main tasks of this project, which implies difficult technological challenges, is the selection of an adequate marine site. In this framework the knowledge of light transmission properties in deep seawater is extremely important. The collaboration has measured optical properties in several marine sites near the Italian coasts, at depths >3000 m, using a set-up based on a AC9, a commercial trasmissometer, manufactured by WETLabs. The results obtained for the two sites reported in this paper Alicudi and Ustica, show that deep seawater optical properties are comparable to those of the clearest waters.


    DEFF Research Database (Denmark)

    Guan, Yajuan


    strategy for paralleled voltage-controlled inverters (VCIs) in AC MGs to provide faster transient response, better active/reactive power decoupling sharing, and wider application ranges for different line impedances than the conventional power droop controller. And then, develop a complete small...... proposed control strategy provides instantaneous and independent direct and quadrature currents sharing for paralleled VCIs. In contrast with the conventional droop control, there is no need to calculate active/reactive power. An integrated small-signal state-space model for the two parallel VCIs with the...... has been commonly adopted in the last decade as the decentralized control in MGs. However, this approach has several inherent drawbacks, such as slow dynamic response, active/reactive power coupling, and sensitivity to line impedance. This project proposes a novel autonomous current sharing control...

  14. Aragonite coating solutions (ACS) based on artificial seawater

    International Nuclear Information System (INIS)

    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry

  15. Aragonite coating solutions (ACS) based on artificial seawater

    Energy Technology Data Exchange (ETDEWEB)

    Tas, A. Cuneyt, E-mail:


    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  16. A Study on Power Quality Improvement in PWM Controlled AC Voltage Controller

    Directory of Open Access Journals (Sweden)

    Ahmet ALTINTAŞ


    Full Text Available A lot of topologies of pulse-width modulated (PWM-AC controllers for single-phase and three-phase systems are proposed up to date. PWM-AC controllers have important advantages compared with the phase-controlled AC controllers using thyristors and triacs. The PWM-AC controller has sinusoidal current waveforms, smaller THD values, better power factor, faster dynamics, and smaller input/output filter. This article presents a novel control technique for application to PWM-AC controllers with ability of generating fewer harmonics. In the proposed control method, both the traditional AC voltage controllers and the PWM-AC controllers are combined; and smaller THD values are obtained. Thus, the harmonic pollution in the power system will be reduced; and consequently, the power quality will be increased. For this purpose, computer simulations are performed in order to investigate the proposed controller performance. The obtained results are compared with the conventional PWM-AC controller.

  17. Expression characteristics of CS-ACS1, CS-ACS2 and CS-ACS3, three members of the 1-aminocyclopropane-1-carboxylate synthase gene family in cucumber (Cucumis sativus L.) fruit under carbon dioxide stress. (United States)

    Mathooko, F M; Mwaniki, M W; Nakatsuka, A; Shiomi, S; Kubo, Y; Inaba, A; Nakamura, R


    We investigated the expression pattern of three 1-aminocyclopropane-1-carboxylate (ACC) synthase genes, CS-ACS1, CS-ACS2 and CS-ACS3 in cucumber (Cucumis sativus L.) fruit under CO2 stress. CO2 stress-induced ethylene production paralleled the accumulation of only CS-ACS1 transcripts which disappeared upon withdrawal of CO2. Cycloheximide inhibited the CO2 stress-induced ethylene production but superinduced the accumulation of CS-ACS1 transcript. At higher concentrations, cycloheximide also induced the accumulation of CS-ACS2 and CS-ACS3 transcripts. In the presence of CO2 and cycloheximide, the accumulation of CS-ACS2 transcript occurred within 1 h, disappeared after 3 h and increased greatly upon withdrawal of CO2. Inhibitors of protein kinase and types 1 and 2A protein phosphatases which inhibited and stimulated, respectively, CO2 stress-induced ethylene production had little effect on the expression of these genes. The results presented here identify CS-ACS1 as the main ACC synthase gene responsible for the increased ethylene biosynthesis in cucumber fruit under CO2 stress and suggest that this gene is a primary response gene and its expression is under negative control since it is expressed by treatment with cycloheximide. The results further suggest that the regulation of CO2 stress-induced ethylene biosynthesis by reversible protein phosphorylation does not result from enhanced ACC synthase transcription. PMID:10202812

  18. Virtual projects

    DEFF Research Database (Denmark)

    Svejvig, Per; Commisso, Trine Hald


    Virtual projects are common with global competition, market development, and not least the financial crisis forcing organizations to reduce their costs drastically. Organizations therefore have to place high importance on ways to carry out virtual projects and consider appropriate practices for p...... overall implications for research and practice are to acknowledge virtual project management as very different to traditional project management and to address this difference.......Virtual projects are common with global competition, market development, and not least the financial crisis forcing organizations to reduce their costs drastically. Organizations therefore have to place high importance on ways to carry out virtual projects and consider appropriate practices for...... performing these projects. This paper compares best practices with practiced practices for virtual projects and discusses ways to bridge the gap between them. We have studied eleven virtual projects in five Danish organizations and compared them with a predefined list of best practices compiled from the...

  19. Transposition of Ac from the P Locus of Maize into Unreplicated Chromosomal Sites


    Chen, Jychian; Greenblatt, Irwin M.; Dellaporta, Stephen L.


    We have analyzed donor and target sites of the mobile element Activator (Ac) that are altered as a result of somatic transposition from the P locus in maize. Previous genetic analysis has indicated that the two mitotic daughter lineages which result from Ac transposition from P differ in their Ac constitution at the P locus. Both lineages, however, usually contain transposed Ac elements which map to the same genetic position. Using methylation-sensitive restriction enzymes and genomic blot a...

  20. A transgenic system for generation of transposon Ac/Ds-induced chromosome rearrangements in rice


    Yu, Chuanhe; Han, FangPu; Zhang, Jianbo; Birchler, James; Peterson, Thomas


    The maize Activator (Ac)/Dissociation (Ds) transposable element system has been used in a variety of plants for insertional mutagenesis. Ac/Ds elements can also generate genome rearrangements via alternative transposition reactions which involve the termini of closely linked transposons. Here, we introduced a transgene containing reverse-oriented Ac/Ds termini together with an Ac transposase gene into rice (Oryza sativa ssp. japonica cv. Nipponbare). Among the transgenic progeny, we identifie...

  1. Low Friction Cryostat for HTS Power Cable of Dutch Project

    NARCIS (Netherlands)

    Chevtchenko, O.; Zuijderduin, R.; Smit, J.; Willen, D.; Lentge, H.; Thidemann, C.; Traeholt, C.


    Particulars of 6 km long HTS AC power cable for Amsterdam project are: a cable has to fit in an annulus of 160 mm, with only two cooling stations at the cable ends [1]. Application of existing solutions for HTS cables would result in excessively high coolant pressure drop in the cable, possibly affe

  2. Project financing

    International Nuclear Information System (INIS)

    This paper presents the basic concepts and components of the project financing of large industrial facilities. Diagrams of a simple partnership structure and a simple leveraged lease structure are included. Finally, a Hypothetical Project is described with basic issues identified for discussion purposes. The topics of the paper include non-recourse financing, principal advantages and objectives, disadvantages, project financing participants and agreements, feasibility studies, organization of the project company, principal agreements in a project financing, insurance, and an examination of a hypothetical project

  3. Control of hybrid AC/DC microgrid under islanding operational conditions

    DEFF Research Database (Denmark)

    Ding, G.; Gao, F.; Zhang, S.;


    interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter, the...

  4. AC Losses in the MICE Channel Magnets -- Is This a Curse or aBlessing?

    Energy Technology Data Exchange (ETDEWEB)

    Green, M.A.; Wu, H.; Wang, L.; Kai, L.L.; Jia, L.X.; Yang, S.Q.


    This report discusses the AC losses in the MICE channelmagnets during magnet charging and discharging. This report talks aboutthe three types of AC losses in the MICE magnets; the hysteretic AC lossin the superconductor, the coupling AC loss in the superconductor and theeddy current AC loss in the magnet mandrel and support structure. AClosses increase the heat load at 4 K. The added heat load increases thetemperature of the second stage of the cooler. In addition, AC losscontributes to the temperature rise between the second stage cold headand the high field point of the magnet, which is usually close to themagnet hot spot. These are the curses of AC loss in the MICE magnet thatcan limit the rate at which the magnet can be charge or discharged. Ifone is willing to allow some of the helium that is around the magnet toboil away during a magnet charge or discharge, AC losses can become ablessing. The boil off helium from the AC losses can be used to cool theupper end of the HTS leads and the surrounding shield. The AC losses arepresented for all three types of MICE magnets. The AC loss temperaturedrops within the coupling magnet are presented as an example of how boththe curse and blessing of the AC losses can be combined.

  5. AC losses and transient field stability of PF-FSJS sample

    International Nuclear Information System (INIS)

    This series of 17 slides deals with AC losses and transient field stability of poloidal field full-size-joint sample) which is relevant to the poloidal field coils of ITER. The topic is divided into 6 parts: 1) general - AC losses, 2) conductor magnetization, 3) conductor calorimetry, 4) conclusion on AC losses, 5) stability, and 6) conclusion on stability

  6. AC losses and transient field stability of PF-FSJS sample

    Energy Technology Data Exchange (ETDEWEB)

    Zani, L


    This series of 17 slides deals with AC losses and transient field stability of poloidal field full-size-joint sample) which is relevant to the poloidal field coils of ITER. The topic is divided into 6 parts: 1) general - AC losses, 2) conductor magnetization, 3) conductor calorimetry, 4) conclusion on AC losses, 5) stability, and 6) conclusion on stability.

  7. 21 CFR 880.5510 - Non-AC-powered patient lift. (United States)


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Non-AC-powered patient lift. 880.5510 Section 880... Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is a hydraulic, battery, or mechanically powered device, either fixed or mobile, used to lift and transport...

  8. Prototypical Rod Consolidation Demonstration Project

    International Nuclear Information System (INIS)

    The objective of Phase 3 of the Prototypical Rod consolidation Demonstration Project (PRCDP) was to procure, fabricate, assemble, and test the Prototypical Rod consolidation System as described in the NUS Phase 2 Final Design Report. This effort required providing the materials, components, and fabricated parts which makes up all of the system equipment. In addition, it included the assembly, installation, and setup of this equipment at the Cold Test Facility. During the Phase 3 effort the system was tested on a component, subsystem, and system level. This volume 1, discusses the PRCDP Phase 3 Test Program that was conducted by the HALLIBURTON NUS Environmental Corporation under contract AC07-86ID12651 with the United States Department of Energy. This document, Volume 1, Book 1 discusses the following topics: the background of the project; test program description; summary of tests and test results; problem evaluation; functional requirements confirmation; recommendations; and completed test documentation for tests performed in Phase 3

  9. Russian contribution to ExoMars Trace Gas Orbiter: Atmospheric Chemistry Suite (ACS) (United States)

    Shakun, Alexey; Korablev, Oleg; Trokhimovskiy, Alexander; Grigoriev, Alexey; Anufreychik, Konstantin; Fedorova, Anna; Ignatiev, Nikolay; Ivanov, Yuriy; Moshkin, Boris; Kalinnikov, Yuriy; Montmessin, Franck


    Atmospheric Chemistry Suite (ACS) is a part of science payload of Trace Gas Orbiter (TGO), ExoMars mission. This project developed by European Space Agency (ESA) in collaboration with Russian Space Agency (Roscosmos). Russian contribution to ExoMars TGO is the Proton rocket and two science instruments ACS (three infrared spectrometers) and FREND (neutron detector). ACS consists of three infrared spectrometers (ACS/NIR, ACS/MIR and ACS/TIRVIM) capable to take spectral measurements from near to thermal infrared range simultaneously or separately. Spectrometric channels of ACS share common mechanical, electrical, and thermal interfaces. Electronic box (ACS/BE) provides to spectrometric channels power and data transfer interfaces. SpaceWire link is used for science data transfer and MIL-1553 link - for commanding and housekeeping data transfer. The NIR channel is an echelle spectrometer with acousto-optic tunable filter (AOTF) for the selection of diffraction orders. ACS NIR is capable to perform nadir and occultation observations. NIR covers the spectral range of 0.7-1.7 μm with resolving power of ~25000. NIR will perform unique for TGO instruments nightglow science (searching for O2, OH, NO nightglow emissions on Mars). From the 1.38 μm band NIR will do water vapour mapping in nadir and H2O vertical profiling in solar occultations. High resolution NIR measurements of 1.27 μm O2(a1Δg) dayglow will supply indirect ozone observations on the dayside on nadir. In solar occultation mode, the O2 vertical profiles will be measured from the surface (in case of low dust activity) to the 40 km altitude based on 0.76 μm absorption band. Together with MIR channel in solar occultation NIR will support the measurements of CO2 density profiles (based on 1.43 μm band) and aerosols characterization from 0.7 to 4 μm. The wide spectral range will allow not just determine aerosol particle sizes and density at different altitudes, but also distinguish between dust and ice particles

  10. Alzheimer's Project (United States)

    ... state Home > News & Events > Upcoming Events > HBO Alzheimer’s Project In the News Walk to End Alzheimer's Upcoming ... Disease Awareness Month World Alzheimer's Month HBO Alzheimer’s Project MAKE A DONATION Your gift will help us ...

  11. Alzheimer's Project

    Medline Plus

    Full Text Available ... THE ALZHEIMER'S PROJECT," providing expert insight and leading community engagement. Talk about the films on our message board . ... support vital research and services. "THE ALZHEIMER'S PROJECT" is a presentation of HBO ...

  12. Intending Projects

    Institute of Scientific and Technical Information of China (English)


    Project name: New construction project of production,research & development base of hydraulic system Construction site: Qingpu Industrial Park Construction unit: Parker Hannifin Industrial Hydraulic Technology (Shanghai) Co., Ltd.

  13. Alzheimer's Project

    Medline Plus

    Full Text Available ... Momentum in Science, Part 2" (70 minutes) Be a part of something big. HBO's "THE ALZHEIMER'S PROJECT" ... vital research and services. "THE ALZHEIMER'S PROJECT" is a presentation of HBO Documentary Films and the National ...

  14. Project Management


    Lörinc, Jan


    This work deals with the problems in the process of project management in enterprises. It examines the precise approaches, the possibility of standardizingthe approach to project team management and motivation of its members and their role in the process of project management. He confronts the views and attitudes of selected authors. The theoretical conclusions of findings compares with knowledgeacquired from research carried out on project management in a selected company.Evaluates managemen...

  15. Project ethics

    CERN Document Server

    Jonasson, Haukur Ingi


    How relevant is ethics to project management? The book - which aims to demystify the field of ethics for project managers and managers in general - takes both a critical and a practical look at project management in terms of success criteria, and ethical opportunities and risks. The goal is to help the reader to use ethical theory to further identify opportunities and risks within their projects and thereby to advance more directly along the path of mature and sustainable managerial practice.

  16. Map Projection

    CERN Document Server

    Ghaderpour, Ebrahim


    In this paper, we introduce some known map projections from a model of the Earth to a flat sheet of paper or map and derive the plotting equations for these projections. The first fundamental form and the Gaussian fundamental quantities are defined and applied to obtain the plotting equations and distortions in length, shape and size for some of these map projections.

  17. Removal of pharmaceutically active compounds (PhACs) and toxicological response of Cyperus alternifolius exposed to PhACs in microcosm constructed wetlands. (United States)

    Yan, Qing; Feng, Guozhong; Gao, Xu; Sun, Chengxiao; Guo, Jin-song; Zhu, Zhiwei


    This study investigated the effects of selected four pharmaceutically active compounds (PhACs) (carbamazepine, sulfamethoxazole, ofloxacin, and roxithromycin) on the photosynthesis and antioxidant enzymes of Cyperus alternifolius in constructed wetlands (CWs). Moreover, the removal and kinetics of PhACs in CWs were evaluated to explore the related removal mechanisms. Results showed that C. alternifolius can uptake and withstand certain PhACs. The PhAC tolerance of C. alternifolius might be attributed to their capacity to maintain relatively normal photosynthetic activity and elevated antioxidative defense. CWs offered comparable or even higher removal efficiencies for the selected PhACs compared with conventional WWTPs. The removal of the target PhACs was enhanced in the planted CWs versus the unplanted CWs mostly because of plant uptake and rhizosphere effects. In particular, carbamazepine, which is considered the most recalcitrant of the PhACs, was significantly reduced (p<0.05). The removal of target PhACs fitted into two distinct periods. The initial fast step (within the first 2 h) was essentially attributed to the adsorption onto the CW medium surface. The subsequent slow process (2-12 h) closely followed first-order kinetics probably because of the interaction between microorganisms and plants. The obtained results indicate that C. alternifolius can phytoremediate PhAC-contaminated waters in CWs. PMID:26465971

  18. A Study on Power Quality Improvement in PWM Controlled AC Voltage Controller


    Ahmet ALTINTAŞ


    A lot of topologies of pulse-width modulated (PWM)-AC controllers for single-phase and three-phase systems are proposed up to date. PWM-AC controllers have important advantages compared with the phase-controlled AC controllers using thyristors and triacs. The PWM-AC controller has sinusoidal current waveforms, smaller THD values, better power factor, faster dynamics, and smaller input/output filter. This article presents a novel control technique for application to PWM-AC controllers with abi...

  19. Dicty_cDB: FC-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

  20. An improved inclusive measurement of Ac using the SLD detector

    International Nuclear Information System (INIS)

    The authors report a new measurement of Ac using data obtained by SLD in 1993--97. This measurement uses a vertex tag technique, where the selection of a c hemisphere is based on the reconstructed mass of the charm hadron decay vertex. The method uses the 3D vertexting capabilities of SLD's CCD vertex detector and the small and stable SLC beams to obtain a high c-event tagging efficiency and purity of 28% and 81%, respectively. Charged kaons identified by the CRID detector and the charge of the reconstructed vertex provide an efficient quark-antiquark tag. They obtain a preliminary result of Ac = 0.650 ± 0.041 ± 0.033

  1. Design and AC loss analysis of a superconducting synchronous motor

    International Nuclear Information System (INIS)

    This paper gives a conceptual design of a superconducting synchronous motor consisting of both high-temperature superconducting rotating field winding and armature winding. The AC losses of the armature winding of the motor have been investigated experimentally and numerically, by considering the self-field of the superconducting coils and the rotating magnetic field exposed on the armature winding. The recent developments of YBCO-coated conductors present the possibility of achieving a wholly superconducting machine of significantly smaller size and weight than a conventional machine. Both the rotating field winding and the armature winding are composed of YBCO high-temperature superconducting (HTS) coils. A low AC loss armature winding design has been developed for this superconducting synchronous motor. The performance of the machine was investigated by modelling with the finite-element method. The machine's torque is calculated from first principles by considering the angle between the field and the armature main flux lines

  2. Strongly nonlinear dynamics of electrolytes in large ac voltages

    CERN Document Server

    Olesen, Laurits H; Bruus, Henrik


    We study the response of a model micro-electrochemical cell to a large ac voltage of frequency comparable to the inverse cell relaxation time. To bring out the basic physics, we consider the simplest possible model of a symmetric binary electrolyte confined between parallel-plate blocking electrodes, ignoring any transverse instability or fluid flow. We analyze the resulting one-dimensional problem by matched asymptotic expansions in the limit of thin double layers and extend previous work into the strongly nonlinear regime, which is characterized by two novel features - significant salt depletion in the electrolyte near the electrodes and, at very large voltage, the breakdown of the quasi-equilibrium structure of the double layers. The former leads to the prediction of "ac capacitive desalination", since there is a time-averaged transfer of salt from the bulk to the double layers, via oscillating diffusion layers. The latter is associated with transient diffusion limitation, which drives the formation and co...

  3. Towards an AC-MOT of CaF (United States)

    Anderegg, Loic; Chae, Eunmi; Ravi, Aakash; Augenbraun, Benjamin; Hemmerling, Boerge; Drayna, Garrett; Hutzler, Nicholas; Collopy, Alejandra; Wu, Yewei; Ding, Shiqian; Ye, Jun; Ketterle, Wolfgang; Doyle, John


    Ultra-cold diatomic molecules have rich prospects as candidates to study controlled ultra-cold chemistry, strongly correlated systems and precision measurements. They are also considered as possible qubits in quantum computing and simulation schemes. We report on progress towards loading CaF into a molecular magneto-optical trap (MOT). An AC-MOT will be used to actively remix magnetic dark states via both polarization and magnetic field switching. In order to load a molecular MOT, we have successfully laser slowed a CaF beam to near the expected capture velocity. We describe our AC-MOT apparatus, which is designed to co-trap CaF and Li. We outline our planned study of CaF-Li collisions to explore the feasibility of sympathetically cooling molecules to ultra-cold temperatures.

  4. The minimization of ac phase noise in interferometric systems

    DEFF Research Database (Denmark)

    Filinski, Ignacy; Gordon, R A


    A simple step-by-step procedure, including several novel techniques discussed in the Appendices, is given for minimizing ac phase noise in typical interferometric systems such as two-beam interferometers, holographic setups, four-wave mixers, etc. Special attention is given to index of refraction...... fluctuations, direct mechanical coupling, and acoustic coupling, whose importance in determining ac phase noise in interferometric systems has not been adequately treated. The minimization procedure must be carried out while continuously monitoring the phase noise which can be done very simply by using a...... in optics. Thus, the necessity of eliminating the effects of index of refraction fluctuations which degrade the performance of all interferometers is pointed out as the first priority. A substantial decrease of the effects of all vibrating, rotating, or flowing masses (e.g., cooling lines) in direct...

  5. Improvement program for polycarbonate capacitors. [hermetically sealed, and ac wound (United States)

    Bailey, R. R.; Waterman, K. D.


    Hermetically sealed, wound, AC, polycarbonate capacitors incorporating design improvements recommended in a previous study were designed and built. A 5000 hour, 400 Hz ac life test was conducted using 384 of these capacitors to verify the adequacy of the design improvements. The improvements incorporated in the capacitors designed for this program eliminated the major cause of failure found in the preceding work, termination failure. A failure cause not present in the previous test became significant in this test with capacitors built from one lot of polycarbonate film. The samples from this lot accounted for 25 percent of the total test complement. Analyses of failed samples showed that the film had an excessive solvent content. This solvent problem was found in 37 of the total 46 failures which occurred in this test. The other nine were random failures resulting from causes such as seal leaks, foreign particles, and possibly wrinkles.

  6. Narrow strand YBCO Roebel cable for lowered AC loss

    International Nuclear Information System (INIS)

    We have constructed test lengths of Roebel cable from wide strips of second generation YBCO wire. The strand width is 2mm to allow for lowered AC losses in comparison with standard HTS wires. Up to 10 strands can be cut from the 40mm wide strip and assembled into a 10 strand cable with a transposition length of 90mm. Electrical measurements show good retention of critical current through the cutting and cabling processes. Initial AC loss measurements confirm the reduction expected from full width wire. Results from mechanical modeling are presented which have been used to optimise strand geometry to reduce stress concentrations. Manufacturing capability to produce up to 100m lengths has been demonstrated

  7. AC magnetization losses in striated YBCO-123/Hastelloy coated conductors

    International Nuclear Information System (INIS)

    In this work we present experimental results of reductions in AC magnetization losses due to a striation process in YBCO-123/Hastelloy coated conductors. The measurements were carried out in a sinusoidally varying external magnetic field, with amplitudes up to 100 mT, in a frequency range of 8.5-85.4 Hz, and at a temperature of 77 K. The field was oriented perpendicularly to the face of the tapes. Sample tapes were successively patterned into the form of narrow parallel strips, by means of a photoresist lithography and chemical wet etching technique. Experimental results are discussed in the framework of existing theoretical models for energy dissipation in thin films in perpendicular AC magnetic fields

  8. Effective nonlinear AC response to composite with spherical particles

    Institute of Scientific and Technical Information of China (English)

    Chen Xiao-Gang; Liang Fang-Chu; Wei En-Bo


    An effective nonlinear alternative-current (AC) response to granular nonlinear-composite with spherical inclusions embedded in a host medium under the action of an external AC field is investigated by using a perturbation approach.The local potentials of composite at higher harmonics are derived both in a region of local inclusion particles and in a local host region under the action of a sinusoidal field E1 sinωt + E3sin3ωt. An effective nonlinear-response to composite and the relationship between the effective nonlinear-responses at the fundamental frequency and the third harmonics are also studied for the spherical inclusions in a dilute limit.

  9. Fiber Materials AC Impedance Characteristics and Principium Analysis (United States)

    Wang, Jianjun; Li, Xiaofeng

    With an invariable amplitude and variable frequency inspiriting, impedance of fiber materials rapidly decrease at first and then increase speedy followed with increasing of signal frequency. For the impedance curve of frequency is section of bathtub, this phenomenon is defined as alternating current electric conductive bathtub effect of fiber material. With analysis tools,of circuit theory and medium polarization theory, the phenomenon can be deeply detected that in AC electric field there are four different kind of currents in fiber material: absorbing current, conductance current, charging current and superficial current. With more analyzing it's discovered this phenomenon can be explained by medium polarize theory. Make using of fiber AC electric conductivity bathtub effect, fast testing equipment on fiber moisture regain can be invent, and disadvantages of conventional impedance technique, such as greatness test error and electrode polarization easily. This paper affords directions to design novel speediness fiber moisture test equipments in theory.

  10. Total loss of AC power analysis for EPR reactor

    Energy Technology Data Exchange (ETDEWEB)

    Darnowski, Piotr, E-mail: [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Skrzypek, Eleonora, E-mail: [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); National Centre for Nuclear Research (NCBJ), A. Sołtana 7, 05-400 Otwock-Świerk (Poland); Mazgaj, Piotr, E-mail: [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Świrski, Konrad [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Gandrille, Pascal [AREVA NP SAS, Tour AREVA, 1 place Jean Millier, 92084 Paris La Défense (France)


    Highlights: • Total loss of AC power (Station Blackout) was simulated for the EPR reactor model. • In-vessel phase of the accident is under consideration. • Comparison of MELCOR and MAAP results is presented. • MELCOR and MAAP results are comparable. - Abstract: In this paper the results of severe accident simulations for the EPR reactor in the case of loss of offsite power combined with total failure of all diesel generators (total loss of AC power) are presented. Calculations were performed with MELCOR 2.1 computer code for in-vessel phase of the accident. In this scenario, the unavailability of all offsite and onsite power sources and the lack of cooling leads directly to core degradation, material relocation to the lower plenum and rupture of the reactor pressure vessel. MELCOR results were compared qualitatively and quantitatively with MAAP4 code results and show a good agreement.

  11. Photovoltaic Inverter Controllers Seeking AC Optimal Power Flow Solutions

    Energy Technology Data Exchange (ETDEWEB)

    Dall' Anese, Emiliano; Dhople, Sairaj V.; Giannakis, Georgios B.


    This paper considers future distribution networks featuring inverter-interfaced photovoltaic (PV) systems, and addresses the synthesis of feedback controllers that seek real- and reactive-power inverter setpoints corresponding to AC optimal power flow (OPF) solutions. The objective is to bridge the temporal gap between long-term system optimization and real-time inverter control, and enable seamless PV-owner participation without compromising system efficiency and stability. The design of the controllers is grounded on a dual ..epsilon..-subgradient method, while semidefinite programming relaxations are advocated to bypass the non-convexity of AC OPF formulations. Global convergence of inverter output powers is analytically established for diminishing stepsize rules for cases where: i) computational limits dictate asynchronous updates of the controller signals, and ii) inverter reference inputs may be updated at a faster rate than the power-output settling time.

  12. Design and AC loss analysis of a superconducting synchronous motor

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Q [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Majoros, M [Department of Materials Science and Engineering, Ohio State University (United States); Hong, Z [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Campbell, A M [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Coombs, T A [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom)


    This paper gives a conceptual design of a superconducting synchronous motor consisting of both high-temperature superconducting rotating field winding and armature winding. The AC losses of the armature winding of the motor have been investigated experimentally and numerically, by considering the self-field of the superconducting coils and the rotating magnetic field exposed on the armature winding. The recent developments of YBCO-coated conductors present the possibility of achieving a wholly superconducting machine of significantly smaller size and weight than a conventional machine. Both the rotating field winding and the armature winding are composed of YBCO high-temperature superconducting (HTS) coils. A low AC loss armature winding design has been developed for this superconducting synchronous motor. The performance of the machine was investigated by modelling with the finite-element method. The machine's torque is calculated from first principles by considering the angle between the field and the armature main flux lines.

  13. On-Chip AC self-test controller (United States)

    Flanagan, John D.; Herring, Jay R.; Lo, Tin-Chee


    A system for performing AC self-test on an integrated circuit that includes a system clock for normal operation is provided. The system includes the system clock, self-test circuitry, a first and second test register to capture and launch test data in response to a sequence of data pulses, and a logic circuit to be tested. The self-test circuitry includes an AC self-test controller and a clock splitter. The clock splitter generates the sequence of data pulses including a long data capture pulse followed by an at speed data launch pulse and an at speed data capture pulse followed by a long data launch pulse. The at speed data launch pulse and the at speed data capture pulse are generated for a common cycle of the system clock.

  14. Bouncing of a Droplet on Superhydrophobic Surface in AC Electrowetting (United States)

    Kang, Kwan Hyoung; Lee, Seung Jun; Hong, Jiwoo


    Oscillation of a droplet is induced in ac electrowetting by time-dependent electrical wetting tension. A droplet placed on a superhydrophobic surface bounces up like a rubber ball when an ac signal is applied. The bouncing pattern is highly frequency dependent. We investigated how the shape deformation and bouncing of a droplet are affected by applied frequency. The droplet motion is analyzed with the spectral method. The droplet is modeled as a simple linear oscillator, and the mass and spring constants are determined based on analytical results. We found that bouncing occurs periodically at a resonance frequency of the droplet. The motion of a sessile droplet released from a fixed shape is analyzed based on the phase field method. The numerical results show qualitative agreement with the experimental results for a bouncing droplet. Details on the flow field inside a bouncing droplet will be discussed based on numerical results.

  15. Ac magnetic susceptibility study of in vivo nanoparticle biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Gutierrez, L; Veintemillas-Verdaguer, S; Serna, C J; Morales, M P [Instituto de Ciencia de Materiales de Madrid, ICMM-CSIC, Sor Juana Ines de la Cruz 3, Cantoblanco 28049, Madrid (Spain); MejIas, R; Barber, D F [Centro Nacional de BiotecnologIa, CNB-CSIC, Darwin 3, Cantoblanco 28049, Madrid (Spain); Lazaro, F J, E-mail: [Departamento de Ciencia y Tecnologia de Materiales y Fluidos, Universidad de Zaragoza, Maria de Luna 3, 50018, Zaragoza (Spain)


    We analysed magnetic nanoparticle biodistribution, before and after cytokine conjugation, in a mouse model by ac susceptibility measurements of the corresponding resected tissues. Mice received repeated intravenous injections of nanoparticle suspension for two weeks and they were euthanized 1 h after the last injection. In general, only 10% of the total injected nanoparticles after multiple exposures were found in tissues. The rest of the particles may probably be metabolized or excreted by the organism. Our findings indicate that the adsorption of interferon to DMSA-coated magnetic nanoparticles changes their biodistribution, reducing the presence of nanoparticles in lungs and therefore their possible toxicity. The specific targeting of the particles to tumour tissues by the use of an external magnetic field has also been studied. Magnetic nanoparticles were observed by transmission electron microscopy in the targeted tissue and quantified by ac magnetic susceptibility.

  16. ac power control in the Core Flow Test Loop

    International Nuclear Information System (INIS)

    This work represents a status report on a development effort to design an ac power controller for the Core Flow Test Loop. The Core Flow Test Loop will be an engineering test facility which will simulate the thermal environment of a gas-cooled fast-breeder reactor. The problems and limitations of using sinusoidal ac power to simulate the power generated within a nuclear reactor are addressed. The transformer-thyristor configuration chosen for the Core Flow Test Loop power supply is presented. The initial considerations, design, and analysis of a closed-loop controller prototype are detailed. The design is then analyzed for improved performance possibilities and failure modes are investigated at length. A summary of the work completed to date and a proposed outline for continued development completes the report

  17. Development of ac corona discharge modes at atmospheric pressure

    International Nuclear Information System (INIS)

    Corona discharges in gases exist under several distinctive forms. In this paper, a survey study has been made of ac corona discharge modes generated in some different gases fed in a wire-duct reactor with a constant rate of flowing at atmospheric pressure. The properties of different corona modes are analyzed under some condition transitions from Trichel pulses to a steady glow. In the course of the presented experimental work, numerous apparent contradictions with earlier observations necessitated further study and are given to provide more information on the physical mechanisms of the ac corona discharges. Furthermore, we have gained insight into some new technologies and applications of the environmentally friendly corona and plasma discharges.

  18. Security analysis of interconnected AC/DC systems

    DEFF Research Database (Denmark)

    Eriksson, Robert


    any line or transformer limits. Simulations were performed in a model of the Nordic power system where a dc grid is placed on top. The simulation supports the method as a tool to consider transfer limits in the grid to avoid violate the same and increase the security after a converter outage.......This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid....... The redistribution of power has a sudden effect on the power-flow in the interconnected ac system. This may cause overloading of lines and transformers resulting in disconnection of equipment, and as a consequence cascading failure. The PTDF is used as a method to analyze and avoid violating limits by in the dc...

  19. Low power DCVSL circuits employing AC power supply

    Institute of Scientific and Technical Information of China (English)


    In view of changing the type of energy conversion in CMOS circuits, this paper investigates low power CMOS circuit design, which adopts a gradually changing power clock. First, we discuss the algebraic expressions and the corresponding properties of clocked power signals. Then the design procedure is summed up for converting complementary CMOS logic gates employing DC power to the power-clocked CMOS gates employing AC power. On this basis, the design of differential cascode voltage switch logic (DCVSL) circuits employing AC power clocks is proposed. The PSPICE simulations using a sinusoidal power-clock demonstrate that the designed power-clocked DCVSL circuit has a correct logic function and low power characteristics. Finally, an interface circuit to convert clocked signals into the standard logic levels of a CMOS circuit is proposed, and its validity is verified by computer simulations.

  20. Ac magnetic susceptibility study of in vivo nanoparticle biodistribution

    International Nuclear Information System (INIS)

    We analysed magnetic nanoparticle biodistribution, before and after cytokine conjugation, in a mouse model by ac susceptibility measurements of the corresponding resected tissues. Mice received repeated intravenous injections of nanoparticle suspension for two weeks and they were euthanized 1 h after the last injection. In general, only 10% of the total injected nanoparticles after multiple exposures were found in tissues. The rest of the particles may probably be metabolized or excreted by the organism. Our findings indicate that the adsorption of interferon to DMSA-coated magnetic nanoparticles changes their biodistribution, reducing the presence of nanoparticles in lungs and therefore their possible toxicity. The specific targeting of the particles to tumour tissues by the use of an external magnetic field has also been studied. Magnetic nanoparticles were observed by transmission electron microscopy in the targeted tissue and quantified by ac magnetic susceptibility.

  1. AC system stabilization via phase shift transformer with thyristor commutation

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Jose Carlos de; Guimaraes, Geraldo Caixeta; Moraes, Adelio Jose [Uberlandia Univ., MG (Brazil); Abreu, Jose Policarpo G. de [Escola Federal de Engenharia de Itajuba, MG (Brazil); Oliveira, Edimar Jose de [Juiz de Fora Univ., MG (Brazil)


    This article aims to present initially the constructive and operative forms of a phase-shift autotransformer which provides both magnitude and phase angle change through thyristor commutation, including a technic to reduce the number of thyristors. Following, it is proposed a control system to make such equipment an efficient AC system stabilizing tool. It is presented some simulation results to show the operation of this transformer in an electrical system. (author) 3 refs., 11 figs., 3 tabs.

  2. MD 349: Impedance Localization with AC-dipole

    CERN Document Server

    Biancacci, Nicolo; Metral, Elias; Salvant, Benoit; Papotti, Giulia; Persson, Tobias Hakan Bjorn; Tomas Garcia, Rogelio; CERN. Geneva. ATS Department


    The purpose of this MD is to measure the distribution of the transverse impedance of the LHC by observing the phase advance variation with intensity between the machine BPMs. Four injected bunches with different intensities are excited with an AC dipole and the turn by turn data is acquired from the BPM system. Through post-processing analysis the phase variation along the machine is depicted and, from this information, first conclusions of the impedance distribution can be drawn.

  3. Photovoltaic Inverter Controllers Seeking AC Optimal Power Flow Solutions


    Dall'Anese, Emiliano; Dhople, Sairaj V.; Giannakis, Georgios B.


    This paper considers future distribution networks featuring inverter-interfaced photovoltaic (PV) systems, and addresses the synthesis of feedback controllers that seek real- and reactive-power inverter setpoints corresponding to AC optimal power flow (OPF) solutions. The objective is to bridge the temporal gap between long-term system optimization and real-time inverter control, and enable seamless PV-owner participation without compromising system efficiency and stability. The design of the...

  4. Improved speed estimation in sensorless PM brushless AC drives


    Shen, J. X.; Zhu, Z.Q.; Howe, D.


    The application of flux-observer-based sensorless control to permanent-magnet brushless AC motor drives is described. Current methods of speed estimation are assessed, both theoretically and experimentally, and an improved method, which combines the best features of methods in which speed is derived from the differential of rotor position and from the ratio of the electromotive force to excitation flux linkage, is proposed. Its performance is verified experimentally.

  5. Power Loss Modeling of Isolated AC/DC Converter


    Ahmad Khan, Naveed


    Several research activities at KTH are carried out related to Isolated AC/DC converters in order to improve the design and efficiency. Concerning the improvement in the mentioned constraints, losses of the elements in the prototype converter are modeled in this thesis work. The obtained loss model is capable of calculating the losses under different circumstances. The individual contribution of losses for each element at different conditions can be obtained, which is further useful in improvi...

  6. Hybrid immersed interface-immersed boundary methods for AC dielectrophoresis (United States)

    Hossan, Mohammad Robiul; Dillon, Robert; Dutta, Prashanta


    Dielectrophoresis, a nonlinear electrokinetic transport mechanism, has become popular in many engineering applications including manipulation, characterization and actuation of biomaterials, particles and biological cells. In this paper, we present a hybrid immersed interface-immersed boundary method to study AC dielectrophoresis where an algorithm is developed to solve the complex Poisson equation using a real variable formulation. An immersed interface method is employed to obtain the AC electric field in a fluid media with suspended particles and an immersed boundary method is used for the fluid equations and particle transport. The convergence of the proposed algorithm as well as validation of the hybrid scheme with experimental results is presented. In this paper, the Maxwell stress tensor is used to calculate the dielectrophoretic force acting on particles by considering the physical effect of particles in the computational domain. Thus, this study eliminates the approximations used in point dipole methods for calculating dielectrophoretic force. A comparative study between Maxwell stress tensor and point dipole methods for computing dielectrophoretic forces are presented. The hybrid method is used to investigate the physics of dielectrophoresis in microfluidic devices using an AC electric field. The numerical results show that with proper design and appropriate selection of applied potential and frequency, global electric field minima can be obtained to facilitate multiple particle trapping by exploiting the mechanism of negative dielectrophoresis. Our numerical results also show that electrically neutral particles form a chain parallel to the applied electric field irrespective of their initial orientation when an AC electric field is applied. This proposed hybrid numerical scheme will help to better understand dielectrophoresis and to design and optimize microfluidic devices.

  7. Hybrid immersed interface-immersed boundary methods for AC dielectrophoresis

    International Nuclear Information System (INIS)

    Dielectrophoresis, a nonlinear electrokinetic transport mechanism, has become popular in many engineering applications including manipulation, characterization and actuation of biomaterials, particles and biological cells. In this paper, we present a hybrid immersed interface–immersed boundary method to study AC dielectrophoresis where an algorithm is developed to solve the complex Poisson equation using a real variable formulation. An immersed interface method is employed to obtain the AC electric field in a fluid media with suspended particles and an immersed boundary method is used for the fluid equations and particle transport. The convergence of the proposed algorithm as well as validation of the hybrid scheme with experimental results is presented. In this paper, the Maxwell stress tensor is used to calculate the dielectrophoretic force acting on particles by considering the physical effect of particles in the computational domain. Thus, this study eliminates the approximations used in point dipole methods for calculating dielectrophoretic force. A comparative study between Maxwell stress tensor and point dipole methods for computing dielectrophoretic forces are presented. The hybrid method is used to investigate the physics of dielectrophoresis in microfluidic devices using an AC electric field. The numerical results show that with proper design and appropriate selection of applied potential and frequency, global electric field minima can be obtained to facilitate multiple particle trapping by exploiting the mechanism of negative dielectrophoresis. Our numerical results also show that electrically neutral particles form a chain parallel to the applied electric field irrespective of their initial orientation when an AC electric field is applied. This proposed hybrid numerical scheme will help to better understand dielectrophoresis and to design and optimize microfluidic devices

  8. Hybrid immersed interface-immersed boundary methods for AC dielectrophoresis

    Energy Technology Data Exchange (ETDEWEB)

    Hossan, Mohammad Robiul [School of Mechanical and Materials Engineering, Washington State University, Pullman, WA 99164-2920 (United States); Department of Engineering and Physics, University of Central Oklahoma, Edmond, OK 73034-5209 (United States); Dillon, Robert [Department of Mathematics, Washington State University, Pullman, WA 99164-3113 (United States); Dutta, Prashanta, E-mail: [School of Mechanical and Materials Engineering, Washington State University, Pullman, WA 99164-2920 (United States)


    Dielectrophoresis, a nonlinear electrokinetic transport mechanism, has become popular in many engineering applications including manipulation, characterization and actuation of biomaterials, particles and biological cells. In this paper, we present a hybrid immersed interface–immersed boundary method to study AC dielectrophoresis where an algorithm is developed to solve the complex Poisson equation using a real variable formulation. An immersed interface method is employed to obtain the AC electric field in a fluid media with suspended particles and an immersed boundary method is used for the fluid equations and particle transport. The convergence of the proposed algorithm as well as validation of the hybrid scheme with experimental results is presented. In this paper, the Maxwell stress tensor is used to calculate the dielectrophoretic force acting on particles by considering the physical effect of particles in the computational domain. Thus, this study eliminates the approximations used in point dipole methods for calculating dielectrophoretic force. A comparative study between Maxwell stress tensor and point dipole methods for computing dielectrophoretic forces are presented. The hybrid method is used to investigate the physics of dielectrophoresis in microfluidic devices using an AC electric field. The numerical results show that with proper design and appropriate selection of applied potential and frequency, global electric field minima can be obtained to facilitate multiple particle trapping by exploiting the mechanism of negative dielectrophoresis. Our numerical results also show that electrically neutral particles form a chain parallel to the applied electric field irrespective of their initial orientation when an AC electric field is applied. This proposed hybrid numerical scheme will help to better understand dielectrophoresis and to design and optimize microfluidic devices.

  9. AC Complex Impedance Analysis of Doped Strontium Titanate Multifunctional Ceramics

    Institute of Scientific and Technical Information of China (English)


    Doped SrTiO3 capacitor-varistor multifunctional ceramics were fabricated by a single sintering process. AC compleximpedance analysis was performed to investigate electrical features ofgrains and grain boundaries for both as-reducedceramic and reoxidized ceramics. The results showed that the as-reduced ceramic exhibited inductive response athigh frequencies above 2 MHz, which is attributed to the contribution of electron behavior in semiconducting grains.The high frequency inductive response disappeared in impedance plots of reoxidized ceramics.

  10. Does a phase shift occur in an AC arc?

    CERN Document Server

    Steinmetz, Charles Proteus


    This is a translation of a classic paper in German showing that the apparent power in an AC arc is larger than the active power although no phase shift exists between the voltage and the current, indicating that the reactive power vanishes. The phenomenon studied in this paper gave rise to a variety of mutually conflicting "power triangle" models relating the active, reactive, and apparent powers P, Q, and S whose merits are still under debate today.

  11. Eddy Current Rail Inspection Using AC Bridge Techniques


    Liu, Ze; Koffman, Andrew D; Waltrip, Bryan C; Wang, Yicheng


    AC bridge techniques commonly used for precision impedance measurements have been adapted to develop an eddy current sensor for rail defect detection. By using two detection coils instead of just one as in a conventional sensor, we can balance out the large baseline signals corresponding to a normal rail. We have significantly enhanced the detection sensitivity of the eddy current method by detecting and demodulating the differential signal of the two coils induced by rail defects, using a di...

  12. A Linear-Programming Approximation of AC Power Flows


    Coffrin, Carleton; Van Hentenryck, Pascal


    Linear active-power-only DC power flow approximations are pervasive in the planning and control of power systems. However, these approximations fail to capture reactive power and voltage magnitudes, both of which are necessary in many applications to ensure voltage stability and AC power flow feasibility. This paper proposes linear-programming models (the LPAC models) that incorporate reactive power and voltage magnitudes in a linear power flow approximation. The LPAC models are built on a co...


    Directory of Open Access Journals (Sweden)

    S. YU. Buryak


    Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.



    Petrinec, Maja


    U radu se razmatraju polumjesečasti privjesci s obručastim dodacima u dnu s groba/ja u Kašiću i Velimu, te jezičac tipa Hohenberg s Bribirske glavice s obzirom na prikaz na zidnoj freski u crkvi Santa Maria Antiqua u Rimu, te se predlaže njihovo vremensko opredjeljivanje u drugu polovinu 8. st.

  15. Electric drives of traction rolling stocks with AC motors


    Leonas Povilas LINGAITIS; Liudvinavičius, Lionginas


    The paper considers the variation of circuit design of the electric drives in traction rolling stocks when traditional DC electric machines are replaced with AC electric machines. Simplified circuit diagrams of the electric drives using electric machines of non-commutator type are offered. Operational defects of DC traction engines are weighed against some positive characteristics of direct current series excitation in traction engines, determining their extensive use in the electric drives o...

  16. Research on AC Variable Frequency Speed Regulation System


    Ou Bing-Xian; Li Qing-Zhong; Yan Jun-Xia


    In view of shortcomings existing in shear speed control system, shearer AC speed regulating system is designed and studied. The mathematical model of three-phase asynchronous motor in rotating coordinate system is established, and PWM technology of space vector is discussed. Software and hardware of the asynchronous motor vector control variable frequency speed regulating system are designed. The simulation of system based on Matlab is made and the correctness and feasibility of the sys...

  17. AC Power Local Network with Multiple Power Routers


    Ryo Takahashi; Yutaro Kitamori; Takashi Hikihara


    Controlling power flow and achieving appropriate matching between power sources and loads according to the quality of energy is expected to be one of the approaches to reduce wasted energy consumption. A power router, proposed recently, has the capability of realizing circuit switching in a power distribution network. This study focuses on the feasibility of an AC power routing network system composed of multiple power routers. To evaluate the feasibility, we experimentally confirm the circui...

  18. Project Temporalities

    DEFF Research Database (Denmark)

    Tryggestad, Kjell; Justesen, Lise; Mouritsen, Jan


    Purpose – The purpose of this paper is to explore how animals can become stakeholders in interaction with project management technologies and what happens with project temporalities when new and surprising stakeholders become part of a project and a recognized matter of concern to be taken...... into account. Design/methodology/approach – The paper is based on a qualitative case study of a project in the building industry. The authors use actor-network theory (ANT) to analyze the emergence of animal stakeholders, stakes and temporalities. Findings – The study shows how project temporalities can...... multiply in interaction with project management technologies and how conventional linear conceptions of project time may be contested with the emergence of new non-human stakeholders and temporalities. Research limitations/implications – The study draws on ANT to show how animals can become stakeholders...

  19. The Autographa californica multiple nucleopolyhedrovirus ac110 gene encodes a new per os infectivity factor. (United States)

    Jiantao Liu; Zhu, Leyuan; Zhang, Shan; Deng, Zihao; Huang, Zhihong; Yuan, Meijin; Wu, Wenbi; Yang, Kai


    The Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac110 gene is especially conserved in lepidopteran-specific baculoviruses and is uncharacterized. To investigate the role of ac110 in the baculovirus life cycle, an ac110-knockout (vAc110KO) and a repair (vAc110:HA) viruses were constructed in this study. Budded virion production and occlusion body formation were unaffected in vAc110KO-transfected or infected Sf9 cells. Intrahemocoelic injection of budded virions of vAc110KO killed Trichoplusia ni larvae as efficiently as the repair or the wild-type viruses. However, per os inoculation of occlusion bodies of vAc110KO failed to establish infection in T. ni larvae, while the repair virus was as efficient as the wild-type virus. Treatment with calcofluor white, a reagent that damages the peritrophic membrane, did not rescue the oral infectivity of vAc110KO. These results suggested that Ac110 is a new per os infectivity factor that may play a role after occlusion-derived virions pass through the peritrophic membrane during oral infection. PMID:27212681

  20. Performance testing of the AC propulsion ELX electric vehicle

    Energy Technology Data Exchange (ETDEWEB)

    Kramer, W.E.; MacDowall, R.D.; Burke, A.F.


    Performance testing of the AC Propulsion ELX electric vehicle is described. Test data are presented and analyzed. The ELX vehicle is the first of a series of electric vehicles of interest to the California Air Resources Board. The test series is being conducted under a Cooperative Research and Development Agreement (CRADA) between the US Department of energy and the California Air Resources Board. The tests which were conducted showed that the AC Propulsion ELX electric vehicle has exceptional acceleration and range performance. when the vehicle`s battery was fully charged, the vehicle can accelerate from 0 to 96 km/h in about 10 seconds. Energy consumption and range tests using consecutive FUDS and HWFET Driving cycles (the all-electric cycle) indicate that the energy economy of the AC Propulsion ELX electric vehicle with regenerative braking is 97 W{center_dot}h/km, with a range of 153 km (95 miles). Computer simulations performed using the SIMPLEV Program indicate that the vehicle would have a range of 327 km (203 miles) on the all-electric cycle if the lead acid batteries were replaced with NiMH batteries having an energy density of 67 W{center_dot}h/kg. Comparisons of FUDS test data with and without regenerative braking indicated that regenerative braking reduced the energy consumption of the ELX vehicle by approximately 25%.

  1. The ACS-NUCL Division 50th Anniversary: Introduction

    Energy Technology Data Exchange (ETDEWEB)

    Hobart, David E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)


    The ACS Division of Nuclear Chemistry and Technology was initiated in 1955 as a subdivision of the Division of Industrial and Engineering Chemistry. Probationary divisional status was lifted in 1965. The Division’s first symposium was held in Denver in 1964 and it is fitting that we kicked-off the 50th Anniversary in Denver in the spring of 2015. Listed as a small ACS Division with only about 1,000 members, NUCL’s impact over the past fifty years has been remarkable. National ACS meetings have had many symposia sponsored or cosponsored by NUCL that included Nobel Laureates, U.S. Senators, other high-ranking officials and many students as speakers. The range of subjects has been exceptional as are the various prestigious awards established by the Division. Of major impact has been the past 30 years of the NUCL Nuclear Chemistry Summer Schools to help fill the void of qualified nuclear scientists and technicians. In celebrating the 50th Anniversary we honor the past, celebrate the present and shape the future of the Division and nuclear science and technology. To celebrate this auspicious occasion a commemorative lapel pin has been designed for distribution to NUCL Division members.

  2. On conformal field theories with extremal (a/c) values

    International Nuclear Information System (INIS)

    Unitary conformal field theories (CFTs) are believed to have positive (non-negative) energy correlators. Energy correlators are universal observables in higher-dimensional CFTs built out of integrated Wightman functions of the stress-energy tensor. We analyze energy correlators in parity invariant four-dimensional CFTs. The goal is to use the positivity of energy correlators to further constrain unitary CFTs. It is known that the positivity of the simplest one-point energy correlator implies that (1/3)≤(a/c)≤(31/18) where a and c are the Weyl anomaly coefficients. We use the positivity of higher point energy correlators to show that CFTs with extremal values of (a/c) have trivial scattering observables. More precisely, for (a/c)=(1/3) and (a/c)=(31/18) all energy correlators are fixed to be the ones of the free boson and the free vector theory correspondingly. Similarly, we show that the positivity and finiteness of energy correlators together imply that the three-point function of the stress tensor in a CFT cannot be proportional to the one in the theory of free boson, free fermion or free vector field

  3. AC electric field induced vortex in laminar coflow diffusion flames

    KAUST Repository

    Xiong, Yuan


    Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.

  4. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan


    Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the

  5. Image optimization procedures for the Fuji AC-1 (United States)

    Freedman, Matthew T.; Mun, Seong K.; Pe, Einar V.; Lo, Shih-Chung B.; Nelson, Martha C.


    The Fuji AC-1 is a popular system for digital radiography with great potential, but for many the initial implementation of the system in a radiology service is frustrating experience for lack of effective support and a clear operational manual. Adjusting the image processing settings for site specific image optimization has been, for most users, difficult and confusing. The effect of each of the image processing parameters available on the Fuji AC-1 is not easily understood by users of the machine. The application manual that comes with the machine briefly defines the parameters and gives recommended settings for different types of examinations, but the manual does not provide the user with adequate information or a suggested method to allow the user to easily optimize the image for that user's site. This paper defines in more precise terms the meaning of the various parameters and suggests a method of procedure to optimize the parameters to each radiologists preference. The results are based on experiments and measurements we performed with a Fuji AC-1 +. This information should assist the radiologist to use a more systematic method of image quality improvement rather than the somewhat random trial and error process that current users have described.

  6. AC electrokinetic manipulation of selenium nanoparticles for potential nanosensor applications

    International Nuclear Information System (INIS)

    Highlights: ► Se nanoparticles were synthesized using a reverse-microemulsion process. ► AC osmotic fluid flow repulses the particles from electrode edges. ► Dielectrophoretic force attracts the particles to electrode edges. ► Dielectrophoresis electrode showed non-ohmic behavior. ► The device can potentially be used as a nanosensor. - Abstract: We report the AC electrokinetic behavior of selenium (Se) nanoparticles for electrical characterization and possible application as micro/nano devices. selenium Se nanoparticles were successfully synthesized using a reverse-microemulsion process and investigated structurally using X-ray diffraction and transmission electron microscope. Interdigitated castellated ITO and non-castellated platinum electrodes were employed for manipulation of suspended materials in the fluid. Using ITO electrodes at low frequency limits resulted in deposition of Se particles on electrode surface. When Se particles exposed to platinum electrodes in the 10 Hz–1 kHz range and V p−p> 8, AC osmotic fluid flow repulses the particles from electrode edges. However, in 10 kHz–10 MHz range and V p−p> 5, dielectrophoretic force attracts the particles to electrode edges. As the Se particle concentration increased, the trapped Se particles were aligned along the electric field line and bridged the electrode gap. The device was characterized and can potentially be useful in making micro/nano electronic devices

  7. AC electrokinetic manipulation of selenium nanoparticles for potential nanosensor applications

    Energy Technology Data Exchange (ETDEWEB)

    Mahmoodi, Seyed Reza [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Bayati, Marzieh, E-mail: [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Hosseinirad, Somayeh [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Foroumadi, Alireza [Department of Medicinal Chemistry, Faculty of Pharmacy and Pharmaceutical Sciences Research Center, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Gilani, Kambiz [Department of Pharmaceutics, School of Pharmacy, Tehran University of Medical Science, Tehran (Iran, Islamic Republic of); Rezayat, Seyed Mahdi [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of)


    Highlights: ► Se nanoparticles were synthesized using a reverse-microemulsion process. ► AC osmotic fluid flow repulses the particles from electrode edges. ► Dielectrophoretic force attracts the particles to electrode edges. ► Dielectrophoresis electrode showed non-ohmic behavior. ► The device can potentially be used as a nanosensor. - Abstract: We report the AC electrokinetic behavior of selenium (Se) nanoparticles for electrical characterization and possible application as micro/nano devices. selenium Se nanoparticles were successfully synthesized using a reverse-microemulsion process and investigated structurally using X-ray diffraction and transmission electron microscope. Interdigitated castellated ITO and non-castellated platinum electrodes were employed for manipulation of suspended materials in the fluid. Using ITO electrodes at low frequency limits resulted in deposition of Se particles on electrode surface. When Se particles exposed to platinum electrodes in the 10 Hz–1 kHz range and V {sub p−p}> 8, AC osmotic fluid flow repulses the particles from electrode edges. However, in 10 kHz–10 MHz range and V {sub p−p}> 5, dielectrophoretic force attracts the particles to electrode edges. As the Se particle concentration increased, the trapped Se particles were aligned along the electric field line and bridged the electrode gap. The device was characterized and can potentially be useful in making micro/nano electronic devices.

  8. Cost Reduction and Manufacture of the SunSine(regsign) ac Module: Final Subcontract Report, 11 June 2001; FINAL

    International Nuclear Information System (INIS)

    This project was a two-phase effort consisting of technical research and manufacturing development to improve and reduce the costs of the SunSine(regsign) inverter. Research addressed packaging, soft switching, circuit optimization, manufacturing process improvements, and pilot production manufacturing. Significant cost reductions were achieved. The main goal of this project was to reduce cost and improve the manufacturability and reliability of the SunSine(regsign) ac module, which consists of a SunSine(regsign) inverter mounted on an ASE Americas PV laminate. This work has also boosted the performance and enhanced marketability by adding customer-valued features. Ascension Technology has accomplished these advancements by cost reductions or design modifications in the following areas: Die-cast aluminum enclosure and base plate; soft switching for cost reduction and efficiency gains; circuit board and component optimization for performance gains and size reduction; streamlined inverter assembly and production testing; and streamlined inverter/module assembly. As a result of the effort in these areas, Ascension Technology's objectives were to achieve the following: 40%-50% reduction in inverter manufacturing costs; 40% reduction in inverter size from 169 to 100 square inches; 4% increase in peak inverter efficiency from 87% to 91% at full power; UL listing, FCC certification; establish a production capability of 5000 SunSine(regsign) inverters/year through manufacturing improvements and production-line design improvements; less than 1 failure per 1000 units at time of installation/turn-on; a 5-year warranty; and a rating of 250 Wac at PTC for the SunSine(regsign) ac Module. Accomplishments during this project include: Inverter production costs were reduced 32% in the pilot production run; inverter production costs anticipated to be reduced a total of 36% in future production runs; 45% reduction in inverter footprint (in contact with module) from 169 to 93 square

  9. Colloid Thruster for Attitude Control Systems (ACS) and Tip-off Control Applications Project (United States)

    National Aeronautics and Space Administration — Busek proposes to develop and deliver a complete engineering model colloid thruster system, capable of thrust levels and lifetimes required for spacecraft...

  10. Colloid Thruster for Attitude Control Systems (ACS) and Tip-off Control Applications Project (United States)

    National Aeronautics and Space Administration — We propose to develop and test key technologies needed for an integrated, high thrust colloid thruster system with no moving parts, for spacecraft attitude control...

  11. Mapping the conformational epitope of a neutralizing antibody (AcV1) directed against the AcMNPV GP64 protein

    International Nuclear Information System (INIS)

    The envelope glycoprotein GP64 of Autographa californica nucleopolyhedrovirus (AcMNPV) is necessary and sufficient for the acid-induced membrane fusion activity that is required for fusion of the budded virus (BV) envelope and the endosome membrane during virus entry. Infectivity of the budded virus (BV) is neutralized by AcV1, a monoclonal antibody (MAb) directed against GP64. Prior studies indicated that AcV1 recognizes a conformational epitope and does not inhibit virus attachment to the cell, but instead inhibits entry at a step following virus attachment. We found that AcV1 recognition of GP64 was lost upon exposure of GP64 to low pH (pH 4.5) and restored by returning GP64 to pH 6.2. In addition, the AcV1 epitope was lost upon denaturation of GP64 in SDS, but the AcV1 epitope was restored by refolding the protein in the absence of SDS. Using truncated GP64 proteins expressed in insect cells, we mapped the AcV1 epitope to a 24 amino acid region in the central variable domain of GP64. When sequences within the mapped AcV1 epitope were substituted with a c-Myc epitope and the resulting construct was used to replace wt GP64 in recombinant AcMNPV viruses, the modified GP64 protein appeared to function normally. However, an anti-c-Myc monoclonal antibody did not neutralize infectivity of those viruses. Because binding of the c-Myc MAb to the same site in the GP64 sequence did not result in neutralization, these studies suggest that AcV1 neutralization may result from a specific structural constraint caused by AcV1 binding and not simply by steric hindrance caused by antibody binding at this position in GP64

  12. The cultivar-specific expression patterns of MdACS3 gene and apple fruit ripening and quality (United States)

    Ethylene plays an important role in diverse physiological and developmental processes of plants. In apple, two ethylene biosynthesis genes, MdACS1 and MdACS3, are expressed in fruit tissues. While MdACS1 expresses at late ripening stages, expression of MdACS3 can be detected as early as 6 weeks bef...

  13. The role of cultivar-specific expression patterns of MdACS3 gene on apple fruit ripening and quality (United States)

    Ethylene plays an important role in diverse physiological and developmental processes of plants. In apple, two ethylene biosynthesis genes, MdACS1 and MdACS3, are expressed in fruit tissues. While MdACS1 expresses at late ripening stages, expression of MdACS3 can be detected as early as 6 weeks befo...

  14. ERIS Project


    Hunter, Philip


    Unlike its predecessor project IRIScotland, which took a more top-down approach to developing repository services for users in Scottish HE institutions, the ERIS project took a bottom-up approach, and consulted potential users of repository systems widely at the outset of the project, whether these systems would be for use by single institutions or subject pools. The idea was to find out what the user community actually required in terms of repository systems and services. In practice we d...

  15. Alzheimer's Project

    Medline Plus

    Full Text Available ... voluntary health organization in Alzheimer's care, support and research, the Alzheimer's Association has been an active partner in "THE ALZHEIMER'S PROJECT," ... (48 minutes) "Momentum ...


    Directory of Open Access Journals (Sweden)

    Smriti Tapadar


    Full Text Available This paper investigates possibility of using Neural network for optimisation of AC - DC Harmonics of HVDC Transmission. Dependableness and potency of power transmission has been at the forefront of analysis for a few time and is presently being given essential thought owing to the inflated dependence on current. With the inflated demand for e lectricity, engineers area unit considering completely different strategies of provide arrangement to enhance the protection of electricity provide. speedy development within the field of power physical science devices particularly Insulated Gate Bipolar T ransistors (IGBTs has semiconductor diode to the High Voltage electrical energy (HVDC transmission supported Voltage supply Converters (VSCs. This new innovative technology provides substantial technical and economical benefits for direct applications c ompared to standard HVDC transmission. The VSC primarily based HVDC transmission primarily consists of two convertor stations connected by a DC cable. This analysis work presents the performance analysis of VSC based HVDC Transmission . To reinforce the pe rformance of the projected model, the management strategy is ruled by soft computing algorithmic rule i.e. Neural Network. Simulation and results show that the projected model is additional economical with the employment of Neural Network (NN.

  17. Removal of nitrate ions from water by activated carbons (ACs)—Influence of surface chemistry of ACs and coexisting chloride and sulfate ions (United States)

    Ota, Kazunari; Amano, Yoshimasa; Aikawa, Masami; Machida, Motoi


    Adsorptive removal of nitrate ions in aqueous solution using activated carbons (ACs) was examined. After ash was removed from Filtrasorb 400 AC, oxidation and outgassing and several heat treatments were carried out to modify the textural and surface properties of ACs. AC oxidized with 8 M nitric acid followed by outgassing at 900 °C (Ox-9OG) exhibited the greatest Langmuir adsorption capacity and affinity for nitrate removal among the total 7 ACs examined. Influence of coexisting chloride and sulfate ions was investigated as well to inspect the nitrate adsorption sites. The highest amount of sites which adsorbed nitrate ions exclusively could be observed for Ox-9OG adsorbent even though as great as 250 times greater number of chloride or sulfate ions over nitrate ions were present in the same aqueous system. Some basic oxygen species on carbon were estimated to work as selective adsorption sites for nitrate ions.

  18. H3K36ac Is an Evolutionary Conserved Plant Histone Modification That Marks Active Genes. (United States)

    Mahrez, Walid; Arellano, Minerva Susana Trejo; Moreno-Romero, Jordi; Nakamura, Miyuki; Shu, Huan; Nanni, Paolo; Köhler, Claudia; Gruissem, Wilhelm; Hennig, Lars


    In eukaryotic cells, histones are subject to a large number of posttranslational modifications whose sequential or combinatorial action affects chromatin structure and genome function. We identified acetylation at Lys-36 in histone H3 (H3K36ac) as a new chromatin modification in plants. The H3K36ac modification is evolutionary conserved in seed plants, including the gymnosperm Norway spruce (Picea abies) and the angiosperms rice (Oryza sativa), tobacco (Nicotiana tabacum), and Arabidopsis (Arabidopsis thaliana). In Arabidopsis, H3K36ac is highly enriched in euchromatin but not in heterochromatin. Genome-wide chromatin immunoprecipitation sequencing experiments revealed that H3K36ac peaks at the 5' end of genes, mainly on the two nucleosomes immediately distal to the transcription start site, independently of gene length. H3K36ac overlaps with H3K4me3 and the H2A.Z histone variant. The histone acetyl transferase GCN5 and the histone deacetylase HDA19 are required for H3K36ac homeostasis. H3K36ac and H3K36me3 show negative crosstalk, which is mediated by GCN5 and the histone methyl transferase SDG8. Although H3K36ac is associated with gene activity, we did not find a linear relationship between H3K36ac and transcript levels, suggesting that H3K36ac is a binary indicator of transcription. PMID:26764380

  19. Construction and function of recombinant AcMNPV with double copies of v-cath gene

    Institute of Scientific and Technical Information of China (English)


    Two recombinant baculoviruses, dciAcMNPV and dcdAcMNPV in which another copy of the v-cath gene controlled by ie1 promoter and polh promoter was inserted, were respectively constructed by the Bac-to-Bac system. The expression of the v-cath gene of the recombinant baculoviruses in Sf9 cells at different phases was investigated by SDS- PAGE and Western blot. The results showed that only recombinant virus dciAcMNPV containing late gene v-cath driven by early gene promoter could express V-CATH protein, cathepsin encoded by virus genome, 12 h post-infection and dcdAcMNPV containing late gene v-cath driven by late and very late gene promoters could express more V-CATH protein. Negative control ncAcMNPV, a mutant deleted v- cath gene, could not express V-CATH protein at all. The Spodopera exigua larvae were infected with viruses respectively and the results showed that the toxicity was as follows: dcdAcMNPV>dciAcMNPV>wtAcMNPV>ncAcMNPV. The toxicity of recombinant viruses and the characters of dead larvae showed that the v-cath gene was relative to viral toxicity and host liquefaction. Recombinant baculovirus dcdAcMNPV might be used as a new kind of safe viral-pes- ticide, because of its high toxicity obtained by adding another gene copy and changing the expression level of its own gene relative to virulence.

  20. Overexpressing mouse model demonstrates the protective role of Muc5ac in the lungs. (United States)

    Ehre, Camille; Worthington, Erin N; Liesman, Rachael M; Grubb, Barbara R; Barbier, Diane; O'Neal, Wanda K; Sallenave, Jean-Michel; Pickles, Raymond J; Boucher, Richard C


    MUC5AC, a major gel-forming mucin expressed in the lungs, is secreted at increased rates in response to infectious agents, implying that mucins exert a protective role against inhaled pathogens. However, epidemiological and pathological studies suggest that excessive mucin secretion causes airways obstruction and inflammation. To determine whether increased MUC5AC secretion alone produces airway obstruction and/or inflammation, we generated a mouse model overexpressing Muc5ac mRNA ~20-fold in the lungs, using the rCCSP promoter. The Muc5ac cDNA was cloned from mouse lungs and tagged internally with GFP. Bronchoalveolar lavage fluid (BALF) analysis demonstrated an approximate 18-fold increase in Muc5ac protein, which formed high-molecular-weight polymers. Histopathological studies and cell counts revealed no airway mucus obstruction or inflammation in the lungs of Muc5ac-transgenic (Muc5ac-Tg) mice. Mucus clearance was preserved, implying that the excess Muc5ac secretion produced an "expanded" rather than more concentrated mucus layer, a prediction confirmed by electron microscopy. To test whether the larger mucus barrier conferred increased protection against pathogens, Muc5ac-Tg animals were challenged with PR8/H1N1 influenza viruses and showed significant decreases in infection and neutrophilic responses. Plaque assay experiments demonstrated that Muc5ac-Tg BALF and purified Muc5ac reduced infection, likely via binding to α2,3-linked sialic acids, consistent with influenza protection in vivo. In conclusion, the normal mucus transport and absence of a pulmonary phenotype in Muc5ac-Tg mice suggests that mucin hypersecretion alone is not sufficient to trigger luminal mucus plugging or airways inflammation/goblet cell hyperplasia. In contrast, increased Muc5ac secretion appears to exhibit a protective role against influenza infection. PMID:23012413

  1. Concurrent Electroencephalography Recording During Transcranial Alternating Current Stimulation (tACS). (United States)

    Fehér, Kristoffer D; Morishima, Yosuke


    Oscillatory brain activities are considered to reflect the basis of rhythmic changes in transmission efficacy across brain networks and are assumed to integrate cognitive neural processes. Transcranial alternating current stimulation (tACS) holds the promise to elucidate the causal link between specific frequencies of oscillatory brain activity and cognitive processes. Simultaneous electroencephalography (EEG) recording during tACS would offer an opportunity to directly explore immediate neurophysiological effects of tACS. However, it is not trivial to measure EEG signals during tACS, as tACS creates a huge artifact in EEG data. Here we explain how to set up concurrent tACS-EEG experiments. Two necessary considerations for successful EEG recording while applying tACS are highlighted. First, bridging of the tACS and EEG electrodes via leaking EEG gel immediately saturates the EEG amplifier. To avoid bridging via gel, the viscosity of the EEG gel is the most important parameter. The EEG gel must be viscous to avoid bridging, but at the same time sufficiently fluid to create contact between the tACS electrode and the scalp. Second, due to the large amplitude of the tACS artifact, it is important to consider using an EEG system with a high resolution analog-to-digital (A/D) converter. In particular, the magnitude of the tACS artifact can exceed 100 mV at the vicinity of a stimulation electrode when 1 mA tACS is applied. The resolution of the A/D converter is of importance to measure good quality EEG data from the vicinity of the stimulation site. By following these guidelines for the procedures and technical considerations, successful concurrent EEG recording during tACS will be realized. PMID:26862814

  2. Alzheimer's Project

    Medline Plus

    Full Text Available ... state Home > News & Events > Upcoming Events > HBO Alzheimer’s Project In the News Walk to End Alzheimer's Upcoming ... Disease Awareness Month World Alzheimer's Month HBO Alzheimer’s Project MAKE A DONATION Your gift will help us ...

  3. Project SEED. (United States)

    Chemical and Engineering News, 1986


    Reports on Project SEED (Summer Educational Experience for the Disadvantaged) a project in which high school students from low-income families work in summer jobs in a variety of academic, industrial, and government research labs. The program introduces the students to career possibilities in chemistry and to the advantages of higher education.…

  4. AC Motor Drive Fed by Renewable Energy Sources with PWM

    Directory of Open Access Journals (Sweden)

    J. Pavalam


    Full Text Available In this fast aproaching nature of technology the ned of Electricity becomes a mandatory in developing technology. The ned of Electricity increases the power demand where the power demand met by the conventional sources of energy has some disadvantage of polution, this disadvantage can be decreased by the use of the Renewable energy sources like Fuel Cel and available solar energy. When a FUEL cel produces AC power, basicaly two stages are required for conversion first a bosting stage and second is inversion stage. In this paper the Bost inverter topology is achieved where in the conventional methods the normal DC - AC power conversion method is used where as in this paper the PWM based DC - AC inverter has ben used which is useful in reducing the harmonics in the output of the Inverter. The voltage controled output is produced in the bost inverter the curent controled output is taken from dc-dc bidirectional converter. The Fuel cel canot be relied as a whole so a Solar PV module is conected acros the Load so while the Sunlight days the PV arays generate power and in the night time the Fuel cel is used to generate power for the load. Since, the Fuel cel and PV arays can generate power in Partial load they are prefered than any other sources. When the output from the Solar PV aray is low or when the sunlight available is not eficient in generating the power a automatic switch over is provided in the junction betwen the Solar PV aray and Fuel cel so that whenever it hapens the switch automaticaly switch over to another source. The simulation results are presented to confirm the operational feature of the proposed system.

  5. Spectroscopic AC susceptibility imaging (sASI) of magnetic nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Ficko, Bradley W., E-mail:; Nadar, Priyanka M.; Diamond, Solomon G.


    This study demonstrates a method for alternating current (AC) susceptibility imaging (ASI) of magnetic nanoparticles (mNPs) using low cost instrumentation. The ASI method uses AC magnetic susceptibility measurements to create tomographic images using an array of drive coils, compensation coils and fluxgate magnetometers. Using a spectroscopic approach in conjunction with ASI, a series of tomographic images can be created for each frequency measurement set and is termed sASI. The advantage of sASI is that mNPs can be simultaneously characterized and imaged in a biological medium. System calibration was performed by fitting the in-phase and out-of-phase susceptibility measurements of an mNP sample with a hydrodynamic diameter of 100 nm to a Brownian relaxation model (R{sup 2}=0.96). Samples of mNPs with core diameters of 10 and 40 nm and a sample of 100 nm hydrodynamic diameter were prepared in 0.5 ml tubes. Three mNP samples were arranged in a randomized array and then scanned using sASI with six frequencies between 425 and 925 Hz. The sASI scans showed the location and quantity of the mNP samples (R{sup 2}=0.97). Biological compatibility of the sASI method was demonstrated by scanning mNPs that were injected into a pork sausage. The mNP response in the biological medium was found to correlate with a calibration sample (R{sup 2}=0.97, p<0.001). These results demonstrate the concept of ASI and advantages of sASI. - Highlights: • Development of an AC susceptibility imaging model. • Comparison of AC susceptibility imaging (ASI) and susceptibility magnitude imaging (SMI). • Demonstration of ASI and spectroscopic ASI (sASI) using three different magnetic nanoparticle types. • SASI scan separation of three different magnetic nanoparticles samples using 5 spectroscopic frequencies. • Demonstration of biological feasibility of sASI.

  6. Laser-modulated ac measurement of high temperature thermopower

    Institute of Scientific and Technical Information of China (English)

    Fan Zhen-Jun; Zhang Dian-Lin


    An experimental set-up for ac-measurement of thermopower between room temperature and 1200K by using modulated laser-heating has been developed. The method shows many advantages compared with the conventional dc-measurements: convenience, applicability to small samples, possibility to measure the anisotropy of single crystals,and capability to continuously trace the temperature dependence of thermopower. The thermopower of a very short piece of pure Pt was measured with the present set-up to test the reliability and accuracy of our new method.

  7. Strongly nonlinear dynamics of electrolytes in large ac voltages

    DEFF Research Database (Denmark)

    Olesen, Laurits Højgaard; Bazant, Martin Z.; Bruus, Henrik


    , ignoring any transverse instability or fluid flow. We analyze the resulting one-dimensional problem by matched asymptotic expansions in the limit of thin double layers and extend previous work into the strongly nonlinear regime, which is characterized by two features—significant salt depletion in the...... suppress the strongly nonlinear regime in the limit of concentrated electrolytes, ionic liquids, and molten salts. Beyond the model problem, our reduced equations for thin double layers, based on uniformly valid matched asymptotic expansions, provide a useful mathematical framework to describe additional...... nonlinear responses to large ac voltages, such as Faradaic reactions, electro-osmotic instabilities, and induced-charge electrokinetic phenomena....

  8. Warning: safety risk with some Apple AC Wall Plug Adapters

    CERN Multimedia

    CERN IT department


    Dear Mac and iOS Users, Apple has determined that some of its two prong Apple AC wall plug adapters may break and create a risk of electrical shock.   CERN users can now exchange their affected Apple wall plug adapters at the Service Desk. To find out if your adapter is affected and for any further information concerning the procedure to follow to exchange it, please check the following URL:

  9. AC dipole based optics measurement and correction at RHIC

    CERN Document Server

    Shen, X; Bai, M; White, S; Robert-Domolaize, G; Luo, Y; Marusic, A; Tomas, R


    Independent component analysis (ICA) was applied to the AC dipole based optics measurement at RHIC to extract beta functions as well as phase advances at each BPM. Existence of excessive beta-beat was observed in both rings of RHIC at polarized proton store energy. A unique global optics correction scheme was then developed and tested successfully during the RHIC polarized proton run in 2013. The feasibility of using horizontal closed orbit bump at sextupole for arc beta-beat correction was also demonstrated.

  10. SCR-controlled digitally programmable ac power supply

    International Nuclear Information System (INIS)

    A digitally programmable ac power supply was designed, built, and tested. Its output voltage may be programmed to be any one of 41 equally spaced voltage levels and may be switched from any level to any other level in one 60-Hz period (16.67 ms). The switching of voltages is accomplished by turning on and off individual silicon-controlled rectifiers (SCR's) in a network of 14 pairs of SCR's. The concept of this power supply is readily extendable to more or fewer voltage levels or higher or lower output currents or voltages than the particular supply described

  11. Total synthesis and allelopathic activity of cytosporones A-C

    Energy Technology Data Exchange (ETDEWEB)

    Zamberlam, Charles E.M.; Meza, Alisson; Lima, Denis P. de; Beatriz, Adilson [Centro de Ciencias Exatas e Tecnologia, Universidade Federal de Mato Grosso do Sul, Campo Grande, MS (Brazil); Leite, Carla Braga; Marques, Maria Rita [Centro de Ciencias Biologicas e da Saude, Universidade Federal de Mato Grosso do Sul, Campo Grande, MS (Brazil)


    The search for efficient, environmentally friendly herbicides has been the focus of numerous studies on the organic synthesis of compounds isolated from natural sources. Cytosporones, which are phenolic lipids isolated from fungi, exhibit noteworthy biological properties. This paper reports the preparation of cytosporones A-C from the same starting material through a short synthetic route, with good yields. All compounds were tested for allelopathic activity on lettuce (Lactuca sativa L) seeds. Cytosporone A and its methylated precursor showed remarkable allelopathic activity, inhibiting seed germination and plantule growth. (author)

  12. Photovoltaic Simplified Boost Z Source Inverter for Ac Module Applications

    Directory of Open Access Journals (Sweden)

    J. Sam Alaric


    Full Text Available This study mainly proposed PV z source boost inverter used to boundary grid or ac module applications. Separate types of converter used for solar system due to its current lagging, here capacitor multiplier based boost converter introduced for maintain the current lagging and voltage gain. Here, the switched inductor z source inverter implemented for grid interface. Proposed z source inverter is controlled by pulse width modulation. A simplified capacitor multiplier controlled by continuous conduction mode, A detailed topology analysis and a generalized discussion are given. The multiplier boost converter has the merits of maintain voltage level and reducing cost and current lagging. Simulation results are implemented and analysis MATLAB software.

  13. Stimulated Raman clock transition without a differential ac Stark

    International Nuclear Information System (INIS)

    We considered a stimulated Raman clock transition between the ground hyperfine states of an alkali atom by using the second-order perturbation theory and the spherical tensor formalism. When the light fields are circularly polarized and properly detuned, the differential ac Stark shift of the clock transition vanishes with non-vanishing transition amplitude. With a two-zone Raman Ramsey method and a slow atomic beam, the proposed scheme should result in a clock with a systematic shift of the order of a few mHz for the case of cesium. (author)

  14. A PWM transistor inverter for an ac electric vehicle drive (United States)

    Slicker, J. M.


    A prototype system consisting of closely integrated motor, inverter, and transaxle has been built in order to demonstrate the feasibility of a three-phase ac transistorized inverter for electric vehicle applications. The microprocessor-controlled inverter employs monolithic power transistors to drive an oil-cooled, three-phase induction traction motor at a peak output power of 30 kW from a 144 V battery pack. Transistor safe switching requirements are discussed, and a circuit is presented for recovering trapped snubber inductor energy at transistor turn-off.

  15. Impedance Localization Measurements using AC Dipoles in the LHC

    CERN Document Server

    Biancacci, Nicolo; Papotti, Giulia; Persson, Tobias; Salvant, Benoit; Tomás, Rogelio


    The knowledge of the LHC impedance is of primary importance to predict the machine performance and allow for the HL-LHC upgrade. The developed impedance model can be benchmarked with beam measurements in order to assess its validity and limit. This is routinely done, for example, moving the LHC collimator jaws and measuring the induced tune shift. In order to localize possible unknown impedance sources, the variation of phase advance with intensity between beam position monitors can be measured. In this work we will present the impedance localization measurements performed at injection in the LHC using AC dipoles as exciter as well as the underlying theory.

  16. Construction of Tunnel Diode Oscillator for AC Impedance Measurement (United States)

    Shin, J. H.; Kim, E.


    We construct a tunnel diode oscillator (TDO) to study electromagnetic response of a superconducting thin film. Highly sensitive tunnel diode oscillators allow us to detect extremely small changes in electromagnetic properties such as dielectric constant, ac magnetic susceptibility and magnetoresistance. A tunnel diode oscillator is a self-resonant oscillator of which resonance frequency is primarily determined by capacitance and inductance of a resonator. Amplitude of the signal depends on the quality factor of the resonator. The change in the impedance of the sample electromagnetic coupled to one of inductors in the resonator alters impedance of the inductor, and leads to the shift in the resonance frequency and the change of the amplitude.

  17. Total synthesis and allelopathic activity of cytosporones A-C

    International Nuclear Information System (INIS)

    The search for efficient, environmentally friendly herbicides has been the focus of numerous studies on the organic synthesis of compounds isolated from natural sources. Cytosporones, which are phenolic lipids isolated from fungi, exhibit noteworthy biological properties. This paper reports the preparation of cytosporones A-C from the same starting material through a short synthetic route, with good yields. All compounds were tested for allelopathic activity on lettuce (Lactuca sativa L) seeds. Cytosporone A and its methylated precursor showed remarkable allelopathic activity, inhibiting seed germination and plantule growth. (author)

  18. Ac superconducting articles and a method for their manufacture

    International Nuclear Information System (INIS)

    A novel ac superconducting article is described comprising a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface. (auth)

  19. Aspectos acústicos do comportamento dos golfinhos


    Santos, Manuel Eduardo dos


    Este artigo pretende apresentar uma recolha bibliográfica de alguns dados e hipóteses relativos a adaptações sensoriais e comunicativas dos cetáceos, particularmente dos golfinhos. São consideradas as suas capacidades perceptivas e as potencialidades dos canais de comunicação de que dispõem, sendo realçada a sua considerável especialização na utilização do canal acústico. Depois de uma breve referência às suas capacidades auditivas concretas e às teorias explicativa...

  20. Propiedades acústicas de los paneles de carrizo

    Directory of Open Access Journals (Sweden)

    Díaz, César


    Full Text Available Reed is a plant species very similar to common cane which is widespread all over the Earth. It is an ecological and sustainable material which is low-cost, aesthetically attractive, easy to obtain and install, and can be used in different construction systems. This work analyses the acoustic properties of reed panels from the point of view of sound absorption and sound insulation against airborne noise, according to the corresponding EN ISO standards. The experimental results obtained point to the conclusion that reed panels are suitable construction systems for controlling reverberant sound within a space, and that the sound reduction index values for different thicknesses of reed panels, or reed panels used in combination with wood particle boards, demonstrate the possibility of using them in construction as an element on the facades and roofs of buildings and for interior partitions.

    El carrizo es una especie vegetal, parecida a la caña común, que se encuentra ampliamente distribuida en la superficie terrestre. Es un material ecológico y sostenible de bajo coste, estéticamente aceptable, fácil de obtener y colocar, que permite generar diferentes sistemas constructivos. En este trabajo se analizan las propiedades acústicas de los paneles de carrizo en lo referente a la absorción acústica y al aislamiento acústico a ruido aéreo, para ello se han aplicado los procedimientos de las normas EN ISO correspondientes. De los resultados experimentales obtenidos se concluye que los paneles de carrizo son unos sistemas constructivos adecuados para el control del sonido reverberante en un recinto y que los valores del índice de reducción acústica de paneles de diferentes espesores o en combinación con tableros de partículas de madera muestran la posibilidad de utilizarlos en la edificación como elemento de fachada, en cubiertas de edificios y particiones interiores.

  1. AC Power Local Network with Multiple Power Routers

    Directory of Open Access Journals (Sweden)

    Ryo Takahashi


    Full Text Available Controlling power flow and achieving appropriate matching between power sources and loads according to the quality of energy is expected to be one of the approaches to reduce wasted energy consumption. A power router, proposed recently, has the capability of realizing circuit switching in a power distribution network. This study focuses on the feasibility of an AC power routing network system composed of multiple power routers. To evaluate the feasibility, we experimentally confirm the circuit switching operation of the parallel and series configurations of the power routers, so that the network system can be designed by the combination of parallel and series configurations.

  2. The Korea Brassica Genome Project: a Glimpse of the Brassica Genome Based on Comparative Genome Analysis With Arabidopsis

    Directory of Open Access Journals (Sweden)

    Beom-Seok Park


    Full Text Available A complete genome sequence provides unlimited information in the sequenced organism as well as in related taxa. According to the guidance of the Multinational Brassica Genome Project (MBGP, the Korea Brassica Genome Project (KBGP is sequencing chromosome 1 (cytogenetically oriented chromosome #1 of Brassica rapa. We have selected 48 seed BACs on chromosome 1 using EST genetic markers and FISH analyses. Among them, 30 BAC clones have been sequenced and 18 are on the way. Comparative genome analyses of the EST sequences and sequenced BAC clones from Brassica chromosome 1 revealed their homeologous partner regions on the Arabidopsis genome and a syntenic comparative map between Brassica chromosome 1 and Arabidopsis chromosomes. In silico chromosome walking and clone validation have been successfully applied to extending sequence contigs based on the comparative map and BAC end sequences. In addition, we have defined the (pericentromeric heterochromatin blocks with centromeric tandem repeats, rDNA and centromeric retrotransposons. In-depth sequence analyses of five homeologous BAC clones and an Arabidopsis chromosomal region reveal overall co-linearity, with 82% sequence similarity. The data indicate that the Brassica genome has undergone triplication and subsequent gene losses after the divergence of Arabidopsis and Brassica. Based on in-depth comparative genome analyses, we propose a comparative genomics approach for conquering the Brassica genome. In 2005 we intend to construct an integrated physical map, including sequence information from 500 BAC clones and integration of fingerprinting data and end sequence data of more than 100 000 BAC clones. The sequences have been submitted to GenBank with accession numbers: 10 204 BAC ends of the KBrH library (CW978640–CW988843; KBrH138P04, AC155338; KBrH117N09, AC155337; KBrH097M21, AC155348; KBrH093K03, AC155347; KBrH081N08, AC155346; KBrH080L24, AC155345; KBrH077A05, AC155343; KBrH020D15

  3. Phonon-Induced Electron-Hole Excitation and ac Conductance in Molecular Junction (United States)

    Ueda, Akiko; Utsumi, Yasuhiro; Imamura, Hiroshi; Tokura, Yasuhiro


    We investigate the linear ac conductance of molecular junctions under a fixed dc bias voltage in the presence of an interaction between a transporting electron and a single local phonon in a molecule with energy ω0. The electron-phonon interaction is treated by the perturbation expansion. The ac conductance as a function of the ac frequency ωac decreases or increases compared with the noninteracting case depending on the magnitude of the dc bias voltage. Furthermore, a dip emerges at ωac ˜ 2ω0. The dip originates from the modification of electron-hole excitation by the ac field, which cannot be obtained by treating the phonon in the linear regime of a classical forced oscillation.

  4. Low-Cost Voltage Zero-Crossing Detector for AC-Grid Applications


    Vorobyov Maxim; Vitols Kristaps


    Renewable energy sources and energy storage devices are becoming more popular. Some of them like small hydropower turbines, wind turbines and diesel generators produce AC voltage with different frequency and voltage than the main grid. For them power electronics converters are necessary. Power electronics converters presented in industry use two or three level energy conversion, although direct AC to AC converters exist, but one of the main problems is the switch commutation when current or v...

  5. Optimizing DC Voltage Droop Settings for AC/DC System Interactions


    Eriksson, Robert; Beerten, Jef; Ghandari, Mehrdad; Belmans, Ronnie


    In this paper, a methodology is presented to optimize the dc voltage droop settings in a multiterminal voltage-source converter high-voltage direct-current system with respect to the ac system stability. Implementing dc voltage droop control enables having multiple converters assisting the system in case of a converter outage. However, the abrupt power setpoint changes create additional stress in the ac system, especially when multiple converters are connected to the same interconnected ac sy...

  6. Overexpressing mouse model demonstrates the protective role of Muc5ac in the lungs


    Ehre, Camille; Worthington, Erin N.; Liesman, Rachael M.; Grubb, Barbara R.; Barbier, Diane; O’Neal, Wanda K; Sallenave, Jean-Michel; Pickles, Raymond J.; Boucher, Richard C.


    MUC5AC, a major gel-forming mucin expressed in the lungs, is secreted at increased rates in response to infectious agents, implying that mucins exert a protective role against inhaled pathogens. However, epidemiological and pathological studies suggest that excessive mucin secretion causes airways obstruction and inflammation. To determine whether increased MUC5AC secretion alone produces airway obstruction and/or inflammation, we generated a mouse model overexpressing Muc5ac mRNA ∼20-fold in...

  7. An NPV and AC Analysis of a Stochastic Inventory System with Joint Manufacturing and Remanufacturing


    Laan, Erwin


    textabstractWhile the net present value (NPV) approach is widely accepted as the right framework for studying production and inventory control systems, average cost (AC) models are more widely used. For the well known EOQ model it can be veri_ed that (under certain conditions) the AC approach gives near optimal results. This paper investigates whether the same holds for two-source systems with joint manufacturing and remanufacturing. It appears that the performance of the AC approach stands o...

  8. Magnetic behaviour of the UCuxGey system by AC magnetic susceptibility measurements

    International Nuclear Information System (INIS)

    We have analyzed the temperature dependence of the AC susceptibility, χac(T), of UCuxGey samples (0.800≤x, y≤1.00) applying various frequencies and magnetic field strengths up to 1 T. This was done in order to verify the reentrant ferromagnetic behaviour of UCuxGe and the antiferromagnetic behaviour of UCuGey previously observed by DC susceptibility experiments. Our χac results are discussed on the basis of existing theories. (orig.)

  9. Application of AC servo motor on the in-core neutron flux instrumentation system

    International Nuclear Information System (INIS)

    The application of ac servo motor in the In-Core Neutron Flux Instrumentation System is described. The hardware component of ac servo motor control system is different from the dc motor control system. The effect of two control system on the instrumentation system is compared. The ac servo motor control system can improve the accuracy of the motion control, optimize the speed control and increase the reliability. (authors)

  10. Nonlinear dynamics of Josephson vortices in a film screen under dc and ac magnetic fields


    Sheikhzada, Ahmad; Gurevich, Alexander


    We present detailed numerical simulations of Josephson vortices in a long Josephson junction perpendicular to a thin film screen under strong dc and ac magnetic fields. By solving the sine-Gordon equation, we calculated the threshold magnetic field for penetration of fluxons as a function of frequency, and the power dissipated by oscillating fluxons as functions of the ac field amplitude and frequency. We considered the effects of superimposed ac and dc fields, and a bi-harmonic magnetic fiel...

  11. The DART-Europe project: towards developing a European theses portal


    Ayris, P.; Pressler, C.; Moyle, M; McLean, A


    This paper will report on the new European theses project DART-Europe. The purpose of this project is to align institutional and national e-theses developments across Europe with the wider open archives movement by the construction of a European portal for research theses, thus enabling a global view of European institutional research assets. This project is driven through an innovative partnership between an information provider and an international body of university libraries and open ac...

  12. Glutathione preconditioning attenuates Ac-LDL-induced macrophage apoptosis via protein kinase C-dependent Ac-LDL trafficking. (United States)

    Rosenson-Schloss, Rene S; Chnari, Evangelia; Brieva, Thomas A; Dang, Anh; Moghe, Prabhas V


    Oxidized low-density lipoprotein (ox-LDL) incorporation into intimally resident vascular cells via scavenger receptors marks one of the early steps in atherosclerosis. Cellular apoptotic damage results from two major serial intracellular events: the binding and scavenger receptor-mediated uptake of oxidizable lipoproteins and the intracellular oxidative responses of accumulated lipoproteins. Most molecular approaches to prevent apoptotic damage have focused on singular events within the cascade of lipoprotein trafficking. To identify a multifocal strategy against LDL-induced apoptosis, we evaluated the role of cellular preconditioning by glutathione-ethyl ester (GSH-Et), a native redox regulator, in the prevention of the uptake and apoptotic effects of an oxidizable scavenger receptor-specific ligand, acetylated low-density lipoprotein (Ac-LDL). Our results indicate that GSH-Et-mediated protein kinase C (PKC) pathway modulation regulates Ac-LDL binding and incorporation into GSH-Et preconditioned cells and subsequently delays reactive oxygen intermediate generation and apoptotic conversion. The GSH-Et protective effects on apoptosis and Ac-LDL binding were reversed by calphostin C, a PKC inhibitor, and were accompanied by an increase in PKC phosphorylation. However, the rate of reactive oxygen intermediate accumulation was not increased following calphostin C treatment, suggesting that GSH-Et may play an important nonreactive oxygen-intermediate-based protective role in regulating apoptotic dynamics. Overall, we report on the novel role for GSH-Et preconditioning as a molecular strategy to limit lipoprotein entry into the cells, which presents a proactive modality to prevent cellular apoptosis in contrast with the prevalent antioxidant approaches that treat damage retroactively. PMID:15618124

  13. Prototypical Rod Consolidation Demonstration Project

    International Nuclear Information System (INIS)

    The objective of Phase 3 of the Prototypical Rod consolidation Demonstration Project (PRCDP) was to procure, fabricate, assemble, and test the Prototypical Rod consolidation System as described in the NUS Phase 2 Final Design Report. This effort required providing the materials, components, and fabricated parts which makes up all of the system equipment. In addition, it included the assembly, installation, and setup of this equipment at the Cold Test Facility. During the Phase 3 effort the system was tested on a component, subsystem, and system level. This volume 1, discusses the PRCDP Phase 3 Test Program that was conducted by the HALLIBURTON NUS Environmental Corporation under contract AC07-86ID12651 with the United States Department of Energy. This document, Volume 1, Book 2 discusses the following topics: Fuel Rod Extraction System Test Results and Analysis Reports and Clamping Table Test Results and Analysis Reports

  14. Prototypical Rod Construction Demonstration Project

    International Nuclear Information System (INIS)

    The objective of Phase 3 of the Prototypical Rod consolidation Demonstration Project (PRCDP) was to procure, fabricate, assemble, and test the Prototypical Rod consolidation System as described in the NUS Phase 2 Final Design Report. This effort required providing the materials, components, and fabricated parts which makes up all of the system equipment. In addition, it included the assembly, installation, and setup of this equipment at the Cold Test Facility. During the Phase 3 effort the system was tested on a component, subsystem, and system level. This volume 1, discusses the PRCDP Phase 3 Test Program that was conducted by the HALLIBURTON NUS Environmental Corporation under contract AC07-86ID12651 with the United States Department of Energy. This document, Volume 1, Book 3 discusses the following topics: Downender Test Results and Analysis Report; NFBC Canister Upender Test Results and Analysis Report; Fuel Assembly Handling Fixture Test Results and Analysis Report; and Fuel Canister Upender Test Results and Analysis Report

  15. Current Control and Energy Balancing of a Square-Wave Powered 1AC-3AC Modular Multilevel Converter


    Schnarrenberger, Mathias; Kammerer, Felix; Gommeringer, Mario; Kolb, Johannes; Braun, Michael


    This paper presents a new control method for a Modular Multilevel Converter (MMC) fed by a push-pull converter via a medium frequency (MF) transformer. Application of this topology is a universal high-precision 3AC voltage source for a Power Hardware-in-the-Loop Emulator with a frequency range from DC up to almost the medium frequency. Advantages are high efficiency, very low harmonic distortion and high dynamics of the output voltage which can be used e.g. for simulation of electrical machin...

  16. Three-phase AC-AC power converters based on matrix converter topology matrix-reactance frequency converters concept

    CERN Document Server

    Szczesniak, Pawel


    AC voltage frequency changes is one of the most important functions of solid state power converters. The most desirable features in frequency converters are the ability to generate load voltages with arbitrary amplitude and frequency, sinusoidal currents and voltages waveforms; the possibility of providing unity power factor for any load; and, finally, a simple and compact power circuit. Over the past decades, a number of different frequency converter topologies have appeared in the literature, but only the converters with either a voltage or current DC link are commonly used in industrial app

  17. Random sampling of an AC source A tool to teach probabilistic observations

    CERN Document Server

    Chandi, P S; Shankar, R; Singh, R C


    An undergraduate level experiment is described to demonstrate the role of probabilistic observations in physics. A capacitor and a DC voltmeter are used to randomly sample an AC voltage source. The resulting probability distribution is analyzed to extract information about the AC source. Different characteristic probability distributions arising from various AC waveforms are calculated and experimentally measured. The reconstruction of the AC waveform is demonstrated from the measured probability distribution under certain restricted circumstances. The results are also compared with a simulated data sample. We propose this as a pedagogical tool to teach probabilistic measurements and their manipulations.

  18. Energy saving measures for automotive air conditioning (AC) system in the tropics


    Subiantoro, Alison; Ooi, Kim Tiow; Stimming, Ulrich


    Air conditioning (AC) is an integral component of modern cars in the tropics. However, AC usage in this region consumes a large amount of energy. In conventional internal combustion engine cars, it consumes up to 30% of the fuel, while in battery electric cars, AC may reduce the battery range by up to 40%. Fortunately, there are various ways to improve the efficiency of automotive ACs in the tropics. In this paper, three energy saving measures are discussed. These include a higher indoor temp...

  19. Redes de Control de la Contaminación Acústica


    Perera, P; Santiago Páez, José Salvador


    La Contaminación Acústica se concentra en las ciudades, que han crecido sin considerar el ruido como un factor determinante de la Planificación Urbana. La realidad actual, es que las ciudades son ruidosas y las administraciones tienen el deber de mejorar su calidad acústica. El primer paso para poder abordar el problema con garantías, es el conocimiento de su "realidad acústica". Los mapas acústicos son uno de los procedimientos utilizados para este cometido, pero la información que proporcio...

  20. Hybrid AC-DC offshore wind power plant topology: optimal design


    Prada Gil, Mikel de; Igualada González, Lucía; Corchero García, Cristina; Gomis Bellmunt, Oriol; Sumper, Andreas


    The aim of this paper is to present a hybrid AC-DC offshore wind power plant (OWPP) topology and to optimize its design in order to minimize the OWPP's total cost. This hybrid concept is based on clustering wind turbines and connecting each group to an AC/DC power converter installed on a collector platform which is located between the AC wind turbine array and the HVDC offshore platform. Thereby, individual power converters of each wind turbine are not required, since such AC/DC converters c...

  1. Harmonics of the AC susceptibility as probes to differentiate the various creep models


    Adesso*, M. G.; Senatore, C.; Polichetti, M.; Pace, S.


    We measured the temperature dependence of the 1st and the 3rd harmonics of the AC magnetic susceptibility on some type II superconducting samples at different AC field amplitudes, hAC. In order to interpret the measurements, we computed the harmonics of the AC susceptibility as function of the temperature T, by integrating the non-linear diffusion equation for the magnetic field with different creep models, namely the vortex glass-collective creep (single-vortex, small bundle and large bundle...

  2. Effect of AC electric fields on the stabilization of premixed bunsen flames

    KAUST Repository

    Kim, Minkuk


    The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.

  3. Cabibbo-Suppressed Non-leptonic Decays of Ac and Final State Interaction

    Institute of Scientific and Technical Information of China (English)

    CHEN Shao-Long; GUO Xin-Heng; LI Xue-Qian; WANG Guo-Li


    With the diquark structure of Ac, we investigate the branching ratio of Ac → nr+ and pro. The results show that without considering the final state interaction (FSI), the branching ratio of Ac → pπ0 is only of order 10-6 whereas this ratio could reach 10-4 and is at the same order as Ac → nr+ if taking into account the FSI effects. Concrete values depend on phenomenological parameters adopted in the calculations. These branching ratios can be measured in the experiments to come.

  4. Modelling of AC loss in coils made of thin tapes under DC bias current


    Pardo, Enric


    Many applications, such as magnets and SMES, are usually charged and discharged under a bias DC current, which may increase the AC loss. For their design, it is necessary to understand and predict the AC loss. This article analises the AC loss in magnet-like coils under DC bias contribution super-imposed to the AC current. The analysis is based on a numerical model that takes the interaction between magnetization currents in all turns into account. The studied example is a stack of 32 pancake...

  5. A New Approach for RRR Determination of Niobium Single Crystal Based on AC Magnetic Susceptibility (United States)

    Ermakov, Alexey; Korolev, Alexander V.; Singer, Waldemar; Singer, Xenia


    Residual resistivity ratio RRR is an important integral characteristic of material purity. It was proposed to determine the RRR on base of the AC susceptibility. AC susceptibility of a number of single crystal niobium samples of different orientations types ( , rpar; and differently treated (BCP 70, 150 μm, annealing 800° C/2h) was measured. The RRR value was determined on base of these results using a relation between the imaginary part of χ″ of AC magnetic susceptibility at low frequency, AC magnetic field and resistivity ρ of the sample.

  6. ac Stark gradient echo memory in cold atoms

    International Nuclear Information System (INIS)

    The burgeoning fields of quantum computing and quantum key distribution have created a demand for a quantum memory. The gradient echo memory scheme is a quantum memory candidate for light storage that can boast efficiencies approaching unity, as well as the flexibility to work with either two- or three-level atoms. The key to this scheme is the frequency gradient that is placed across the memory. Currently, the three-level implementation uses a Zeeman gradient and warm atoms. In this article we model an alternate gradient-creation mechanism--the ac Stark effect--to provide an improvement in the flexibility of gradient-creation and field-switching times. We propose this scheme in concert with a move to cold atoms (≅1 mK). These temperatures would increase the storage times possible, and the small ensemble volumes would enable large ac Stark shifts with reasonable laser power. We find that memory bandwidths on the order of MHz can be produced with experimentally achievable laser powers and trapping volumes, with high precision in gradient creation and switching times on the order of nanoseconds possible. By looking at the different decoherence mechanisms present in this system, we determine that coherence times on the order of tens of milliseconds are possible, as are delay-bandwidth products of approximately 50 and efficiencies over 90%.

  7. Accelerated life ac conductivity measurements of CRT oxide cathodes (United States)

    Hashim, A. A.; Barratt, D. S.; Hassan, A. K.; Nabok, A.


    The ac conductivity measurements have been carried out for the activated Ba/SrO cathode with additional 5% Ni powder for every 100 h acceleration life time at the temperature around 1125 K. The ac conductivity was studied as a function of temperature in the range 300-1200 K after conversion and activation of the cathode at 1200 K for 1 h in two cathodes face to face closed configuration. The experimental results prove that the hopping conductivity dominate in the temperature range 625-770 K through the traps of the WO 3 associate with activation energy Ea = 0.87 eV, whereas from 500-625 K it is most likely to be through the traps of the Al 2O 3 with activation energy of Ea = 1.05 eV. The hopping conductivity at the low temperature range 300-500 K is based on Ni powder link with some Ba contaminants in the oxide layer stricture which indicates very low activation energy Ea = 0.06 eV.

  8. Long-range response in ac electricity grids. (United States)

    Jung, Daniel; Kettemann, Stefan


    Local changes in the topology of electricity grids can cause overloads far away from the disturbance [D. Witthaut and M. Timme, Eur. Phys. J. B 86, 377 (2013)EPJBFY1434-602810.1140/epjb/e2013-40469-4], making the prediction of the robustness against changes in the topology-for example, caused by power outages or grid extensions-a challenging task. The impact of single-line additions on the long-range response of dc electricity grids has recently been studied [D. Labavić, R. Suciu, H. Meyer-Ortmanns, and S. Kettemann, Eur. Phys. J.: Spec. Top. 223, 2517 (2014)1951-635510.1140/epjst/e2014-02273-0]. By solving the real part of the static ac load flow equations, we conduct a similar investigation for ac grids. In a regular two-dimensional grid graph with cyclic boundary conditions, we find a power law decay for the change of power flow as a function of distance to the disturbance over a wide range of distances. The power exponent increases and saturates for large system sizes. By applying the same analysis to the German transmission grid topology, we show that also in real-world topologies a long-ranged response can be found. PMID:27575148


    Directory of Open Access Journals (Sweden)



    Full Text Available Photovoltaic generators (PVG are increasingly used to provide electricity in remote areas. However, in many applications the DC generated electricity by a PVG need to be converted to AC. Traditionally DC to AC inverters have been widely used for this purpose. In this paper, a different system is proposed in which a self excited induction generator (SEIG driven by a permanent magnet DC motor (DCM and powered from a PVG through a maximum power point tracker (MPPT are used. A step-up chopper is utilized as an MPPT unit. The proposed system is modelled in time domain, and a detailed transient and steady-state analysis are presented. The main reason behind analyzing the system in the time domain is because of the fact that for unknown speeds, the methods developed for steady-state analysis of SEIGs can not be applied. The presented work shows that the full available power of the PVG can be harnessed by selecting suitable values for the duty cycle and the frequency of the step up chopper and the excitation capacitor of the SEIG. It is also shown that with such a combination power utilization efficiency of more than 83% can be achieved.

  10. Perfecting the Photometric Calibration of the ACS CCD Cameras

    CERN Document Server

    Bohlin, Ralph C


    Newly acquired data and improved data reduction algorithms mandate a fresh look at the absolute flux calibration of the CCD cameras on the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS). The goals are to achieve a 1\\% accuracy and to make this calibration more accessible to the HST guest investigator. Absolute fluxes from the CALSPEC\\footnote{} database for three primary hot 30,000--60,000K WDs define the sensitivity calibrations for the WFC and HRC filters. The external uncertainty for the absolute flux is $\\sim$1\\%, while the internal consistency of the sensitivities in the broadband ACS filters is $\\sim$0.3\\% among the three primary WD flux standards. For stars as cool as K type, the agreement with the CALSPEC standards is within 1\\% at the WFC1-1K subarray position, which achieves the 1\\% precision goal for the first time. After making a small adjustment to the filter bandpass for F814W, the 1\\% precision goal is achieved over the full ...

  11. Perfecting the Photometric Calibration of the ACS CCD Cameras (United States)

    Bohlin, Ralph C.


    Newly acquired data and improved data reduction algorithms mandate a fresh look at the absolute flux calibration of the charge-coupled device cameras on the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS). The goals are to achieve a 1% accuracy and to make this calibration more accessible to the HST guest investigator. Absolute fluxes from the CALSPEC1 database for three primary hot 30,000–60,000K WDs define the sensitivity calibrations for the Wide Field Channel (WFC) and High Resolution Channel (HRC) filters. The external uncertainty for the absolute flux is ˜1%, while the internal consistency of the sensitivities in the broadband ACS filters is ˜0.3% among the three primary WD flux standards. For stars as cool as K type, the agreement with the CALSPEC standards is within 1% at the WFC1-1K subarray position, which achieves the 1% precision goal for the first time. After making a small adjustment to the filter bandpass for F814W, the 1% precision goal is achieved over the full F814W WFC field of view for stars of K type and hotter. New encircled energies and absolute sensitivities replace the seminal results of Sirianni et al. that were published in 2005. After implementing the throughput updates, synthetic predictions of the WFC and HRC count rates for the average of the three primary WD standard stars agree with the observations to 0.1%.

  12. SQUIDs De-fluxing Using a Decaying AC Magnetic Field

    Energy Technology Data Exchange (ETDEWEB)

    Matlashov, Andrei Nikolaevich [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Semenov, Vasili Kirilovich [State Univ. of New York (SUNY), Plattsburgh, NY (United States); Anderson, Bill [Senior Scientific, LLC, Albuquerque, NM (United States)


    Flux trapping is the Achilles’ heel of all superconductor electronics. The most direct way to avoid flux trapping is a prevention of superconductor circuits from exposure to magnetic fields. Unfortunately this is not feasible if the circuits must be exposed to a strong DC magnetic field even for a short period of time. For example, such unavoidable exposures take place in superparamagnetic relaxation measurements (SPMR) and ultra-low field magnetic resonance imaging (ULF MRI) using unshielded thin-film SQUID-based gradiometers. Unshielded SQUIDs stop working after being exposed to DC magnetic fields of only a few Gauss in strength. In this paper we present experimental results with de-fluxing of planar thin-film LTS SQUID-based gradiometers using a strong decaying AC magnetic field. We used four commercial G136 gradiometers for SPMR measurements with up to a 10 mT magnetizing field. Strong 12.9 kHz decaying magnetic field pulses reliably return SQUIDs to normal operation 50 ms after zeroing the DC magnetizing field. This new AC de-fluxing method was also successfully tested with seven other different types of LTS SQUID sensors and has been shown to dissipate extremely low energy.

  13. Memory Convergence and Optimization with Fuzzy PSO and ACS

    Directory of Open Access Journals (Sweden)

    Subhash C. Pandey


    Full Text Available Associative neural memories are models of biological phenomena that allow for the storage of pattern associations and the retrieval of the desired output pattern upon presentation of a possibly noisy or incomplete version of an input pattern. In this study, we introduce fuzzy swarm particle optimization technique for convergence of associative neural memories based on fuzzy set theory. A Fuzzy Particle Swarm Optimization (FPSO consists of clustering of swarm's particle by applying fuzzy c-mean algorithm to attain the neighborhood best. We present a singular value decomposition method for the selection of efficient rule from a given rule base required to attain the global best. Finally, we illustrate the proposed method by virtue of some examples. Further, ant colony system ACS algorithm is used to study the Symmetric Traveling Salesman Problem TSP. The optimum parameters for this algorithm have to found by trial and error. The ACS parameters working in a designed subset of TSP instances has also been optimized by virtue of Particle Swarm Optimization PSO.

  14. AcMNPV As A Model for Baculovirus DNA Replication

    Institute of Scientific and Technical Information of China (English)

    Eric B. Carstens


    Baculoviruses were first identified as insect-specific pathogens, and it was this specificity that lead to their use as safe, target specific biological pesticides. For the past 30 years, AcMNPV has served as the subject of intense basic molecular research into the baculovirus infectious cycle including the interaction of the virus with a continuous insect cell line derived from Spodoptera frugiperda. The studies on baculoviruese have led to an in-depth understanding of the physical organization of the viral genomes including many complete genomic sequences, the time course of gene expression, and the application of this basic research to the use of baculoviruses not only as insecticides, but also as a universal eukaryotic protein expression system, and a potential vector in gene therapy. A great deal has also been discovered about the viral genes required for the replication of the baculovirus genome, while much remains to be learned about the mechanism of viral DNA replication. This report outlines the current knowledge of the factors involved in baculovirus DNA replication, using data on AcMNPV as a model for most members of the Baculoviridae.

  15. Resonant tunneling of interacting electrons in an AC electric field

    International Nuclear Information System (INIS)

    The problem of the effect of electron-electron interaction on the static and dynamic properties of a double-barrier nanostructure (resonant tunneling diode (RTD)) is studied in terms of a coherent tunneling model, which includes a set of Schrödinger and Poisson equations with open boundary conditions. Explicit analytical expressions are derived for dc and ac potentials and reduced (active and reactive) currents in the quasi-classical approximation over a wide frequency range. These expressions are used to analyze the frequency characteristics of RTD. It is shown that the interaction can radically change the form of these expressions, especially in the case of a hysteretic I-V characteristic. In this case, the active current and the ac potentials can increase sharply at both low and high frequencies. For this increase to occur, it is necessary to meet quantum regime conditions and to choose a proper working point in the I-V characteristic of RTD. The possibility of appearance of specific plasma oscillations, which can improve the high-frequency characteristics of RTD, is predicted. It is found that the active current can be comparable with the resonant dc current of RTD

  16. Resonant tunneling of interacting electrons in an AC electric field

    Energy Technology Data Exchange (ETDEWEB)

    Elesin, V. F., E-mail: [National Research Nuclear University MEPhI (Russian Federation)


    The problem of the effect of electron-electron interaction on the static and dynamic properties of a double-barrier nanostructure (resonant tunneling diode (RTD)) is studied in terms of a coherent tunneling model, which includes a set of Schrödinger and Poisson equations with open boundary conditions. Explicit analytical expressions are derived for dc and ac potentials and reduced (active and reactive) currents in the quasi-classical approximation over a wide frequency range. These expressions are used to analyze the frequency characteristics of RTD. It is shown that the interaction can radically change the form of these expressions, especially in the case of a hysteretic I-V characteristic. In this case, the active current and the ac potentials can increase sharply at both low and high frequencies. For this increase to occur, it is necessary to meet quantum regime conditions and to choose a proper working point in the I-V characteristic of RTD. The possibility of appearance of specific plasma oscillations, which can improve the high-frequency characteristics of RTD, is predicted. It is found that the active current can be comparable with the resonant dc current of RTD.

  17. AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Data name AcEST(EST... sequences of Adiantum capillus-veneris and their annotation) Description of data contents EST sequence of Adiantum capi...db/view/archive_acest#en Data acquisition method Capillary sequencer Data analysi...atabases) Number of data entries Adiantum capillus-veneris ESTs: 30,540. Data item Description Clone id Clon...e ID of EST sequence of Adiantum capillus-veneris. Library Library name Length Nu

  18. La crisis del siglo XII A.C. pueblos del mar y guerra de Troya ca. 1215-1175 A.C.


    Mederos Martín, Alfredo


    Los ataques de los Pueblos del Mar se produjeron en dos momentos diferentes, separados por 32 años, ca. 1208 y ca. 1176 a.C., y fueron efectos colaterales de las crisis de dos grandes estados, primero Ahhiyawa y posteriormente Hatti. Esta fase de inestabilidad se generalizó en el Mediterráneo Oriental a partir de la muerte de Ramses II ca. 1213 a.C. y Tudhaliya IV, ca. 1215/1209 a.C., en la cual las tensiones internas dentro de Hatti y Egipto, por los problemas sucesorios, tuvieron una import...

  19. Alzheimer's Project

    Medline Plus

    Full Text Available ... Alzheimer's Gala A Night at Sardi's Alzheimer's Disease Awareness Month World Alzheimer's Month HBO Alzheimer’s ... HBO's "THE ALZHEIMER'S PROJECT" takes a look at the faces behind the disease - and the forces leading us ...

  20. Alzheimer's Project

    Medline Plus

    Full Text Available ... about the films on our message board . Watch films free online now "The Memory Loss Tapes" (85 ... ALZHEIMER'S PROJECT" is a presentation of HBO Documentary Films and the National Institute on Aging at the ...

  1. Alzheimer's Project

    Medline Plus

    Full Text Available ... and the effects this debilitating and fatal disease has on those with Alzheimer's and their families. September ... Alzheimer's care, support and research, the Alzheimer's Association has been an active partner in "THE ALZHEIMER'S PROJECT," ...

  2. Alzheimer's Project

    Medline Plus

    Full Text Available ... Web site . Become an Alzheimer's champion. Help support vital research and services. "THE ALZHEIMER'S PROJECT" is a ... Your Local Chapter Get the facts 10 warning signs What is dementia What is Alzheimer's Stages of ...

  3. Alzheimer's Project

    Medline Plus

    Full Text Available ... 272.3900 Find your chapter: search by state Home > News & Events > Upcoming Events > HBO Alzheimer’s Project In the News Walk to End Alzheimer's Upcoming Events AAIC Advocacy Forum Rita ...

  4. Project Reptile! (United States)

    Diffily, Deborah


    Integrating curriculum is important in helping children make connections within and among areas. Presents a class project for kindergarten children which came out of the students' interests and desire to build a reptile exhibit. (ASK)

  5. Alzheimer's Project

    Medline Plus

    Full Text Available ... our nation and drive concerned citizens to take action. Here are three ways you can help us change the way ... vital research and services. "THE ALZHEIMER'S PROJECT" is a presentation ...

  6. Alzheimer's Project

    Medline Plus

    Full Text Available ... 14, 2009 "The Alzheimer's Project" wins two Creative Arts Emmys Two installments of the multi-part HBO ... from the Alzheimer's Association and others, won Creative Arts Emmy awards. "The Memory Loss Tapes" was honored ...

  7. Radiochemistry Project

    International Nuclear Information System (INIS)

    Researches carried out in the 'Radiochemistry Project' of the Agricultural Nuclear Energy Center, Piracicaba, Sao Paulo State, Brazil, are described. Such researches comprise: dosimetry and radiological protection; development of techniques and methods of chemical analysis and radiochemistry. (M.A.)

  8. Alzheimer's Project

    Medline Plus

    Full Text Available ... thinks about Alzheimer's disease. Tell your family and friends. Post info on your Web site . Become an Alzheimer's champion. Help support vital research and services. "THE ALZHEIMER'S PROJECT" is a presentation ...

  9. Alzheimer's Project

    Medline Plus

    Full Text Available ... disease has on those with Alzheimer's and their families. September 14, 2009 "The Alzheimer's Project" wins two ... way Americans thinks about Alzheimer's disease. Tell your family and friends. Post info on your Web site . ...

  10. Alzheimer's Project

    Medline Plus

    Full Text Available ... your family and friends. Post info on your Web site . Become an Alzheimer's champion. Help support vital research and services. "THE ALZHEIMER'S PROJECT" is a presentation of HBO ...

  11. Project Management

    DEFF Research Database (Denmark)

    Kampf, Constance


    In this video Associate Professor Constance Kampf talks about the importance project management. Not only as a tool in implementation, but also as a way of thinking, and as something that needs to be considered from idea conception......In this video Associate Professor Constance Kampf talks about the importance project management. Not only as a tool in implementation, but also as a way of thinking, and as something that needs to be considered from idea conception...

  12. LAPI project


    Soler Vich, Josep Francesc


    This project carries out a part of a new location application. This service consists of location-based application that connects with a location server. That server provides the necessary location information to run the service. Then an interface between the location-based application and the location server is needed. That interface could be a Location Application Programming Interface (LAPI), and the development of one LAPI is the goal of this project.

  13. Project Megawatt: experience with photovoltaics in Switzerland

    International Nuclear Information System (INIS)

    The Megawatt Project is designed for a high-volume installation of standardized, small-scale, roof-top mounted residential, grid-connected photovoltaic systems. To facilitate grid-connection of PV systems, a 3kW, high-efficiency, AC-DC inverter was designed, with a 50 kHz pulse-width modulator and a field effect transistor technology. A one-to-one cost system for kW-h bought and sold to the utility by the homeowner has been achieved

  14. Mathematical modeling of Automatic Control System (ACS) and synchronous motor in high reliability power supply systems in Kozloduy NPP - set up optimization of ACS

    International Nuclear Information System (INIS)

    The article presents the models of Automatic Control System (ACS) and synchronous motor of the reversible generator-engine groups of the first category power supply section in the Kozloduy NPP units 1 to 4. The control parameter is the magnetic field. The research aims are optimal ACS setups, property control guaranties in accordance with the technical requirements. The used synchronous machine model is included in Matlab5.x library. For optimization the instruments of optimization toolbox - NCD out port block and plant actuator and created basic models of variable Discrete PID-regulator and PWM system are utilized. The results are applied for the setup of the real ACS. The results precision of the created models gives a possibility for a real summary model development and the achieved models implementation in cases of fluctuations of AC/DC reversible electromechanical supply

  15. Mathematical modeling of Automatic Control System (ACS) and synchronous generator in high reliability power supply systems in Kozloduy NPP - set up optimization of ACS

    International Nuclear Information System (INIS)

    The article presents the models of Automatic Control System (ACS) and synchronous generator of the reversible generator-engine groups of first category power supply section in the Kozloduy NPP units 1 to 4. The control parameter is the synchronous machine tension. The research aims are optimal ACS setups, property control guaranties in accordance with the technical requirements. The used synchronous machine model is included in Matlab5.x library. For optimization the instruments of optimization toolbox - NCD out port block and plant actuator and created basic models of variable Discrete PID-regulator and PWM system are utilized. The results are applied for the setup of the real ACS. The results precision of the created models gives a possibility for a real summary model development and the achieved models implementation in cases of fluctuations of AC/DC reversible electromechanical supply

  16. Intégration fonctionnelle autour des composants quatre quadrants
    Avec l'application à la conversion AC/AC


    Nguyen, Dac-Binh


    La thèse porte sur l'intégration fonctionnelle autour des composants commandables bidirectionnels en courant et en tension, avec pour application, la conversion AC-AC à prélèvement sinusoïdal (PFC). La première partie du document de thèse présente la mise en oeuvre d'un gradateur AC-AC à l'aide de dispositifs intégrables. Certains bénéfices sont clairement mis en évidence à travers une analyse fonctionnelle et une validation expérimentale complètes. La seconde partie du mémoire porte sur l'in...

  17. Numerical and theoretical evaluations of AC losses for single and infinite numbers of superconductor strips with direct and alternating transport currents in external AC magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Kajikawa, K., E-mail: [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Funaki, K. [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Shikimachi, K.; Hirano, N.; Nagaya, S. [Chubu Electric Power Co., Inc., 20-1 Kitasekiyama, Ohdaka-cho, Midori-ku, Nagoya 459-8522 (Japan)


    AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.

  18. Numerical and theoretical evaluations of AC losses for single and infinite numbers of superconductor strips with direct and alternating transport currents in external AC magnetic field (United States)

    Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.


    AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean’s critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.

  19. AC loss in striped (filamentary) YBCO coated conductors leading to designs for high frequencies and field-sweep amplitudes

    International Nuclear Information System (INIS)

    AC losses of YBCO coated conductors are investigated by calculation and experiment for the higher frequency regime. Previous research using YBCO film deposited onto single-crystal substrates demonstrated the effectiveness of 'striping' or filamentary subdivision as a technique for AC loss reduction. As a result of these studies the idea of subdividing YBCO 'coated conductors' (YBCO, overlayer, and even underlayer) into such stripes suggested itself. The suggestion was implemented by burning grooves into samples of coated conductor using laser micromachining. Various machining parameters were investigated, and the striping and slicing characteristics are presented. Loss measurements were performed on unstriped as well as striped samples by the pick-up coil technique at frequencies from 50 to 200 Hz at field sweep amplitudes of up to 150 mT. The effect of soft ferromagnetic Fe shielding was also investigated. The results of the experiments form a starting point for a more general study of reduced-loss coated conductor design (including hysteretic, coupling, normal eddy current, and transport losses) projected into higher ranges of frequency and field-sweep amplitude with transformer and all-cryogenic-motor/generator applications in mind

  20. Multi-wavelength observations of a rich galaxy cluster at z ~ 1: the HST/ACS colour-magnitude diagram

    CERN Document Server

    Santos, Joana S; Gobat, Raphael; Lidman, Chris; Dawson, Kyle; Perlmutter, Saul; Boehringer, Hans; Balestra, Italo; Mullis, Chris R; Fassbender, Rene; Kohnert, Jan; Lamer, Georg; Rettura, Alessandro; Rite, Charles; Schwope, Axel


    XMMU J1229+0151 is a rich galaxy cluster with redshift z=0.975, that was serendipitously detected in X-rays within the scope of the XMM-Newton Distant Cluster Project. HST/ACS observations in the i775 and z850 passbands, as well as VLT/FORS2 spectroscopy were further obtained, in addition to follow-up Near-Infrared (NIR) imaging in J- and Ks-bands with NTT/SOFI. We investigate the photometric, structural and spectral properties of the early-type galaxies in the high-redshift cluster XMMU J1229+0151. Source detection and aperture photometry are performed in the optical and NIR imaging. Galaxy morphology is inspected visually and by means of Sersic profile fitting to the 21 spectroscopically confirmed cluster members in the ACS field of view. The i775-z850 colour-magnitude relation (CMR) is derived with a method based on galaxy magnitudes obtained by fitting the surface brightness of the galaxies with Sersic models. The i775-z850 CMR of the spectroscopic members shows a very tight red-sequence with a zero point...