WorldWideScience

Sample records for acs fornax cluster

  1. THE ACS FORNAX CLUSTER SURVEY. X. COLOR GRADIENTS OF GLOBULAR CLUSTER SYSTEMS IN EARLY-TYPE GALAXIES

    International Nuclear Information System (INIS)

    Liu Chengze; Peng, Eric W.; Jordan, Andres; Ferrarese, Laura; Blakeslee, John P.; Cote, Patrick; Mei, Simona

    2011-01-01

    We use the largest homogeneous sample of globular clusters (GCs), drawn from the ACS Virgo Cluster Survey (ACSVCS) and ACS Fornax Cluster Survey (ACSFCS), to investigate the color gradients of GC systems in 76 early-type galaxies. We find that most GC systems possess an obvious negative gradient in (g-z) color with radius (bluer outward), which is consistent with previous work. For GC systems displaying color bimodality, both metal-rich and metal-poor GC subpopulations present shallower but significant color gradients on average, and the mean color gradients of these two subpopulations are of roughly equal strength. The field of view of ACS mainly restricts us to measuring the inner gradients of the studied GC systems. These gradients, however, can introduce an aperture bias when measuring the mean colors of GC subpopulations from relatively narrow central pointings. Inferred corrections to previous work imply a reduced significance for the relation between the mean color of metal-poor GCs and their host galaxy luminosity. The GC color gradients also show a dependence with host galaxy mass where the gradients are weakest at the ends of the mass spectrum-in massive galaxies and dwarf galaxies-and strongest in galaxies of intermediate mass, around a stellar mass of M * ∼10 10 M sun . We also measure color gradients for field stars in the host galaxies. We find that GC color gradients are systematically steeper than field star color gradients, but the shape of the gradient-mass relation is the same for both. If gradients are caused by rapid dissipational collapse and weakened by merging, these color gradients support a picture where the inner GC systems of most intermediate-mass and massive galaxies formed early and rapidly with the most massive galaxies having experienced greater merging. The lack of strong gradients in the GC systems of dwarfs, which probably have not experienced many recent major mergers, suggests that low-mass halos were inefficient at retaining

  2. THE ACS FORNAX CLUSTER SURVEY. IV. DEPROJECTION OF THE SURFACE BRIGHTNESS PROFILES OF EARLY-TYPE GALAXIES IN THE VIRGO AND FORNAX CLUSTERS: INVESTIGATING THE 'CORE/POWER-LAW DICHOTOMY'

    International Nuclear Information System (INIS)

    Glass, Lisa; Ferrarese, Laura; Cote, Patrick; Blakeslee, John P.; Chen, Chin-Wei; Jordan, Andres; Infante, Leopoldo; Peng, Eric; Mei, Simona; Tonry, John L.; West, Michael J.

    2011-01-01

    Although early observations with the Hubble Space Telescope (HST) pointed to a sharp dichotomy among early-type galaxies in terms of the logarithmic slope γ' of their central surface brightness profiles, several studies in the past few years have called this finding into question. In particular, recent imaging surveys of 143 early-type galaxies belonging to the Virgo and Fornax Clusters using the Advanced Camera for Surveys (ACS) on board HST have not found a dichotomy in γ', but instead a systematic progression from central luminosity deficit to excess relative to the inward extrapolation of the best-fitting global Sersic model. Given that earlier studies also found that the dichotomy persisted when analyzing the deprojected density profile slopes, we investigate the distribution of the three-dimensional luminosity density profiles of the ACS Virgo and Fornax Cluster Survey galaxies. Having fitted the surface brightness profiles with modified Sersic models, we then deproject the galaxies using an Abel integral and measure the inner slopes γ 3D of the resulting luminosity density profiles at various fractions of the effective radius R e . We find no evidence of a dichotomy, but rather, a continuous variation in the central luminosity profiles as a function of galaxy magnitude. We introduce a parameter, Δ 3D , that measures the central deviation of the deprojected luminosity profiles from the global Sersic fit, showing that this parameter varies smoothly and systematically along the luminosity function.

  3. Tidal origin of NGC 1427A in the Fornax cluster

    Science.gov (United States)

    Lee-Waddell, K.; Serra, P.; Koribalski, B.; Venhola, A.; Iodice, E.; Catinella, B.; Cortese, L.; Peletier, R.; Popping, A.; Keenan, O.; Capaccioli, M.

    2018-02-01

    We present new HI observations from the Australia Telescope Compact Array and deep optical imaging from OmegaCam on the VLT Survey Telescope of NGC 1427A, an arrow-shaped dwarf irregular galaxy located in the Fornax cluster. The data reveal a star-less HI tail that contains ˜10 per cent of the atomic gas of NGC 1427A as well as extended stellar emission that shed new light on the recent history of this galaxy. Rather than being the result of ram pressure induced star formation, as previously suggested in the literature, the disturbed optical appearance of NGC 1427A has tidal origins. The galaxy itself likely consists of two individual objects in an advanced stage of merging. The HI tail may be made of gas expelled to large radii during the same tidal interaction. It is possible that some of this gas is subject to ram pressure, which would be considered a secondary effect and implies a north-west trajectory of NGC 1427A within the Fornax cluster.

  4. The Next Generation Fornax Survey (NGFS). IV. Mass and Age Bimodality of Nuclear Clusters in the Fornax Core Region

    Science.gov (United States)

    Ordenes-Briceño, Yasna; Puzia, Thomas H.; Eigenthaler, Paul; Taylor, Matthew A.; Muñoz, Roberto P.; Zhang, Hongxin; Alamo-Martínez, Karla; Ribbeck, Karen X.; Grebel, Eva K.; Ángel, Simón; Côté, Patrick; Ferrarese, Laura; Hilker, Michael; Lançon, Ariane; Mieske, Steffen; Miller, Bryan W.; Rong, Yu; Sánchez-Janssen, Ruben

    2018-06-01

    We present the analysis of 61 nucleated dwarf galaxies in the central regions (≲R vir/4) of the Fornax galaxy cluster. The galaxies and their nuclei are studied as part of the Next Generation Fornax Survey using optical imaging obtained with the Dark Energy Camera mounted at Blanco/Cerro Tololo Inter-American Observatory and near-infrared data obtained with VIRCam at VISTA/ESO. We decompose the nucleated dwarfs in nucleus and spheroid, after subtracting the surface brightness profile of the spheroid component and studying the nucleus using point source photometry. In general, nuclei are consistent with colors of confirmed metal-poor globular clusters, but with significantly smaller dispersion than other confirmed compact stellar systems in Fornax. We find a bimodal nucleus mass distribution with peaks located at {log}({{ \\mathcal M }}* /{M}ȯ )≃ 5.4 and ∼6.3. These two nucleus subpopulations have different stellar population properties: the more massive nuclei are older than ∼2 Gyr and have metal-poor stellar populations (Z ≤ 0.02 Z ⊙), while the less massive nuclei are younger than ∼2 Gyr with metallicities in the range 0.02 < Z/Z ⊙ ≤ 1. We find that the nucleus mass ({{ \\mathcal M }}nuc}) versus galaxy mass ({{ \\mathcal M }}gal}) relation becomes shallower for less massive galaxies starting around 108 M ⊙, and the mass ratio {η }n={{ \\mathcal M }}nuc}/{{ \\mathcal M }}gal} shows a clear anticorrelation with {{ \\mathcal M }}gal} for the lowest masses, reaching 10%. We test current theoretical models of nuclear cluster formation and find that they cannot fully reproduce the observed trends. A likely mixture of in situ star formation and star cluster mergers seems to be acting during nucleus growth over cosmic time.

  5. VLT/UVES spectroscopy of individual stars in three globular clusters in the Fornax dwarf spheroidal galaxy

    NARCIS (Netherlands)

    Letarte, B; Hill, [No Value; Jablonka, P; Tolstoy, E; Francois, P; Meylan, G

    We present a high resolution ( R similar to 43 000) abundance analysis of a total of nine stars in three of the five globular clusters associated with the nearby Fornax dwarf spheroidal galaxy. These three clusters ( 1, 2 and 3) trace the oldest, most metal-poor stellar populations in Fornax. We

  6. Cannibal Stars Cause Giant Explosions in Fornax Cluster Galaxy

    Science.gov (United States)

    2000-07-01

    been necessary to detect a few distant novae [3]. VLT observations of NGC 1316 in the Fornax Cluster ESO PR Photo 18a/00 ESO PR Photo 18a/00 [Preview - JPEG: 400 x 448 pix - 28k] [Normal - JPEG: 800 x 895 pix - 136k] [Full-Res - JPEG: 1941 x 2172 pix - 904k] Caption : Colour composite photo of the central area of NGC 1316 , a giant elliptical galaxy in the Fornax cluster of galaxies. Many dark dust clouds and lanes are visible. Some of the star-like objects in the field are globular clusters of stars that belong to the galaxy. It is based on CCD exposures, obtained with the 8.2-m VLT/ANTU telescope and the FORS-1 multi-mode instrument through B (blue), V (green-yellow) and I (here rendered as red) filters, respectively. The "pyramids" above and below the bright centre of the galaxy and the vertical lines at some of the brighter stars are caused by overexposure ("CCD bleeding"). The field measures 6.8 x 6.8 arcmin 2 , with 0.2 arcsec/pixel. The image quality of this composite is about 0.9 arcsec. North is up and East is left. NGC 1316 is a giant "dusty" galaxy ( PR Photo 18a/00 ), located in the Fornax cluster seen in the southern constellation of that name ("The Oven"). This galaxy is of special interest in connection with current attempts to establish an accurate distance scale in the Universe. In 1980 and 1981, NGC 1316 was the host of two supernovae of type Ia , a class of object that is widely used as a "cosmological standard candle" to determine the distance to very distant galaxies, cf. ESO PR 21/98. A precise measurement of the distance to NGC 1316 may therefore provide an independent calibration of the intrinsic brightness of these supernovae. The new observations were performed during 8 nights distributed over the period from January 9 to 19, 2000. They were made in service mode at the 8.2-m VLT/ANTU telescope with the FORS-1 multi-mode instrument, using a 2k x 2k CCD camera with 0.2 arcsec pixels and a field of 6.8 x 6.8 arcmin 2. The exposures lasted 20 min

  7. VLT/UVES abundances of individual stars in the Fornax dwarf spheroidal globular clusters

    NARCIS (Netherlands)

    Letarte, B.; Hill, V.; Jablonka, P.; Tolstoy, E.; Randich, S; Pasquini, L

    2006-01-01

    We present high resolution abundance analysis of nine stars belonging to three of the five globular clusters (GCs) of the Fornax dwarf galaxy. The spectra were taken with UVES at a resolution of 43 000. We find them to be slightly more metal-poor than what was previously calculated with other

  8. Two transitional type Ia supernovae located in the Fornax cluster member NGC 1404

    DEFF Research Database (Denmark)

    Gall, C.; Stritzinger, M. D.; Ashall, C.

    2018-01-01

    We present an analysis of ultraviolet (UV) to near-infrared observations of the fast-declining Type Ia supernovae (SNe Ia) 2007on and 2011iv, hosted by the Fornax cluster member NGC 1404. The B-band light curves of SN 2007on and SN 2011iv are characterised by Delta m(15)(B) decline-rate values of...

  9. Optical identifications of IRAS point sources: the Fornax, Hydra I and Coma clusters

    International Nuclear Information System (INIS)

    Wang, G.; Leggett, S.K.; Savage, A.

    1991-01-01

    We present optical identifications for 66 IRAS point sources in the region of the Fornax cluster of galaxies, 106 IRAS point sources in the region of the Hydra I cluster of galaxies (Abell 1060) and 59 IRAS point sources in the region of the Coma cluster of galaxies (Abell 1656). Eight other sources in Hydra I do not have optical counterparts and are very probably due to infrared cirrus. Twenty-three (35 per cent) of the Fornax sources are associated with stars and 43 (65 per cent) with galaxies; 48 (42 per cent) of the Hydra I sources are associated with stars and 58 (51 per cent) with galaxies; 18 (31 per cent) of the Coma sources are associated with stars and 41 (69 per cent) with galaxies. The stellar and infrared cirrus surface density is consistent with the galactic latitude of each field. (author)

  10. Bright galaxies in the Fornax cluster. Automated galaxy surface photometry: Pt. 7

    International Nuclear Information System (INIS)

    Disney, M.J.; Phillipps, S.; Davies, J.L.; Cawson, M.G.M.; Kibblewhite, E.J.

    1990-01-01

    We have determined surface-brightness profiles for all galaxies down to magnitude B = 16 in the central region of the Fornax cluster. Using existing redshift data, we have determined the distributions of surface brightness for both the whole sample and for cluster disc galaxies only. Although both distributions peak at extrapolated central surface brightness ∼ 21.7B mag/arcsec 2 (the canonical result), it is shown that they are, in fact, consistent with very broad distributions of disc central surface brightness once selection effects and the effects of bulge contamination of the profile are taken into account. (author)

  11. The HST Key Project on the Extragalactic Distance Scale. XV. A Cepheid Distance to the Fornax Cluster and Its Implications

    OpenAIRE

    Madore, Barry F.; Freedman, Wendy L.; Silbermann, N.; Harding, Paul; Huchra, John; Mould, Jeremy; Graham, John; Ferrarese, Laura; Gibson, Brad; Han, Mingsheng; Hoessel, John; Hughes, Shaun; Illingworth, Garth; Phelps, Randy; Sakai, Shoko

    1998-01-01

    Using the Hubble Space Telescope (HST) 37 long-period Cepheid variables have been discovered in the Fornax Cluster spiral galaxy NGC 1365. The resulting V and I period-luminosity relations yield a true distance modulus of 31.35 +/- 0.07 mag, which corresponds to a distance of 18.6 +/- 0.6 Mpc. This measurement provides several routes for estimating the Hubble Constant. (1) Assuming this distance for the Fornax Cluster as a whole yields a local Hubble Constant of 70 +/-18_{random} [+/-7]_{syst...

  12. FCC046: A CANDIDATE GASEOUS POLAR RING DWARF ELLIPTICAL GALAXY IN THE FORNAX CLUSTER

    Energy Technology Data Exchange (ETDEWEB)

    De Rijcke, S.; Buyle, P.; Koleva, M. [Department of Physics and Astronomy, Ghent University, Krijgslaan 281 S9, B-9000 Ghent (Belgium)

    2013-06-20

    FCC046 is a Fornax Cluster dwarf elliptical galaxy. Optical observations have shown that this galaxy, besides an old and metal-poor stellar population, also contains a very young centrally concentrated population and is actively forming stars, albeit at a very low level. Here, we report on 21 cm observations of FCC046 with the Australia Telescope Compact Array which we conducted in the course of a small survey of Fornax Cluster early-type dwarf galaxies. We have discovered a {approx}10{sup 7} M{sub Sun} H I cloud surrounding FCC046. We show that the presence of this significant gas reservoir offers a concise explanation for this galaxy's optical morphological and kinematical properties. Surprisingly, the H I gas, as evidenced by its morphology and its rotational motion around the galaxy's optical major axis, is kinematically decoupled from the galaxy's stellar body. This is the first time such a ring of gaseous material in minor-axis rotation is discovered around a dwarf galaxy.

  13. Low surface brightness galaxies in the Fornax Cluster: automated galaxy surface photometry

    International Nuclear Information System (INIS)

    Davies, J.I.; Phillipps, S.; Disney, M.J.

    1988-01-01

    A sample is presented of low surface brightness galaxies (with extrapolated central surface brightness fainter than 22.0 Bμ) in the Fornax Cluster region which has been measured by the APM machine. Photometric parameters, namely profile shape, scale length, central brightness and total magnitude, are derived for the sample galaxies and correlations between the parameters of low surface brightness dwarf galaxies are discussed, with particular reference to the selection limits. Contrary to previous authors we find no evidence for a luminosity-surface brightness correlation in the sense of lower surface brightness galaxies having lower luminosities and scale sizes. In fact, the present data suggest that it is the galaxies with the largest scale lengths which are more likely to be of very low surface brightness. In addition, the larger scale length galaxies occur preferentially towards the centre of the Cluster. (author)

  14. The Fornax Cluster VLT Spectroscopic Survey II - Planetary Nebulae kinematics within 200 kpc of the cluster core

    Science.gov (United States)

    Spiniello, C.; Napolitano, N. R.; Arnaboldi, M.; Tortora, C.; Coccato, L.; Capaccioli, M.; Gerhard, O.; Iodice, E.; Spavone, M.; Cantiello, M.; Peletier, R.; Paolillo, M.; Schipani, P.

    2018-06-01

    We present the largest and most spatially extended planetary nebulae (PNe) catalogue ever obtained for the Fornax cluster. We measured velocities of 1452 PNe out to 200 kpc in the cluster core using a counter-dispersed slitless spectroscopic technique with data from FORS2 on the Very Large Telescope (VLT). With such an extended spatial coverage, we can study separately the stellar haloes of some of the cluster main galaxies and the intracluster light. In this second paper of the Fornax Cluster VLT Spectroscopic Survey, we identify and classify the emission-line sources, describe the method to select PNe, and calculate their coordinates and velocities from the dispersed slitless images. From the PN 2D velocity map, we identify stellar streams that are possibly tracing the gravitational interaction of NGC 1399 with NGC 1404 and NGC 1387. We also present the velocity dispersion profile out to ˜200 kpc radii, which shows signatures of a superposition of the bright central galaxy and the cluster potential, with the latter clearly dominating the regions outside R ˜ 1000 arcsec (˜100 kpc).

  15. B and R CCD surface photometry of selected low surface brightness galaxies in the region of the Fornax cluster

    International Nuclear Information System (INIS)

    Davies, J.I.; Phillipps, S.; Disney, M.J.

    1990-01-01

    The recent discoveries of large numbers of low surface brightness (LSB) galaxies in clusters and of the extreme LSB giant galaxy Malin 1 are changing our view of the galactic contents of the Universe. In this paper we describe B and R band CCD photometry of a sample of LSB galaxies previously identified from photographic plates of the Fornax cluster. This sample contains some of the lowest surface brightness galaxies known, one having the same central surface brightness as Main 1. The objects in this sample have a wide range of morphologies, and galaxies of similar appearance may have very different (B-R) colours. The range of (B-R) colours for this sample (almost all of which would have been described as dE from their B band morphology alone) is as large as that of the entire Hubble sequence. (author)

  16. A Starburst in the Core of a Galaxy Cluster: the Dwarf Irregular NGC 1427A in Fornax

    Science.gov (United States)

    Mora, Marcelo D.; Chanamé, Julio; Puzia, Thomas H.

    2015-09-01

    Gas-rich galaxies in dense environments such as galaxy clusters and massive groups are affected by a number of possible types of interactions with the cluster environment, which make their evolution radically different than that of field galaxies. The dwarf irregular galaxy NGC 1427A, presently infalling toward the core of the Fornax galaxy cluster for the first time, offers a unique opportunity to study those processes at a level of detail not possible to achieve for galaxies at higher redshifts, when galaxy-scale interactions were more common. Using the spatial resolution of the Hubble Space Telescope/Advanced Camera for Surveys and auxiliary Very Large Telescope/FORS1 ground-based observations, we study the properties of the most recent episodes of star formation in this gas-rich galaxy, the only one of its type near the core of the Fornax cluster. We study the structural and photometric properties of young star cluster complexes in NGC 1427A, identifying 12 bright such complexes with exceptionally blue colors. The comparison of our broadband near-UV/optical photometry with simple stellar population models yields ages below ˜ 4× {10}6 years and stellar masses from a few 1000 up to ˜ 3× {10}4{M}⊙ , slightly dependent on the assumption of cluster metallicity and initial mass function. Their grouping is consistent with hierarchical and fractal star cluster formation. We use deep Hα imaging data to determine the current star formation rate in NGC 1427A and estimate the ratio, Γ, of star formation occurring in these star cluster complexes to that in the entire galaxy. We find Γ to be among the largest such values available in the literature, consistent with starburst galaxies. Thus a large fraction of the current star formation in NGC 1427A is occurring in star clusters, with the peculiar spatial arrangement of such complexes strongly hinting at the possibility that the starburst is being triggered by the passage of the galaxy through the cluster environment

  17. THE CONVERSION OF LATE-TYPE INTO EARLY-TYPE DWARF GALAXIES BY RAM-PRESSURE STRIPPING IN THE FORNAX CLUSTER

    International Nuclear Information System (INIS)

    De Rijcke, S.; Van Hese, E.; Buyle, P.

    2010-01-01

    We put to the test the hypothesis that the Fornax cluster dwarf galaxies are mostly a relatively recently acquired population, of which the star-forming, late-type members are converted into quiescent, early-type ones by ram-pressure stripping while being on orbits that plunge inside the inner few hundred kiloparsecs of the cluster. We construct dynamical models with different anisotropy profiles for the dwarf galaxy population and show that only extremely radially anisotropic orbital distributions are in agreement with the available morphological, positional, and kinematical data, especially with the radially increasing late-to-early-type ratio. This corroborates the idea that the Fornax cluster dwarfs are an infall population and that environmental factors, in this case ram-pressure stripping, play a prominent role in converting late-type dwarfs into early-type ones.

  18. Bioinformatics and Astrophysics Cluster (BinAc)

    Science.gov (United States)

    Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

    2017-09-01

    BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

  19. SEARCH FOR DARK MATTER ANNIHILATION SIGNALS FROM THE FORNAX GALAXY CLUSTER WITH H.E.S.S

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D 22761 Hamburg (Germany); Acero, F. [Laboratoire de Physique Theorique et Astroparticules, Universite Montpellier 2, CNRS/IN2P3, CC 70, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D 69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Yerevan (Armenia); Anton, G.; Balzer, A.; Brucker, J. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D 91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Barres de Almeida, U. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Becherini, Y. [Astroparticule et Cosmologie (APC), CNRS, Universite Paris 7 Denis Diderot, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D 44780 Bochum (Germany); Behera, B. [Landessternwarte, Universitaet Heidelberg, Koenigstuhl, D 69117 Heidelberg (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D 12489 Berlin (Germany); Biteau, J.; Brun, F. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, 92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P., E-mail: bjoern.opitz@desy.de [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D 72076 Tuebingen (Germany); Collaboration: H.E.S.S. Collaboration; and others

    2012-05-10

    The Fornax galaxy cluster was observed with the High Energy Stereoscopic System for a total live time of 14.5 hr, searching for very high energy (VHE; E > 100GeV) {gamma}-rays from dark matter (DM) annihilation. No significant signal was found in searches for point-like and extended emissions. Using several models of the DM density distribution, upper limits on the DM velocity-weighted annihilation cross-section ({sigma}v) as a function of the DM particle mass are derived. Constraints are derived for different DM particle models, such as those arising from Kaluza-Klein and supersymmetric models. Various annihilation final states are considered. Possible enhancements of the DM annihilation {gamma}-ray flux, due to DM substructures of the DM host halo, or from the Sommerfeld effect, are studied. Additional {gamma}-ray contributions from internal bremsstrahlung and inverse Compton radiation are also discussed. For a DM particle mass of 1 TeV, the exclusion limits at 95% of confidence level reach values of ({sigma}v){sup 95%C.L.} {approx} 10{sup -23} cm{sup 3} s{sup -1}, depending on the DM particle model and halo properties. Additional contribution from DM substructures can improve the upper limits on ({sigma}v) by more than two orders of magnitude. At masses around 4.5 TeV, the enhancement by substructures and the Sommerfeld resonance effect results in a velocity-weighted annihilation cross-section upper limit at the level of ({sigma}v){sup 95%C.L.} {approx}10{sup -26} cm{sup 3} s{sup -1}.

  20. SEARCH FOR DARK MATTER ANNIHILATION SIGNALS FROM THE FORNAX GALAXY CLUSTER WITH H.E.S.S

    International Nuclear Information System (INIS)

    Abramowski, A.; Acero, F.; Aharonian, F.; Bernlöhr, K.; Bochow, A.; Akhperjanian, A. G.; Anton, G.; Balzer, A.; Brucker, J.; Barnacka, A.; Barres de Almeida, U.; Becherini, Y.; Becker, J.; Behera, B.; Birsin, E.; Biteau, J.; Brun, F.; Boisson, C.; Bolmont, J.; Bordas, P.

    2012-01-01

    The Fornax galaxy cluster was observed with the High Energy Stereoscopic System for a total live time of 14.5 hr, searching for very high energy (VHE; E > 100GeV) γ-rays from dark matter (DM) annihilation. No significant signal was found in searches for point-like and extended emissions. Using several models of the DM density distribution, upper limits on the DM velocity-weighted annihilation cross-section (σv) as a function of the DM particle mass are derived. Constraints are derived for different DM particle models, such as those arising from Kaluza-Klein and supersymmetric models. Various annihilation final states are considered. Possible enhancements of the DM annihilation γ-ray flux, due to DM substructures of the DM host halo, or from the Sommerfeld effect, are studied. Additional γ-ray contributions from internal bremsstrahlung and inverse Compton radiation are also discussed. For a DM particle mass of 1 TeV, the exclusion limits at 95% of confidence level reach values of (σv) 95%C.L. ∼ 10 –23 cm 3 s –1 , depending on the DM particle model and halo properties. Additional contribution from DM substructures can improve the upper limits on (σv) by more than two orders of magnitude. At masses around 4.5 TeV, the enhancement by substructures and the Sommerfeld resonance effect results in a velocity-weighted annihilation cross-section upper limit at the level of (σv) 95%C.L. ∼10 –26 cm 3 s –1 .

  1. Two transitional type Ia supernovae located in the Fornax cluster member NGC 1404: SN 2007on and SN 2011iv

    Science.gov (United States)

    Gall, C.; Stritzinger, M. D.; Ashall, C.; Baron, E.; Burns, C. R.; Hoeflich, P.; Hsiao, E. Y.; Mazzali, P. A.; Phillips, M. M.; Filippenko, A. V.; Anderson, J. P.; Benetti, S.; Brown, P. J.; Campillay, A.; Challis, P.; Contreras, C.; Elias de la Rosa, N.; Folatelli, G.; Foley, R. J.; Fraser, M.; Holmbo, S.; Marion, G. H.; Morrell, N.; Pan, Y.-C.; Pignata, G.; Suntzeff, N. B.; Taddia, F.; Robledo, S. Torres; Valenti, S.

    2018-03-01

    We present an analysis of ultraviolet (UV) to near-infrared observations of the fast-declining Type Ia supernovae (SNe Ia) 2007on and 2011iv, hosted by the Fornax cluster member NGC 1404. The B-band light curves of SN 2007on and SN 2011iv are characterised by Δm15 (B) decline-rate values of 1.96 mag and 1.77 mag, respectively. Although they have similar decline rates, their peak B- and H-band magnitudes differ by 0.60 mag and 0.35 mag, respectively. After correcting for the luminosity vs. decline rate and the luminosity vs. colour relations, the peak B-band and H-band light curves provide distances that differ by 14% and 9%, respectively. These findings serve as a cautionary tale for the use of transitional SNe Ia located in early-type hosts in the quest to measure cosmological parameters. Interestingly, even though SN 2011iv is brighter and bluer at early times, by three weeks past maximum and extending over several months, its B - V colour is 0.12 mag redder than that of SN 2007on. To reconcile this unusual behaviour, we turn to guidance from a suite of spherical one-dimensional Chandrasekhar-mass delayed-detonation explosion models. In this context, 56Ni production depends on both the so-called transition density and the central density of the progenitor white dwarf. To first order, the transition density drives the luminosity-width relation, while the central density is an important second-order parameter. Within this context, the differences in the B - V colour evolution along the Lira regime suggest that the progenitor of SN 2011iv had a higher central density than SN 2007on. The photometry tables are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/611/A58

  2. Searches for dark matter self-annihilation signals from dwarf spheroidal galaxies and the Fornax galaxy cluster with imaging air Cherenkov telescopes

    International Nuclear Information System (INIS)

    Opitz, Bjoern Helmut Bastian

    2014-06-01

    Many astronomical observations indicate that dark matter pervades the universe and dominates the formation and dynamics of cosmic structures. Weakly interacting massive particles (WIMPs) with masses in the GeV to TeV range form a popular class of dark matter candidates. WIMP self-annihilation may lead to the production of γ-rays in the very high energy regime above 100 GeV, which is observable with imaging air Cherenkov telescopes (IACTs). For this thesis, observations of dwarf spheroidal galaxies (dSph) and the Fornax galaxy cluster with the Cherenkov telescope systems H.E.S.S., MAGIC and VERITAS were used to search for γ-ray signals of dark matter annihilations. The work consists of two parts: First, a likelihood-based statistical technique was introduced to combine published results of dSph observations with the different IACTs. The technique also accounts for uncertainties on the ''J factors'', which quantify the dark matter content of the dwarf galaxies. Secondly, H.E.S.S. observations of the Fornax cluster were analyzed. In this case, a collection of dark matter halo models was used for the J factor computation. In addition, possible signal enhancements from halo substructures were considered. None of the searches yielded a significant γ-ray signal. Therefore, the results were used to place upper limits on the thermally averaged dark matter self-annihilation cross-section left angle σν right angle. Different models for the final state of the annihilation process were considered. The cross-section limits range from left angle σν right angle UL ∝10 -19 cm 3 s -1 to left angle σν right angle UL ∝10 -25 cm 3 s -1 for dark matter particles masses between 100 GeV and 100 TeV. Some of the diverse model uncertainties causing this wide range of left angle σν right angle UL values were analyzed.

  3. Measuring Gravitational Flexion in ACS Clusters

    Science.gov (United States)

    Goldberg, David

    2005-07-01

    We propose measurement of the gravitational "Flexion" signal in ACS cluster images. The flexion, or "arciness" of a lensed background galaxy arises from variations in the lensing field. As a result, it is extremely sensitive to small scale perturbations in the field, and thus, to substructure in clusters. Moreover, because flexion represents gravitationally induced asymmetries in the lensed image, it is completely separable from traditional measurements of shear, which focus on the induced ellipticity of the image, and thus, the two signals may be extracted simultaneously. Since typical galaxies are roughly symmetric upon 180 degree rotation, even a small induced flexion can potentially produce a noticeable effect {Goldberg & Bacon, 2005}. We propose the measurement of substructure within approximately 4 clusters with high-quality ACS data, and will further apply a test of a new tomographic technique whereby comparisons of lensed arcs at different redshifts may be used to estimate the background cosmology, and thus place constraints on the equation of state of dark energy.

  4. CCD photometry of apparent dwarf galaxies in Fornax

    International Nuclear Information System (INIS)

    Phillipps, S.; Grimley, P.L.; Disney, M.J.; Cawson, M.G.M.; Kibblewhite, E.J.

    1986-01-01

    Blue and red CCD surface photometry of two apparent dwarf galaxies in the Fornax cluster region is presented. Luminosity profiles are derived and their form discussed. The fainter galaxy resembles an archetypal diffuse dwarf elliptical but the brighter of the pair is either an unusual red dwarf or a background galaxy in chance juxtaposition. (author)

  5. Two Cepheid variables in the Fornax dwarf galaxy

    Science.gov (United States)

    Light, R. M.; Armandroff, T. E.; Zinn, R.

    1986-01-01

    Two fields surrounding globular clusters 2 and 3 in the Fornax dwarf spheroidal galaxy have been searched for short-period variable stars that are brighter than the horizontal branch. This survey confirmed as variable the two suspected suprahorizontal-branch variables discovered by Buonanno et al. (1985) in their photometry of the clusters. The observations show that the star in cluster 2 is a W Virginis variable of 14.4 day period. It is the first W Vir variable to be found in a dwarf spheroidal galaxy, and its proximity to the center of cluster 2 suggests that it is a cluster member. The other star appears to be an anomalous Cephpeid of 0.78 day period. It lies outside or very near the boundary of cluster 3, and is therefore probably a member of the field population of Fornax. Although no other suprahorizontal-branch variables were discovered in the survey, it did confirm as variable two of the RR Lyrae candidates of Buonanno et al., which appeared at the survey limit. The implications of these observations for the understanding of the stellar content at Fornax are discussed.

  6. The HST/ACS Coma Cluster Survey : II. Data Description and Source Catalogs

    NARCIS (Netherlands)

    Hammer, Derek; Kleijn, Gijs Verdoes; Hoyos, Carlos; den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Peletier, Reynier F.; Smith, Russell J.; Graham, Alister W.; Trentham, Neil; Peng, Eric; Puzia, Thomas H.; Lucey, John R.; Jogee, Shardha; Aguerri, Alfonso L.; Batcheldor, Dan; Bridges, Terry J.; Chiboucas, Kristin; Davies, Jonathan I.; del Burgo, Carlos; Erwin, Peter; Hornschemeier, Ann; Hudson, Michael J.; Huxor, Avon; Jenkins, Leigh; Karick, Arna; Khosroshahi, Habib; Kourkchi, Ehsan; Komiyama, Yutaka; Lotz, Jennifer; Marzke, Ronald O.; Marinova, Irina; Matkovic, Ana; Merritt, David; Miller, Bryan W.; Miller, Neal A.; Mobasher, Bahram; Mouhcine, Mustapha; Okamura, Sadanori; Percival, Sue; Phillipps, Steven; Poggianti, Bianca M.; Price, James; Sharples, Ray M.; Tully, R. Brent; Valentijn, Edwin

    The Coma cluster, Abell 1656, was the target of an HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially completed survey still covers ~50% of the core high-density region in

  7. Ac hopping conduction at extreme disorder takes place on the percolating cluster

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, J. C.

    2008-01-01

    Simulations of the random barrier model show that ac currents at extreme disorder are carried almost entirely by the percolating cluster slightly above threshold; thus contributions from isolated low activation-energy clusters are negligible. The effective medium approximation in conjunction...

  8. VizieR Online Data Catalog: HST/ACS Coma Cluster Survey. VI. (den Brok+, 2011)

    Science.gov (United States)

    den Brok, M.; Peletier, R. F.; Valentijn, E. A.; Balcells, M.; Carter, D.; Erwin, P.; Ferguson, H. C.; Goudfrooij, P.; Graham, A. W.; Hammer, D.; Lucey, J. R.; Trentham, N.; Guzman, R.; Hoyos, C.; Verdoes Kleijn, G.; Jogee, S.; Karick, A. M.; Marinova, I.; Mouhcine, M.; Weinzirl, T.

    2018-01-01

    We have used the data from the HST/ACS Coma Cluster Survey, a deep two-passband imaging survey of the Coma cluster. A full description of the observations and data reduction can be found in Paper I (Carter et al., 2008ApJS..176..424C). We have derived colour gradients for a sample of confirmed or very likely Coma cluster members. (2 data files).

  9. Chemical analysis of the Fornax Dwarf galaxy

    NARCIS (Netherlands)

    Letarte, Bruno

    2007-01-01

    This thesis is entitled “Chemical Analysis of the Fornax Dwarf Galaxy”, and it’s main goal is to determine what are the chemical elements present in the stars of this galaxy in order to try and understand it’s evolution. Galaxies are not “static” objects, they move, form stars and can interact with

  10. Probable alpha and 14C cluster emission from hyper Ac nuclei

    International Nuclear Information System (INIS)

    Santhosh, K.P.

    2013-01-01

    A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)

  11. VizieR Online Data Catalog: HST/ACS Coma cluster survey. II. (Hammer+, 2010)

    NARCIS (Netherlands)

    Hammer, D.; Verdoes Kleijn, G.; Hoyos, C.; den Brok, M.; Balcells, M.; Ferguson, H. C.; Goudfrooij, P.; Carter, D.; Guzman, R.; Peletier, R. F.; Smith, R. J.; Graham, A. W.; Trentham, N.; Peng, E.; Puzia, T. H.; Lucey, J. R.; Jogee, S.; Aguerri, A. L.; Batcheldor, D.; Bridges, T. J.; Chiboucas, K.; Davies, J. I.; Del Burgo, C.; Erwin, P.; Hornschemeier, A.; Hudson, M. J.; Huxor, A.; Jenkins, L.; Karick, A.; Khosroshahi, H.; Kourkchi, E.; Komiyama, Y.; Lotz, J.; Marzke, R. O.; Marinova, I.; Matkovic, A.; Merritt, D.; Miller, B. W.; Miller, N. A.; Mobasher, B.; Mouhcine, M.; Okamura, S.; Percival, S.; Phillipps, S.; Poggianti, B. M.; Price, J.; Sharples, R. M.; Tully, R. B.; Valentijn, E.

    2010-01-01

    This data release contains catalogs for the ACS Images in F475W and F814W bands of 25 fields in the Coma cluster of galaxies. Each field is about 202x202arcsec. Please see the release notes for further details. (25 data files).

  12. AGE DETERMINATION OF SIX INTERMEDIATE-AGE SMALL MAGELLANIC CLOUD STAR CLUSTERS WITH HST/ACS

    International Nuclear Information System (INIS)

    Glatt, Katharina; Kayser, Andrea; Grebel, Eva K.; Sabbi, Elena; Gallagher, John S. III; Harbeck, Daniel; Nota, Antonella; Sirianni, Marco; Clementini, Gisella; Tosi, Monica; Koch, Andreas; Da Costa, Gary

    2008-01-01

    We present a photometric analysis of the star clusters Lindsay 1, Kron 3, NGC 339, NGC 416, Lindsay 38, and NGC 419 in the Small Magellanic Cloud (SMC), observed with the Hubble Space Telescope Advanced Camera for Surveys (ACS) in the F555W and F814W filters. Our color-magnitude diagrams (CMDs) extend ∼3.5 mag deeper than the main-sequence turnoff points, deeper than any previous data. Cluster ages were derived using three different isochrone models: Padova, Teramo, and Dartmouth, which are all available in the ACS photometric system. Fitting observed ridgelines for each cluster, we provide a homogeneous and unique set of low-metallicity, single-age fiducial isochrones. The cluster CMDs are best approximated by the Dartmouth isochrones for all clusters, except for NGC 419 where the Padova isochrones provided the best fit. Using Dartmouth isochrones we derive ages of 7.5 ± 0.5 Gyr (Lindsay 1), 6.5 ± 0.5 Gyr (Kron 3), 6 ± 0.5 Gyr (NGC 339), 6 ± 0.5 Gyr (NGC 416), and 6.5 ± 0.5 Gyr (Lindsay 38). The CMD of NGC 419 shows several main-sequence turnoffs, which belong to the cluster and to the SMC field. We thus derive an age range of 1.2-1.6 Gyr for NGC 419. We confirm that the SMC contains several intermediate-age populous star clusters with ages unlike those of the Large Magellanic Cloud and the Milky Way. Interestingly, our intermediate-age star clusters have a metallicity spread of ∼0.6 dex, which demonstrates that the SMC does not have a smooth, monotonic age-metallicity relation. We find an indication for centrally-concentrated blue straggler star candidates in NGC 416, while these are not present for the other clusters. Using the red clump magnitudes, we find that the closest cluster, NGC 419 (∼50 kpc), and the farthest cluster, Lindsay 38 (∼67 kpc), have a relative distance of ∼17 kpc, which confirms the large depth of the SMC. The three oldest SMC clusters (NGC 121, Lindsay 1, and Kron 3) lie in the northwestern part of the SMC, while the youngest

  13. THE HST/ACS COMA CLUSTER SURVEY. IV. INTERGALACTIC GLOBULAR CLUSTERS AND THE MASSIVE GLOBULAR CLUSTER SYSTEM AT THE CORE OF THE COMA GALAXY CLUSTER

    International Nuclear Information System (INIS)

    Peng, Eric W.; Ferguson, Henry C.; Goudfrooij, Paul; Hammer, Derek; Lucey, John R.; Marzke, Ronald O.; Puzia, Thomas H.; Carter, David; Balcells, Marc; Bridges, Terry; Chiboucas, Kristin; Del Burgo, Carlos; Graham, Alister W.; Guzman, Rafael; Hudson, Michael J.; Matkovic, Ana

    2011-01-01

    Intracluster stellar populations are a natural result of tidal interactions in galaxy clusters. Measuring these populations is difficult, but important for understanding the assembly of the most massive galaxies. The Coma cluster of galaxies is one of the nearest truly massive galaxy clusters and is host to a correspondingly large system of globular clusters (GCs). We use imaging from the HST/ACS Coma Cluster Survey to present the first definitive detection of a large population of intracluster GCs (IGCs) that fills the Coma cluster core and is not associated with individual galaxies. The GC surface density profile around the central massive elliptical galaxy, NGC 4874, is dominated at large radii by a population of IGCs that extend to the limit of our data (R +4000 -5000 (systematic) IGCs out to this radius, and that they make up ∼70% of the central GC system, making this the largest GC system in the nearby universe. Even including the GC systems of other cluster galaxies, the IGCs still make up ∼30%-45% of the GCs in the cluster core. Observational limits from previous studies of the intracluster light (ICL) suggest that the IGC population has a high specific frequency. If the IGC population has a specific frequency similar to high-S N dwarf galaxies, then the ICL has a mean surface brightness of μ V ∼ 27 mag arcsec -2 and a total stellar mass of roughly 10 12 M sun within the cluster core. The ICL makes up approximately half of the stellar luminosity and one-third of the stellar mass of the central (NGC 4874+ICL) system. The color distribution of the IGC population is bimodal, with blue, metal-poor GCs outnumbering red, metal-rich GCs by a ratio of 4:1. The inner GCs associated with NGC 4874 also have a bimodal distribution in color, but with a redder metal-poor population. The fraction of red IGCs (20%), and the red color of those GCs, implies that IGCs can originate from the halos of relatively massive, L* galaxies, and not solely from the disruption of

  14. The sluggs survey: HST/ACS mosaic imaging of the NGC 3115 globular cluster system

    Energy Technology Data Exchange (ETDEWEB)

    Jennings, Zachary G.; Romanowsky, Aaron J.; Brodie, Jean P.; Arnold, Jacob A. [University of California Observatories, Santa Cruz, CA 95064 (United States); Strader, Jay [Department of Physics and Astronomy, Michigan State University, East Lansing, Michigan, MI 48824 (United States); Lin, Dacheng; Irwin, Jimmy A.; Wong, Ka-Wah [Department of Physics and Astronomy, University of Alabama, Box 870324, Tuscaloosa, AL 35487 (United States); Sivakoff, Gregory R., E-mail: zgjennin@ucsc.edu [Department of Physics, University of Alberta, Edmonton, Alberta T6G 2E1 (Canada)

    2014-08-01

    We present Hubble Space Telescope/Advanced Camera for Surveys (HST/ACS) g and z photometry and half-light radii R {sub h} measurements of 360 globular cluster (GC) candidates around the nearby S0 galaxy NGC 3115. We also include Subaru/Suprime-Cam g, r, and i photometry of 421 additional candidates. The well-established color bimodality of the GC system is obvious in the HST/ACS photometry. We find evidence for a 'blue tilt' in the blue GC subpopulation, wherein the GCs in the blue subpopulation get redder as luminosity increases, indicative of a mass-metallicity relationship. We find a color gradient in both the red and blue subpopulations, with each group of clusters becoming bluer at larger distances from NGC 3115. The gradient is of similar strength in both subpopulations, but is monotonic and more significant for the blue clusters. On average, the blue clusters have ∼10% larger R {sub h} than the red clusters. This average difference is less than is typically observed for early-type galaxies but does match that measured in the literature for the Sombrero Galaxy (M104), suggesting that morphology and inclination may affect the measured size difference between the red and blue clusters. However, the scatter on the R {sub h} measurements is large. We also identify 31 clusters more extended than typical GCs, which we term ultra-compact dwarf (UCD) candidates. Many of these objects are actually considerably fainter than typical UCDs. While it is likely that a significant number will be background contaminants, six of these UCD candidates are spectroscopically confirmed as NGC 3115 members. To explore the prevalence of low-mass X-ray binaries in the GC system, we match our ACS and Suprime-Cam detections to corresponding Chandra X-ray sources. We identify 45 X-ray-GC matches: 16 among the blue subpopulation and 29 among the red subpopulation. These X-ray/GC coincidence fractions are larger than is typical for most GC systems, probably due to the increased

  15. Proper Motions of Dwarf Spheroidal Galaxies from Hubble Space Telescope Imaging. V. Final Measurement for Fornax

    Science.gov (United States)

    Piatek, Slawomir; Pryor, Carlton; Bristow, Paul; Olszewski, Edward W.; Harris, Hugh C.; Mateo, Mario; Minniti, Dante; Tinney, Christopher G.

    2007-03-01

    The measured proper motion of Fornax, expressed in the equatorial coordinate system, is (μα,μδ)=(47.6+/-4.6,-36.0+/-4.1) mas century-1. This proper motion is a weighted mean of four independent measurements for three distinct fields. Each measurement uses a quasi-stellar object as a reference point. Removing the contribution of the motion of the Sun and of the local standard of rest to the measured proper motion produces a Galactic rest-frame proper motion of (μGrfα,μGrfδ)=(24.4+/-4.6,-14.3+/-4.1) mas century-1. The implied space velocity with respect to the Galactic center has a radial component of Vr=-31.8+/-1.7 km s-1 and a tangential component of Vt=196+/-29 km s-1. Integrating the motion of Fornax in a realistic potential for the Milky Way produces orbital elements. The perigalacticon and apogalacticon are 118 (66, 137) and 152 (144, 242) kpc, respectively, where the values in the parentheses represent the 95% confidence intervals derived from Monte Carlo experiments. The eccentricity of the orbit is 0.13 (0.11, 0.38), and the orbital period is 3.2 (2.5, 4.6) Gyr. The orbit is retrograde and inclined by 101° (94°, 107°) to the Galactic plane. Fornax could be a member of a proposed ``stream'' of galaxies and globular clusters; however, the membership of another proposed galaxy in the stream, Sculptor, has been previously ruled out. Fornax is in the Kroupa-Theis-Boily plane, which contains 11 of the Galactic satellite galaxies, but its orbit will take it out of that plane. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26555.

  16. Images From Hubbles's ACS Tell A Tale Of Two Record-Breaking Galaxy Clusters

    Science.gov (United States)

    2004-01-01

    Looking back in time nearly 9 billion years, an international team of astronomers found mature galaxies in a young universe. The galaxies are members of a cluster of galaxies that existed when the universe was only 5 billion years old, or about 35 percent of its present age. This compelling evidence that galaxies must have started forming just after the big bang was bolstered by observations made by the same team of astronomers when they peered even farther back in time. The team found embryonic galaxies a mere 1.5 billion years after the birth of the cosmos, or 10 percent of the universe's present age. The "baby galaxies" reside in a still-developing cluster, the most distant proto-cluster ever found. The Advanced Camera for Surveys (ACS) aboard NASA's Hubble Space Telescope was used to make observations of the massive cluster, RDCS 1252.9-2927, and the proto-cluster, TN J1338-1942. Observations by NASA's Chandra X-ray Observatory yielded the mass and heavy element content of RDCS 1252, the most massive known cluster for that epoch. These observations are part of a coordinated effort by the ACS science team to track the formation and evolution of clusters of galaxies over a broad range of cosmic time. The ACS was built especially for studies of such distant objects. These findings further support observations and theories that galaxies formed relatively early in the history of the cosmos. The existence of such massive clusters in the early universe agrees with a cosmological model wherein clusters form from the merger of many sub-clusters in a universe dominated by cold dark matter. The precise nature of cold dark matter, however, is still not known. The first Hubble study estimated that galaxies in RDCS 1252 formed the bulk of their stars more than 11 billion years ago (at redshifts greater than 3). The results were published in the Oct. 20, 2003 issue of the Astrophysical Journal. The paper's lead author is John Blakeslee of the Johns Hopkins University in

  17. THE HST/ACS COMA CLUSTER SURVEY. II. DATA DESCRIPTION AND SOURCE CATALOGS

    International Nuclear Information System (INIS)

    Hammer, Derek; Verdoes Kleijn, Gijs; Den Brok, Mark; Peletier, Reynier F.; Hoyos, Carlos; Balcells, Marc; Aguerri, Alfonso L.; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Smith, Russell J.; Lucey, John R.; Graham, Alister W.; Trentham, Neil; Peng, Eric; Puzia, Thomas H.; Jogee, Shardha; Batcheldor, Dan; Bridges, Terry J.

    2010-01-01

    The Coma cluster, Abell 1656, was the target of an HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially completed survey still covers ∼50% of the core high-density region in Coma. Observations were performed for 25 fields that extend over a wide range of cluster-centric radii (∼1.75 Mpc or 1 0 ) with a total coverage area of 274 arcmin 2 . The majority of the fields are located near the core region of Coma (19/25 pointings) with six additional fields in the southwest region of the cluster. In this paper, we present reprocessed images and SEXTRACTOR source catalogs for our survey fields, including a detailed description of the methodology used for object detection and photometry, the subtraction of bright galaxies to measure faint underlying objects, and the use of simulations to assess the photometric accuracy and completeness of our catalogs. We also use simulations to perform aperture corrections for the SEXTRACTOR Kron magnitudes based only on the measured source flux and its half-light radius. We have performed photometry for ∼73,000 unique objects; approximately one-half of our detections are brighter than the 10σ point-source detection limit at F814W = 25.8 mag (AB). The slight majority of objects (60%) are unresolved or only marginally resolved by ACS. We estimate that Coma members are 5%-10% of all source detections, which consist of a large population of unresolved compact sources (primarily globular clusters but also ultra-compact dwarf galaxies) and a wide variety of extended galaxies from a cD galaxy to dwarf low surface brightness galaxies. The red sequence of Coma member galaxies has a color-magnitude relation with a constant slope and dispersion over 9 mag (-21 F814W < -13). The initial data release for the HST-ACS Coma Treasury program was made available to the public in 2008 August. The images and catalogs described

  18. The HST/ACS Coma Cluster Survey : VI. Colour gradients in giant and dwarf early-type galaxies

    NARCIS (Netherlands)

    den Brok, M.; Peletier, R. F.; Valentijn, E. A.; Balcells, Marc; Carter, D.; Erwin, P.; Ferguson, H. C.; Goudfrooij, P.; Graham, A. W.; Hammer, D.; Lucey, J. R.; Trentham, N.; Guzman, R.; Hoyos, C.; Kleijn, G. Verdoes; Jogee, S.; Karick, A. M.; Marinova, I.; Mouhcine, M.; Weinzirl, T.

    Using deep, high-spatial-resolution imaging from the Hubble Space Telescope/Advanced Camera for Surveys (HST/ACS) Coma Cluster Treasury Survey, we determine colour profiles of early-type galaxies in the Coma cluster. From 176 galaxies brighter than M-F814W(AB) = -15 mag that are either

  19. The HST/ACS Coma Cluster Survey. II. Data Description and Source Catalogs

    Science.gov (United States)

    Hammer, Derek; Kleijn, Gijs Verdoes; Hoyos, Carlos; Den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Peletier, Reynier F.; hide

    2010-01-01

    The Coma cluster, Abell 1656, was the target of a HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially-completed survey still covers approximately 50% of the core high density region in Coma. Observations were performed for twenty-five fields with a total coverage area of 274 aremin(sup 2), and extend over a wide range of cluster-centric radii (approximately 1.75 Mpe or 1 deg). The majority of the fields are located near the core region of Coma (19/25 pointings) with six additional fields in the south-west region of the cluster. In this paper we present SEXTRACTOR source catalogs generated from the processed images, including a detailed description of the methodology used for object detection and photometry, the subtraction of bright galaxies to measure faint underlying objects, and the use of simulations to assess the photometric accuracy and completeness of our catalogs. We also use simulations to perform aperture corrections for the SEXTRACTOR Kron magnitudes based only on the measured source flux and its half-light radius. We have performed photometry for 76,000 objects that consist of roughly equal numbers of extended galaxies and unresolved objects. Approximately two-thirds of all detections are brighter than F814W=26.5 mag (AB), which corresponds to the 10sigma, point-source detection limit. We estimate that Coma members are 5-10% of the source detections, including a large population of compact objects (primarily GCs, but also cEs and UCDs), and a wide variety of extended galaxies from cD galaxies to dwarf low surface brightness galaxies. The initial data release for the HST-ACS Coma Treasury program was made available to the public in August 2008. The images and catalogs described in this study relate to our second data release.

  20. VLT/FLAMES spectroscopy of red giant branch stars in the Fornax dwarf spheroidal galaxy

    NARCIS (Netherlands)

    Lemasle, B.; de Boer, T.J.L.; Hill, V.; Tolstoy, E.; Irwin, M.J.; Jablonka, P.; Venn, K.; Battaglia, G.; Starkenburg, E.; Shetrone, M.; Letarte, B.; François, P.; Helmi, A.; Primas, F.; Kaufer, A.; Szeifert, T.

    2014-01-01

    Context. Fornax is one of the most massive dwarf spheroidal galaxies in the Local Group. The Fornax field star population is dominated by intermediate age stars but star formation was going on over almost its entire history. It has been proposed that Fornax experienced a minor merger event. Aims.

  1. THE FORNAX DWARF GALAXY AS A REMNANT OF RECENT DWARF-DWARF MERGING IN THE LOCAL GROUP

    International Nuclear Information System (INIS)

    Yozin, C.; Bekki, K.

    2012-01-01

    We present results from the first numerical analysis to support the hypothesis, first proposed in Coleman et al., that the Fornax dwarf galaxy was formed from the minor merging of two dwarfs about 2 Gyr ago. Using orbits for the Fornax dwarf that are consistent with the latest proper motion measurements, our dynamical evolution models show that the observed asymmetric shell-like substructures can be formed from the remnant of a smaller dwarf during minor merging. These models also predict the formation of diffuse stellar streams. We discuss how these stellar substructures depend on model parameters of dwarf-dwarf merging, and how the intermediate-age subpopulations found in the vicinity of these substructures may be formed from gas accretion in past merger events. We also suggest that one of Fornax's globular clusters originates from a merged dwarf companion, and demonstrate where as yet undetected tidal streams or H I gas formed from the dwarf merging may be found in the outer halo of the Galaxy.

  2. The surface brightness of 1550 galaxies in Fornax: automated galaxy surface photometry: Pt. 2

    International Nuclear Information System (INIS)

    Phillipps, S.; Disney, M.J.; Kibblewhite, E.J.; Cawson, M.G.M.

    1987-01-01

    A survey of a complete sample of galaxies in the region of the Fornax cluster is presented. Measurements with the Automatic Plate Measuring machine are used to derive the observed distribution of galaxy surface brightness for 1550 objects. Corrections for surface brightness dependent selection effects are then made in order to estimate the true distribution. It is found that the sample (with 16.6 ≤ Msub(APM) ≤ 19.1) is divided into two distinct populations. The 'normal' galaxies with extrapolated central surface brightness Ssub(x) ≤ 22.5 Bμ form a uniformly distributed background of field galaxies. Low surface brightness galaxies (Ssub(x) ≥ 22.5 Bμ), on the other hand, are strongly clumped about the cluster centre. There appear to be few low surface brightness field galaxies. (author)

  3. THE ACS SURVEY OF GALACTIC GLOBULAR CLUSTERS. IX. HORIZONTAL BRANCH MORPHOLOGY AND THE SECOND PARAMETER PHENOMENON

    International Nuclear Information System (INIS)

    Dotter, Aaron; Sarajedini, Ata; Anderson, Jay; Bedin, Luigi R.; Paust, Nathaniel; Reid, I. Neill; Aparicio, Antonio; MarIn-Franch, A.; Rosenberg, Alfred; Chaboyer, Brian; Majewski, Steven; Milone, Antonino; Piotto, Giampaolo; Siegel, Michael

    2010-01-01

    The horizontal branch (HB) morphology of globular clusters (GCs) is most strongly influenced by metallicity. The second parameter phenomenon, first described in the 1960s, acknowledges that metallicity alone is not enough to describe the HB morphology of all GCs. In particular, astronomers noticed that the outer Galactic halo contains GCs with redder HBs at a given metallicity than are found inside the solar circle. Thus, at least a second parameter was required to characterize HB morphology. While the term 'second parameter' has since come to be used in a broader context, its identity with respect to the original problem has not been conclusively determined. Here we analyze the median color difference between the HB and the red giant branch, hereafter denoted as Δ(V - I), measured from Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) photometry of 60 GCs within ∼20 kpc of the Galactic center. Analysis of this homogeneous data set reveals that, after the influence of metallicity has been removed from the data, the correlation between Δ(V - I) and age is stronger than that of any other parameter considered. Expanding the sample to include HST ACS and Wide Field Planetary Camera 2 photometry of the six most distant Galactic GCs lends additional support to the correlation between Δ(V - I) and age. This result is robust with respect to the adopted metallicity scale and the method of age determination, but must bear the caveat that high-quality, detailed abundance information is not available for a significant fraction of the sample. Furthermore, when a subset of GCs with similar metallicities and ages is considered, a correlation between Δ(V - I) and central luminosity density is exposed. With respect to the existence of GCs with anomalously red HBs at a given metallicity, we conclude that age is the second parameter and central density is most likely the third. Important problems related to HB morphology in GCs, notably multi-modal distributions

  4. ULTRA-COMPACT DWARFS IN THE COMA CLUSTER

    International Nuclear Information System (INIS)

    Chiboucas, Kristin; Tully, R. Brent; Marzke, R. O.; Phillipps, S.; Price, J.; Peng, Eric W.; Trentham, Neil; Carter, David; Hammer, Derek

    2011-01-01

    We have undertaken a spectroscopic search for ultra-compact dwarf galaxies (UCDs) in the dense core of the dynamically evolved, massive Coma cluster as part of the Hubble Space Telescope/Advanced Camera for Surveys (HST/ACS) Coma Cluster Treasury Survey. UCD candidates were initially chosen based on color, magnitude, degree of resolution within the ACS images, and the known properties of Fornax and Virgo UCDs. Follow-up spectroscopy with Keck/Low-Resolution Imaging Spectrometer confirmed 27 candidates as members of the Coma cluster, a success rate >60% for targeted objects brighter than M R = -12. Another 14 candidates may also prove to be Coma members, but low signal-to-noise spectra prevent definitive conclusions. An investigation of the properties and distribution of the Coma UCDs finds these objects to be very similar to UCDs discovered in other environments. The Coma UCDs tend to be clustered around giant galaxies in the cluster core and have colors/metallicity that correlate with the host galaxy. With properties and a distribution similar to that of the Coma cluster globular cluster population, we find strong support for a star cluster origin for the majority of the Coma UCDs. However, a few UCDs appear to have stellar population or structural properties which differentiate them from the old star cluster populations found in the Coma cluster, perhaps indicating that UCDs may form through multiple formation channels.

  5. Dark Matter Cores in the Fornax and Sculptor Dwarf Galaxies

    DEFF Research Database (Denmark)

    C. Amorisco, Nicola; Zavala Franco, Jesus; J. L. de Boer, Thomas

    2014-01-01

    We combine the detailed Star Formation Histories of the Fornax and Sculptor dwarf Spheroidals with the mass assembly history of their dark matter halo progenitors to estimate if the energy deposited by Supernova type II (SNeII) is sufficient to create a substantial dark matter core. Assuming...... the efficiency of energy injection of the SNeII into dark matter particles is \\epsilon=0.05, we find that a single early episode, z...

  6. A Chemical Evolution Model for the Fornax Dwarf Spheroidal Galaxy

    Directory of Open Access Journals (Sweden)

    Yuan Zhen

    2016-01-01

    Full Text Available Fornax is the brightest Milky Way (MW dwarf spheroidal galaxy and its star formation history (SFH has been derived from observations. We estimate the time evolution of its gas mass and net inflow and outflow rates from the SFH usinga simple star formation law that relates the star formation rate to the gas mass. We present a chemical evolution model on a 2D mass grid with supernovae (SNe as sources of metal enrichment. We find that a key parameter controlling the enrichment is the mass Mx of the gas to mix with the ejecta from each SN. The choice of Mx depends on the evolution of SN remnants and on the global gas dynamics. It differs between the two types of SNe involved and between the periods before and after Fornax became an MW satellite at time t = tsat. Our results indicate that due to the global gas outflow at t > tsat, part of the ejecta from each SN may directly escape from Fornax. Sample results from our model are presented and compared with data.

  7. A 3.5-million Solar Masses Black Hole in the Centre of the Ultracompact Dwarf Galaxy Fornax UCD3

    Science.gov (United States)

    Afanasiev, Anton V.; Chilingarian, Igor V.; Mieske, Steffen; Voggel, Karina T.; Picotti, Arianna; Hilker, Michael; Seth, Anil; Neumayer, Nadine; Frank, Matthias; Romanowsky, Aaron J.; Hau, George; Baumgardt, Holger; Ahn, Christopher; Strader, Jay; den Brok, Mark; McDermid, Richard; Spitler, Lee; Brodie, Jean; Walsh, Jonelle L.

    2018-04-01

    The origin of ultracompact dwarfs (UCDs), a class of compact stellar systems discovered two decades ago, still remains a matter of debate. Recent discoveries of central supermassive black holes in UCDs likely inherited from their massive progenitor galaxies provide support for the tidal stripping hypothesis. At the same time, on statistical grounds, some massive UCDs might be representatives of the high luminosity tail of the globular cluster luminosity function. Here we present a detection of a 3.3^{+1.4}_{-1.2}× 10^6 M_{⊙} black hole (1σ uncertainty) in the centre of the UCD3 galaxy in the Fornax cluster, that corresponds to 4 per cent of its stellar mass. We performed isotropic Jeans dynamical modelling of UCD3 using internal kinematics derived from adaptive optics assisted observations with the SINFONI spectrograph and seeing limited data collected with the FLAMES spectrograph at the ESO VLT. We rule out the zero black hole mass at the 3σ confidence level when adopting a mass-to-light ratio inferred from stellar populations. This is the fourth supermassive black hole found in a UCD and the first one in the Fornax cluster. Similarly to other known UCDs that harbour black holes, UCD3 hosts metal rich stars enhanced in α-elements that supports the tidal stripping of a massive progenitor as its likely formation scenario. We estimate that up to 80 per cent of luminous UCDs in galaxy clusters host central black holes. This fraction should be lower for UCDs in groups, because their progenitors are more likely to be dwarf galaxies, which do not tend to host central black holes.

  8. HOMOGENEOUS UGRIZ PHOTOMETRY FOR ACS VIRGO CLUSTER SURVEY GALAXIES: A NON-PARAMETRIC ANALYSIS FROM SDSS IMAGING

    International Nuclear Information System (INIS)

    Chen, Chin-Wei; Cote, Patrick; Ferrarese, Laura; West, Andrew A.; Peng, Eric W.

    2010-01-01

    We present photometric and structural parameters for 100 ACS Virgo Cluster Survey (ACSVCS) galaxies based on homogeneous, multi-wavelength (ugriz), wide-field SDSS (DR5) imaging. These early-type galaxies, which trace out the red sequence in the Virgo Cluster, span a factor of nearly ∼10 3 in g-band luminosity. We describe an automated pipeline that generates background-subtracted mosaic images, masks field sources and measures mean shapes, total magnitudes, effective radii, and effective surface brightnesses using a model-independent approach. A parametric analysis of the surface brightness profiles is also carried out to obtain Sersic-based structural parameters and mean galaxy colors. We compare the galaxy parameters to those in the literature, including those from the ACSVCS, finding good agreement in most cases, although the sizes of the brightest, and most extended, galaxies are found to be most uncertain and model dependent. Our photometry provides an external measurement of the random errors on total magnitudes from the widely used Virgo Cluster Catalog, which we estimate to be σ(B T )∼ 0.13 mag for the brightest galaxies, rising to ∼ 0.3 mag for galaxies at the faint end of our sample (B T ∼ 16). The distribution of axial ratios of low-mass ( d warf ) galaxies bears a strong resemblance to the one observed for the higher-mass ( g iant ) galaxies. The global structural parameters for the full galaxy sample-profile shape, effective radius, and mean surface brightness-are found to vary smoothly and systematically as a function of luminosity, with unmistakable evidence for changes in structural homology along the red sequence. As noted in previous studies, the ugriz galaxy colors show a nonlinear but smooth variation over a ∼7 mag range in absolute magnitude, with an enhanced scatter for the faintest systems that is likely the signature of their more diverse star formation histories.

  9. THE DARK MATTER DENSITY PROFILE OF THE FORNAX DWARF

    International Nuclear Information System (INIS)

    Jardel, John R.; Gebhardt, Karl

    2012-01-01

    We construct axisymmetric Schwarzschild models to measure the mass profile of the Local Group dwarf galaxy Fornax. These models require no assumptions to be made about the orbital anisotropy of the stars, as is the case for commonly used Jeans models. We test a variety of parameterizations of dark matter density profiles and find cored models with uniform density ρ c = (1.6 ± 0.1) × 10 –2 M ☉ pc –3 fit significantly better than the cuspy halos predicted by cold dark matter simulations. We also construct models with an intermediate-mass black hole, but are unable to make a detection. We place a 1σ upper limit on the mass of a potential intermediate-mass black hole at M . ≤ 3.2 × 10 4 M ☉ .

  10. THE DISTANCE TO NGC 1316 (FORNAX A) FROM OBSERVATIONS OF FOUR TYPE Ia SUPERNOVAE

    International Nuclear Information System (INIS)

    Stritzinger, Maximilian; Phillips, Mark M.; Boldt, Luis; Campillay, Abdo; Krzeminski, Wojtek; Morrell, Nidia; Salgado, Francisco; Roth, Miguel; Burns, Christopher R.; Persson, Sven E.; Freedman, Wendy L.; Madore, Barry F.; Folatelli, Gaston; Hamuy, Mario; Krisciunas, Kevin; Suntzeff, Nicholas B.; Kattner, ShiAnne; Contreras, Carlos

    2010-01-01

    The giant elliptical galaxy NGC 1316 (Fornax A) is a well-studied member of the Fornax Cluster and a prolific producer of Type Ia supernovae (SNe Ia), having hosted four observed events since 1980. Here, we present detailed optical- and near-infrared light curves of the spectroscopically normal SN 2006dd. These data are used, along with previously published photometry of the normal SN 1980N and SN 1981D, and the fast-declining, low-luminosity SN 2006mr, to compute independent estimates of the host reddening for each SN, and the distance to NGC 1316. From the three normal SNe, we find a distance of 17.8 ± 0.3 (random) ± 0.3 (systematic) Mpc for H o = 72. Distance moduli derived from the 'EBV' and Tripp methods give the values that are mutually consistent with 4%-8%. Moreover, the weighted means of the distance moduli for these three SNe for three methods agree to within 3%. This consistency is encouraging and supports the premise that Type Ia SNe are reliable distance indicators at the 5% precision level or better. On the other hand, the two methods used to estimate the distance of the fast-declining SN 2006mr both yield a distance to NGC 1316 which is 25%-30% larger. This disparity casts doubt on the suitability of fast-declining events for estimating extragalactic distances. Modest-to-negligible host galaxy reddening values are derived for all four SNe. Nevertheless, two of them (SN 2006dd and SN 2006mr) show strong Na I D interstellar lines in the host galaxy system. The strength of this absorption is completely inconsistent with the small reddening values derived from the SN light curves if the gas in NGC 1316 is typical of that found in the interstellar medium of the Milky Way. In addition, the equivalent width of the Na lines in SN 2006dd appears to have weakened significantly some 100-150 days after explosion.

  11. High resolution spectroscopy of Red Giant Branch stars and the chemical evolution of the Fornax dwarf spheroidal galaxy

    NARCIS (Netherlands)

    Lemasle, B.; de Boer, T. J. L.; Hill, V.; Tolstoy, E.; Irwin, M. J.; Jablonka, P.; Venn, K.; Battaglia, G.; Starkenburg, E.; Shetrone, M.; Letarte, B.; Francois, P.; Helmi, A.; Primas, F.; Kaufer, A.; Szeifert, T.; Ballet, J.; Martins, F.; Bournaud, F.; Monier, R.; Reylé, C.

    2014-01-01

    From VLT-FLAMES high-resolution spectra, we determine the abundances of several α, iron-peak and neutron-capture elements in 47 Red Giant Branch stars in the Fornax dwarf spheroidal galaxy. We confirm that SNe Ia started to contribute to the chemical enrichment of Fornax at [Fe/H] between --2.0 and

  12. Extremely metal-poor stars in classical dwarf spheroidal galaxies : Fornax, Sculptor, and Sextans

    NARCIS (Netherlands)

    Tafelmeyer, M.; Jablonka, P.; Hill, V.; Shetrone, M.; Tolstoy, E.; Irwin, M. J.; Battaglia, G.; Helmi, A.; Starkenburg, E.; Venn, K. A.; Abel, T.; Francois, P.; Kaufer, A.; North, P.; Primas, F.; Szeifert, T.

    2010-01-01

    We present the results of a dedicated search for extremely metal-poor stars in the Fornax, Sculptor, and Sextans dSphs. Five stars were selected from two earlier VLT/Giraffe and HET/HRS surveys and subsequently followed up at high spectroscopic resolution with VLT/UVES. All of them turned out to

  13. Extremely metal-poor stars in classical dwarf spheroidal galaxies: Fornax, Sculptor, and Sextans

    NARCIS (Netherlands)

    Tafelmeyer, M.; Jablonka, P.; Hill, V.; Shetrone, M.; Tolstoy, E.; Irwin, M. J.; Battaglia, G.; Helmi, A.; Starkenburg, E.; Venn, K. A.; Abel, T.; Francois, P.; Kaufer, A.; North, P.; Primas, F.; Szeifert, T.

    2010-01-01

    We present the results of a dedicated search for extremely metal-poor stars in the Fornax, Sculptor, and Sextans dSphs. Five stars were selected from two earlier VLT/Giraffe and HET/HRS surveys and subsequently followed up at high spectroscopic resolution with VLT/UVES. All of them turned out to

  14. Weak Galactic halo-Fornax dSph connection from RR Lyrae stars

    NARCIS (Netherlands)

    Fiorentino, G.; Monelli, M.; Stetson, P. B.; Bono, G.; Gallart, C.; Martínez-Vázquez, C. E.; Bernard, E. J.; Massari, D.; Braga, V. F.; Dall'Ora, M.

    2017-01-01

    Aims: For the first time accurate pulsation properties of the ancient variable stars of the Fornax dwarf spheroidal galaxy (dSph) are discussed in the broad context of galaxy formation and evolution. Methods: Homogeneous multi-band BVI optical photometry of spanning twenty years has allowed us to

  15. A new study of stellar substructures in the Fornax dwarf spheroidal galaxy

    NARCIS (Netherlands)

    de Boer, T. J. L.; Tolstoy, E.; Saha, A.; Olszewski, E. W.

    Using deep V, B - V wide-field photometry, we have conducted a new study of stellar over-densities in the Fornax dwarf spheroidal galaxy by determining detailed star formation histories from colour-magnitude diagram analysis. We have concentrated on the relatively young stellar component ( We have

  16. Fornax A, Centaurus A other radio galaxies as sources of ultra-high energy cosmic rays

    Science.gov (United States)

    Matthews, J. H.; Bell, A. R.; Blundell, K. M.; Araudo, A. T.

    2018-06-01

    The origin of ultra-high energy cosmic rays (UHECRs) is still unknown. It has recently been proposed that UHECR anisotropies can be attributed to starburst galaxies or active galactic nuclei. We suggest that the latter is more likely and that giant-lobed radio galaxies such as Centaurus A and Fornax A can explain the data.

  17. The dwarf galaxy population of nearby galaxy clusters

    NARCIS (Netherlands)

    Lisker, Thorsten; Wittmann, Carolin; Pak, Mina; Janz, Joachim; Bialas, Daniel; Peletier, Reynier; Grebel, Eva; Falcon Barroso, Jesus; Toloba, Elisa; Smakced Collaboration, Focus Collaboration

    The Fornax, Virgo, Ursa Major and Perseus galaxy clusters all have very different characteristics, in terms of their density, mass, and large-scale environment. We can regard these clusters as laboratories for studying environmental influence on galaxy evolution, using the sensitive low-mass

  18. Nonthermal Particles and Radiation Produced by Cluster Merger Shocks

    Science.gov (United States)

    2003-09-10

    NONTHERMAL PARTICLES AND RADIATION PRODUCED BY CLUSTER MERGER SHOCKS Robert C. Berrington and Charles D. Dermer Naval Research Laboratory, Code 7653...of the merging cluster and is assumed to be constant as the shock propagates outward from the cluster center. In this paper , we model the cluster ...emission in the60–250 eV band for a number of clus- ters. These clusters include Virgo , Coma, Fornax, A2199, A1795, and A4059 (Lieu et al. 1996a, 1996b

  19. The Araucaria Project: The Distance to the Fornax Dwarf Galaxy from Near-infrared Photometry of RR Lyrae Stars

    Science.gov (United States)

    Karczmarek, Paulina; Pietrzyński, Grzegorz; Górski, Marek; Gieren, Wolfgang; Bersier, David

    2017-12-01

    We have obtained single-phase near-infrared (NIR) magnitudes in the J and K bands for 77 RR Lyrae (RRL) stars in the Fornax Dwarf Spheroidal Galaxy. We have used different theoretical and empirical NIR period-luminosity-metallicity calibrations for RRL stars to derive their absolute magnitudes, and found a true, reddening-corrected distance modulus of 20.818+/- 0.015{{(statistical)}}+/- 0.116{{(systematic)}} mag. This value is in excellent agreement with the results obtained within the Araucaria Project from the NIR photometry of red clump stars (20.858 ± 0.013 mag), the tip of the red giant branch (20.84+/- 0.04+/- 0.14 mag), as well as with other independent distance determinations to this galaxy. The effect of metallicity and reddening is substantially reduced in the NIR domain, making this method a robust tool for accurate distance determination at the 5% level. This precision is expected to reach the level of 3% once the zero points of distance calibrations are refined thanks to the Gaia mission. NIR period-luminosity-metallicity relations of RRL stars are particularly useful for distance determinations to galaxies and globular clusters up to 300 kpc, that lack young standard candles, like Cepheids. Based on data collected with the VLT/HAWK-I instrument at ESO Paranal Observatory, Chile, as a part of programme 082.D-0123(B).

  20. INVESTIGATION OF THE PUZZLING ABUNDANCE PATTERN IN THE STARS OF THE FORNAX DWARF SPHEROIDAL GALAXY

    Energy Technology Data Exchange (ETDEWEB)

    Li Hongjie; Cui Wenyuan; Zhang Bo, E-mail: zhangbo@mail.hebtu.edu.cn [Department of Physics, Hebei Normal University, No. 20 East of South 2nd Ring Road, Shijiazhuang 050024 (China)

    2013-09-20

    Many works have found unusual characteristics of elemental abundances in nearby dwarf galaxies. This implies that there is a key factor of galactic evolution that is different from that of the Milky Way (MW). The chemical abundances of the stars in the Fornax dwarf spheroidal galaxy (Fornax dSph) provide excellent information for setting constraints on the models of galactic chemical evolution. In this work, adopting the five-component approach, we fit the abundances of the Fornax dSph stars, including {alpha} elements, iron group elements, and neutron-capture elements. For most sample stars, the relative contributions from the various processes to the elemental abundances are not usually in the MW proportions. We find that the contributions from massive stars to the primary {alpha} elements and iron group elements increase monotonically with increasing [Fe/H]. This means that the effect of the galactic wind is not strong enough to halt star formation and the contributions from the massive stars to {alpha} elements did not halt for [Fe/H] {approx}< -0.5. The average contribution ratios of various processes between the dSph stars and the MW stars monotonically decrease with increasing progenitor mass. This is important evidence of a bottom-heavy initial mass function (IMF) for the Fornax dSph, compared to the MW. Considering a bottom-heavy IMF for the dSph, the observed relations of [{alpha}/Fe] versus [Fe/H], [iron group/Fe] versus [Fe/H], and [neutron-capture/Fe] versus [Fe/H] for the dSph stars can be explained.

  1. Distribución en gran escala de los cúmulos globulares en Fornax

    Science.gov (United States)

    Ostrov, P. G.

    Para analizar los cúmulos globulares azules y rojos de NGC 1399 asociados con NGC 1399 en particular, o si los cúmulos azules representaban un sistema asociado con el cúmulo de Fornax en general, se obtuvieron imágenes CCD de gran formato con el telescopio de 4m del CTIO, en las bandas C y T1. Se describe el método empleado y lo encontrado.

  2. The HST/ACS Coma Cluster Survey - VII. Structure and assembly of massive galaxies in the centre of the Coma cluster

    NARCIS (Netherlands)

    Weinzirl, Tim; Jogee, Shardha; Neistein, Eyal; Khochfar, Sadegh; Kormendy, John; Marinova, Irina; Hoyos, Carlos; Balcells, Marc; den Brok, Mark; Hammer, Derek; Peletier, Reynier F.; Kleijn, Gijs Verdoes; Carter, David; Goudfrooij, Paul; Lucey, John R.; Mobasher, Bahram; Trentham, Neil; Erwin, Peter; Puzia, Thomas

    2014-01-01

    We constrain the assembly history of galaxies in the projected central 0.5 Mpc of the Coma cluster by performing structural decomposition on 69 massive (M⋆ ≥ 109 M⊙) galaxies using high-resolution F814W images from the Hubble Space Telescope (HST) Treasury Survey of Coma. Each galaxy is modelled

  3. Low surface brightness galaxies in the cluster A1367

    International Nuclear Information System (INIS)

    Davies, J.I.; Phillipps, S.; Disney, M.J.

    1989-01-01

    We have obtained deep CCD frames of apparently blank regions of sky in the hope of detecting very low surface brightness (LSB) objects in the cluster A1367. We discuss our data reduction, and image detection and selection techniques. If the galaxies detected are actually cluster members then they are dwarfs and the conclusions of a previous paper on the Fornax cluster are essentially confirmed. One area of variance is that the lowest surface brightness galaxies do not appear to be preferentially concentrated towards the cluster centre. This can be explained by there being a much larger density of dwarf galaxies over this bright galaxy-rich region of the universe. We find over our small area approximately four times as many LSB galaxies as would be expected from our Fornax data. We speculate on the possible origin and likely intensity of intergalactic light within clusters. (author)

  4. The metal-poor knee in the Fornax dwarf spheroidal galaxy

    Energy Technology Data Exchange (ETDEWEB)

    Hendricks, Benjamin; Koch, Andreas [Zentrum für Astronomie der Universität Heidelberg, Landessternwarte, Königstuhl 12, D-69117, Heidelberg (Germany); Lanfranchi, Gustavo A. [Núcleo de Astrofísica Teórica, Universidade Cruzeiro do Sul, R. Galvão Bueno 868, Liberdade, 01506-000, São Paulo, SP (Brazil); Boeche, Corrado [Zentrum für Astronomie der Universität Heidelberg, Astronomisches Rechen-Institut, Mönchhofstr. 12-14, D-69120, Heidelberg (Germany); Walker, Matthew [McWilliams Center for Cosmology, Carnegie Mellon University, 5000 Forbes Ave., Pittsburgh, PA 15213 (United States); Johnson, Christian I. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, MS-15, Cambridge, MA 02138 (United States); Peñarrubia, Jorge [Institute for Astronomy, University of Edinburgh, Royal Observatory, Blackford Hill, Edinburgh EH9 3HJ (United Kingdom); Gilmore, Gerard, E-mail: ben.hendricks@lsw.uni-heidelberg.de [Institute of Astronomy, Cambridge University, Madingley Rd, Cambridge CB3 OHA (United Kingdom)

    2014-04-20

    We present α-element abundances of Mg, Si, and Ti for a large sample of field stars in two outer fields of the Fornax dwarf spheroidal (dSph) galaxy, obtained with Very Large Telescope/GIRAFFE (R ∼ 16, 000). Due to the large fraction of metal-poor (MP) stars in our sample, we are able to follow the α-element evolution from [Fe/H] ≈ –2.5 continuously to [Fe/H] ≈ –0.7. For the first time we are able to resolve the turnover from the Type II supernovae (SNe) dominated, α-enhanced plateau down to subsolar [α/Fe] values, due to the onset of SNe Ia, and thus to trace the chemical enrichment efficiency of the galaxy. Our data support the general concept of an α-enhanced plateau at early epochs, followed by a well-defined 'knee' caused by the onset of SNe Ia, and finally a second plateau with sub-solar [α/Fe] values. We find the position of this knee to be at [Fe/H] ≈ –1.9 and therefore significantly more MP than expected from comparison with other dSphs and standard evolutionary models. Surprisingly, this value is rather comparable to the knee in Sculptor, a dSph ∼10 times less luminous than Fornax. Using chemical evolution models, we find that the position of the knee and the subsequent plateau at the sub-solar level can hardly be explained unless the galaxy experienced several discrete star formation (SF) events with a drastic variation in SF efficiency, while a uniform SF can be ruled out. One possible evolutionary scenario is that Fornax experienced one or several major accretion events from gas-rich systems in the past, so that its current stellar mass is not indicative of the chemical evolution environment at ancient times. If Fornax is the product of several smaller buildings blocks, this may also have implications for the understanding of the formation process of dSphs in general.

  5. Two transitional type Ia supernovae located in the Fornax cluster member NGC 1404

    DEFF Research Database (Denmark)

    Gall, C.; Stritzinger, M. D.; Ashall, C.

    2018-01-01

    and bluer at early times, by three weeks past maximum and extending over several months, its B - V colour is 0.12 mag redder than that of SN 2007on. To reconcile this unusual behaviour, we turn to guidance from a suite of spherical one-dimensional Chandrasekhar-mass delayed-detonation explosion models...

  6. Globular clusters in high-redshift dwarf galaxies: a case study from the Local Group

    Science.gov (United States)

    Zick, Tom O.; Weisz, Daniel R.; Boylan-Kolchin, Michael

    2018-06-01

    We present the reconstructed evolution of rest-frame ultraviolet (UV) luminosities of the most massive Milky Way dwarf spheroidal satellite galaxy, Fornax, and its five globular clusters (GCs) across redshift, based on analysis of the stellar fossil record and stellar population synthesis modelling. We find that (1) Fornax's (proto-)GCs can generate 10-100 times more UV flux than the field population, despite comprising 3. (3) GC formation can introduce order-of-magnitude errors in abundance matching. We also find that some compact HFF objects are consistent with the reconstructed properties of Fornax's GCs at the same redshifts (e.g. surface brightness, star formation rate), suggesting we may have already detected proto-GCs in the early Universe. Finally, we discuss the prospects for improving the connections between local GCs and proto-GCs detected in the early Universe.

  7. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  8. clusters

    Indian Academy of Sciences (India)

    2017-09-27

    Sep 27, 2017 ... Author for correspondence (zh4403701@126.com). MS received 15 ... lic clusters using density functional theory (DFT)-GGA of the DMOL3 package. ... In the process of geometric optimization, con- vergence thresholds ..... and Postgraduate Research & Practice Innovation Program of. Jiangsu Province ...

  9. clusters

    Indian Academy of Sciences (India)

    environmental as well as technical problems during fuel gas utilization. ... adsorption on some alloys of Pd, namely PdAu, PdAg ... ried out on small neutral and charged Au24,26,27, Cu,28 ... study of Zanti et al.29 on Pdn (n = 1–9) clusters.

  10. Motions in Nearby Galaxy Cluster Reveal Presence of Hidden Superstructure

    Science.gov (United States)

    2004-09-01

    A nearby galaxy cluster is facing an intergalactic headwind as it is pulled by an underlying superstructure of dark matter, according to new evidence from NASA's Chandra X-ray Observatory. Astronomers think that most of the matter in the universe is concentrated in long large filaments of dark matter and that galaxy clusters are formed where these filaments intersect. A Chandra survey of the Fornax galaxy cluster revealed a vast, swept-back cloud of hot gas near the center of the cluster. This geometry indicates that the hot gas cloud, which is several hundred thousand light years in length, is moving rapidly through a larger, less dense cloud of gas. The motion of the core gas cloud, together with optical observations of a group of galaxies racing inward on a collision course with it, suggests that an unseen, large structure is collapsing and drawing everything toward a common center of gravity. X-ray Image of Fornax with labels X-ray Image of Fornax with labels "At a relatively nearby distance of about 60 million light years, the Fornax cluster represents a crucial laboratory for studying the interplay of galaxies, hot gas and dark matter as the cluster evolves." said Caleb Scharf of Columbia University in New York, NY, lead author of a paper describing the Chandra survey that was presented at an American Astronomical Society meeting in New Orleans, LA. "What we are seeing could be associated directly with the intergalactic gas surrounding a very large scale structure that stretches over millions of light years." The infalling galaxy group, whose motion was detected by Michael Drinkwater of the University of Melbourne in Australia, and colleagues, is about 3 million light years from the cluster core, so a collision with the core will not occur for a few billion years. Insight as to how this collision will look is provided by the elliptical galaxy NGC 1404 that is plunging into the core of the cluster for the first time. As discussed by Scharf and another group

  11. Polyfluorinated boron cluster based salts: A new electrolyte for application in nonaqueous asymmetric AC/Li{sub 4}Ti{sub 5}O{sub 12} supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Ionica-Bousquet, C.M.; Munoz-Rojas, D.; Palacin, M.R. [Institut de Ciencia de Materials de Barcelona, CSIC, Campus UAB, E-08193 Bellaterra (Spain); Casteel, W.J. Jr.; Pearlstein, R.M.; Kumar, G. Girish; Pez, G.P. [Air Products and Chemicals, Inc., 7201 Hamilton Blvd., Allentown, PA 18195 (United States)

    2011-02-01

    Solutions of novel fluorinated lithium dodecaborate (Li{sub 2}B{sub 12}F{sub x}H{sub 12-x}) salts have been evaluated as electrolytes in nonaqueous asymmetric supercapacitors with Li{sub 4}Ti{sub 5}O{sub 12} as negative electrode, and activated carbon (AC) as positive electrode. The results obtained with these new electrolytes were compared with those obtained with cells built using standard 1 M LiPF{sub 6} dissolved in ethylene carbonate and dimethyl carbonate (EC:DMC; 1:1, v/v) as electrolyte. The specific energy, rate capability, and cycling performances of nonaqueous asymmetric cells based on these new electrolyte salts were studied. Cells assembled using the new fluoroborate salts show excellent reversibility, coulombic efficiency, rate capability and improved cyclability when compared with the standard electrolyte. These features confirm the suitability of lithium-fluoro-borate based salts to be used in nonaqueous asymmetric supercapacitors. (author)

  12. AC Initiation System.

    Science.gov (United States)

    An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)

  13. DARK MATTER CORES IN THE FORNAX AND SCULPTOR DWARF GALAXIES: JOINING HALO ASSEMBLY AND DETAILED STAR FORMATION HISTORIES

    International Nuclear Information System (INIS)

    Amorisco, N. C.; Zavala, J.; De Boer, T. J. L.

    2014-01-01

    We combine the detailed star formation histories of the Fornax and Sculptor dwarf spheroidals with the mass assembly history of their dark matter (DM) halo progenitors to estimate if the energy deposited by Type II supernovae (SNe II) is sufficient to create a substantial DM core. Assuming the efficiency of energy injection of the SNe II into DM particles is ε gc = 0.05, we find that a single early episode, z ≳ z infall , that combines the energy of all SNe II due to explode over 0.5 Gyr is sufficient to create a core of several hundred parsecs in both Sculptor and Fornax. Therefore, our results suggest that it is energetically plausible to form cores in cold dark matter (CDM) halos via early episodic gas outflows triggered by SNe II. Furthermore, based on CDM merger rates and phase-space density considerations, we argue that the probability of a subsequent complete regeneration of the cusp is small for a substantial fraction of dwarf-size halos

  14. THE ACS LCID PROJECT. I. SHORT-PERIOD VARIABLES IN THE ISOLATED DWARF SPHEROIDAL GALAXIES CETUS AND TUCANA

    International Nuclear Information System (INIS)

    Bernard, Edouard J.; Monelli, Matteo; Gallart, Carme

    2009-01-01

    We present the first study of the variable star populations in the isolated dwarf spheroidal galaxies (dSphs) Cetus and Tucana. Based on Hubble Space Telescope images obtained with the Advanced Camera for Surveys in the F475W and F814W bands, we identified 180 and 371 variables in Cetus and Tucana, respectively. The vast majority are RR Lyrae stars. In Cetus, we also found three anomalous Cepheids (ACs), four candidate binaries and one candidate long-period variable (LPV), while six ACs and seven LPV candidates were found in Tucana. Of the RR Lyrae stars, 147 were identified as fundamental mode (RRab) and only eight as first-overtone mode (RRc) in Cetus, with mean periods of 0.614 and 0.363 day, respectively. In Tucana, we found 216 RRab and 82 RRc giving mean periods of 0.604 and 0.353 day. These values place both galaxies in the so-called Oosterhoff Gap, as is generally the case for dSph. We calculated the distance modulus to both galaxies using different approaches based on the properties of RRab and RRc, namely, the luminosity-metallicity and period-luminosity-metallicity relations, and found values in excellent agreement with previous estimates using independent methods: (m - M) 0,Cet = 24.46 ± 0.12 and (m - M) 0,Tuc = 24.74 ± 0.12, corresponding to 780 ± 40 kpc and 890 ± 50 kpc. We also found numerous RR Lyrae variables pulsating in both modes simultaneously (RRd): 17 in Cetus and 60 in Tucana. Tucana is, after Fornax, the second dSph in which such a large fraction of RRd (∼17%) has been observed. We provide the photometry and pulsation parameters for all the variables, and compare the latter with values from the literature for well studied dSph of the Local Group and Galactic globular clusters. The parallel WFPC2 fields were also searched for variables, as they lie well within the tidal radius of Cetus, and at its limit in the case of Tucana. No variables were found in the latter, while 15 were discovered in the outer field of Cetus (11 RRab, three RRc

  15. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  16. Low Offset AC Correlator.

    Science.gov (United States)

    This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)

  17. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  18. Cluster-cluster clustering

    International Nuclear Information System (INIS)

    Barnes, J.; Dekel, A.; Efstathiou, G.; Frenk, C.S.; Yale Univ., New Haven, CT; California Univ., Santa Barbara; Cambridge Univ., England; Sussex Univ., Brighton, England)

    1985-01-01

    The cluster correlation function xi sub c(r) is compared with the particle correlation function, xi(r) in cosmological N-body simulations with a wide range of initial conditions. The experiments include scale-free initial conditions, pancake models with a coherence length in the initial density field, and hybrid models. Three N-body techniques and two cluster-finding algorithms are used. In scale-free models with white noise initial conditions, xi sub c and xi are essentially identical. In scale-free models with more power on large scales, it is found that the amplitude of xi sub c increases with cluster richness; in this case the clusters give a biased estimate of the particle correlations. In the pancake and hybrid models (with n = 0 or 1), xi sub c is steeper than xi, but the cluster correlation length exceeds that of the points by less than a factor of 2, independent of cluster richness. Thus the high amplitude of xi sub c found in studies of rich clusters of galaxies is inconsistent with white noise and pancake models and may indicate a primordial fluctuation spectrum with substantial power on large scales. 30 references

  19. Broadband Radio Polarimetry of Fornax A. I. Depolarized Patches Generated by Advected Thermal Material from NGC 1316

    Science.gov (United States)

    Anderson, C. S.; Gaensler, B. M.; Heald, G. H.; O’Sullivan, S. P.; Kaczmarek, J. F.; Feain, I. J.

    2018-03-01

    We present observations and analysis of the polarized radio emission from the nearby radio galaxy Fornax A over 1.28–3.1 GHz, using data from the Australia Telescope Compact Array. In this, the first of two associated papers, we use modern broadband polarimetric techniques to examine the nature and origin of conspicuous low-polarization (low-p) patches in the lobes. We resolve the (low-p) patches and find that their low fractional polarization is associated with complicated frequency-dependent interference in the polarized signal generated by Faraday effects along the line of sight (LOS). The low-p patches are spatially correlated with interfaces in the magnetic structure of the lobe, across which the LOS-projected magnetic field changes direction. Spatial correlations with the sky-projected magnetic field orientation and structure in total intensity are also identified and discussed. We argue that the (low-p) patches, along with associated reversals in the LOS magnetic field and other related phenomena, are best explained by the presence of { \\mathcal O }({10}9) {M}ȯ of magnetized thermal plasma in the lobes, structured in shells or filaments, and likely advected from the interstellar medium of NCG 1316 or its surrounding intracluster medium. Our study underscores the power and utility of spatially resolved, broadband, full-polarization radio observations to reveal new facets of flow behaviors and magneto-ionic structure in radio lobes and their interplay with the surrounding environment.

  20. Caracterização sazonal de acúmulos isolados de própolis em colônias de Plebeia emerina (Hymenoptera, Apidae no sul do Brasil Seasonal characterization of isolated propolis clusters in Plebeia emerina (Hymenoptera, Apidae colonies in the south of Brazil

    Directory of Open Access Journals (Sweden)

    Camila G. dos Santos

    2009-06-01

    Full Text Available Em colônias de abelhas sem ferrão a aplicação da própolis é ampla, sendo utilizada como matéria-prima nas construções e defesa contra inimigos. Há registros de armazenamento de própolis viscosa, sob forma de acúmulos isolados. Neste trabalho propõe-se a caracterização sazonal da área, do número e da distribuição espacial dos acúmulos isolados de própolis em colônias de Plebeia emerina (Friese, 1900. Colônias foram avaliadas entre outubro/2003 e setembro/2004, medindo-se mensalmente os acúmulos isolados de própolis e registrando-se a posição relativa dos mesmos nas colméias. Entre outubro e março, a área dos acúmulos de própolis nas colônias variou entre 0,50 e 4,92 cm² e o número de acúmulos foi de 3 a 16. No período de abril a setembro, a área foi de 4,54 a 18,48 cm² e o número de acúmulos de 9 a 36. Sugere-se que o aumento da própolis acumulada possa estar relacionado à preparação das colônias para o outonoinverno quando a coleta do produto é reduzida. A análise sazonal da distribuição dos depósitos isolados de própolis corrobora com os registros da área total, indicando preferência da posição anterior da colônia para acumular a própolis. Esta constatação fortalece a hipótese do uso da própolis viscosa dos depósitos isolados na defesa, principalmente junto à entrada das colônias.In colonies of stingless bees, propolis is used for many applications, such as in raw material for constructions and for their defense against enemies. There are records of viscous propolis storage, in form of isolated clusters. In this work, the seasonal characterization of area, number and spatial distribution of isolated propolis clusters in Plebeia emerina (Friese, 1900 colonies is proposed. Colonies were evaluated between October/2003 and September/2004, by measuring in a monthly basis the isolated propolis clusters and recording the relative position of these clusters within the beehives. Between

  1. FLUIDIC AC AMPLIFIERS.

    Science.gov (United States)

    Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems

  2. AC power supply systems

    International Nuclear Information System (INIS)

    Law, H.

    1987-01-01

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  3. ACS Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2005-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

  4. VizieR Online Data Catalog: Cool carbon stars in the halo and Fornax dSph (Mauron+, 2014)

    Science.gov (United States)

    Mauron, N.; Gigoyan, K. S.; Berlioz-Arthaud, P.; Klotz, A.

    2014-03-01

    Spectroscopy of halo candidate C stars was achieved at ESO (La Silla) on 17-18 October 2009 at the NTT telescope equipped with the EFOSC2 instrument in the spectral range 5200-9300Å. We were able to secure the spectra of 25 candidates with exposure times of generally a few minutes, and eventually, eight were found to be C-rich. We also observed three carbon stars in the Carina dwarf galaxy because they were erroneously believed to be in the halo, and for comparison APM 2225-1401, a C star from the list of Totten and Irwin (1998MNRAS.294....1T). We found spectra that covered the Hα region for four halo stars in the Byurakan Astrophysical Observatory archive. They were obtained with the BAO 2.6m telescope and the ByuFOSC2 spectrograph. These spectra were taken on 28 March 1999, 12 June 2002, 11 May 2000, and 11 June 2000 with a resolution ~8Å. Concerning Fornax, spectra of C stars were found in the ESO Archive (program 70.D-0203, P.I. Marc Azzopardi). They were obtained on 5 November 2002 with the ESO 3.6m telescope and the EFOSC instrument with a resolution ~23Å and a spectral coverage from 4000Å to 7950Å. Sixteen C stars were monitored with the ground-based 25cm diameter TAROT telescopes. This monitoring took place irregularly at ESO La Silla and Observatoire de la Cote d'Azur (France) beginning in 2010. Thanks to the recently released Catalina and LINEAR databases, we were able to examine the light curves of 143 halo C stars and found 66 new periodic (Mira or SRa-type) variables among them. (5 data files).

  5. AcMNPV

    African Journals Online (AJOL)

    USER

    2010-08-16

    Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...

  6. AC BREAKDOWN IN GASES

    Science.gov (United States)

    electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.

  7. THERMIONIC AC GENERATION

    Science.gov (United States)

    is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)

  8. AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene

    International Nuclear Information System (INIS)

    McCarthy, Christina B.; Theilmann, David A.

    2008-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription

  9. Mass of AC Andromedae

    International Nuclear Information System (INIS)

    King, D.S.; Cox, A.N.; Hodson, S.W.

    1975-01-01

    Calculations indicate that AC Andromedae is population I rather than population II. A mass and radius for this star are calculated using a new set of opacities for the Kippenhahn Ia mixture. It is concluded that the mass is too high for an ordinary RR Lyrae star. (BJG)

  10. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, G [Jefferson Lab (United States)

    2014-07-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  11. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  12. K2: A NEW METHOD FOR THE DETECTION OF GALAXY CLUSTERS BASED ON CANADA-FRANCE-HAWAII TELESCOPE LEGACY SURVEY MULTICOLOR IMAGES

    International Nuclear Information System (INIS)

    Thanjavur, Karun; Willis, Jon; Crampton, David

    2009-01-01

    We have developed a new method, K2, optimized for the detection of galaxy clusters in multicolor images. Based on the Red Sequence approach, K2 detects clusters using simultaneous enhancements in both colors and position. The detection significance is robustly determined through extensive Monte Carlo simulations and through comparison with available cluster catalogs based on two different optical methods, and also on X-ray data. K2 also provides quantitative estimates of the candidate clusters' richness and photometric redshifts. Initially, K2 was applied to the two color (gri) 161 deg 2 images of the Canada-France-Hawaii Telescope Legacy Survey Wide (CFHTLS-W) data. Our simulations show that the false detection rate for these data, at our selected threshold, is only ∼1%, and that the cluster catalogs are ∼80% complete up to a redshift of z = 0.6 for Fornax-like and richer clusters and to z ∼ 0.3 for poorer clusters. Based on the g-, r-, and i-band photometric catalogs of the Terapix T05 release, 35 clusters/deg 2 are detected, with 1-2 Fornax-like or richer clusters every 2 deg 2 . Catalogs containing data for 6144 galaxy clusters have been prepared, of which 239 are rich clusters. These clusters, especially the latter, are being searched for gravitational lenses-one of our chief motivations for cluster detection in CFHTLS. The K2 method can be easily extended to use additional color information and thus improve overall cluster detection to higher redshifts. The complete set of K2 cluster catalogs, along with the supplementary catalogs for the member galaxies, are available on request from the authors.

  13. The globular cluster system of NGC 1316. II. The extraordinary object SH2

    Science.gov (United States)

    Richtler, T.; Kumar, B.; Bassino, L. P.; Dirsch, B.; Romanowsky, A. J.

    2012-07-01

    Context. SH2 has been described as an isolated HII-region, located about 6.5' south of the nucleus of NGC 1316 (Fornax A), a merger remnant in the the outskirts of the Fornax cluster of galaxies. Aims: We give a first, preliminary description of the stellar content and environment of this remarkable object. Methods: We used photometric data in the Washington system and HST photometry from the Hubble Legacy Archive for a morphological description and preliminary aperture photometry. Low-resolution spectroscopy provides radial velocities of the brightest star cluster in SH2 and a nearby intermediate-age cluster. Results: SH2 is not a normal HII-region, ionized by very young stars. It contains a multitude of star clusters with ages of approximately 108 yr. A ring-like morphology is striking. SH2 seems to be connected to an intermediate-age massive globular cluster with a similar radial velocity, which itself is the main object of a group of fainter clusters. Metallicity estimates from emission lines remain ambiguous. Conclusions: The present data do not yet allow firm conclusions about the nature or origin of SH2. It might be a dwarf galaxy that has experienced a burst of extremely clustered star formation. We may witness how globular clusters are donated to a parent galaxy. Based on observations taken at the European Southern Observatory, Cerro Paranal, Chile, under the programmes 082.B-0680, on observations taken at the Interamerican Observatory, Cerro Tololo, Chile. Furthermore based on observations made with the NASA/ESA Hubble Space Telescope (HST, PI: A. Sandage, Prop.ID: 7504), and obtained from the Hubble Legacy Archive, which is a collaboration between the Space Telescope Science Institute (STScI/NASA), the Space Telescope European Coordinating Facility (ST-ECF/ESA) and the Canadian Astronomy Data Centre (CADC/NRC/CSA).

  14. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

    1997-01-01

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  15. Superconducting ac cable

    Science.gov (United States)

    Schmidt, F.

    1980-11-01

    The components of a superconducting 110 kV ac cable for power ratings or = 2000 MVA were developed. The cable design is of the semiflexible type, with a rigid cryogenic envelope containing a flexible hollow coaxial cable core. The cable core consists of spirally wound Nb-A1 composite wires electrically insulated by high pressure polyethylene tape wrappings. A 35 m long single phase test cable with full load terminals rated at 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of this cable design.

  16. ac superconducting articles

    International Nuclear Information System (INIS)

    Meyerhoff, R.W.

    1977-01-01

    A noval ac superconducting cable is described. It consists of a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface

  17. Superconducting ac cable

    International Nuclear Information System (INIS)

    Schmidt, F.

    1980-01-01

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.) [de

  18. Globular Clusters - Guides to Galaxies

    CERN Document Server

    Richtler, Tom; Joint ESO-FONDAP Workshop on Globular Clusters

    2009-01-01

    The principal question of whether and how globular clusters can contribute to a better understanding of galaxy formation and evolution is perhaps the main driving force behind the overall endeavour of studying globular cluster systems. Naturally, this splits up into many individual problems. The objective of the Joint ESO-FONDAP Workshop on Globular Clusters - Guides to Galaxies was to bring together researchers, both observational and theoretical, to present and discuss the most recent results. Topics covered in these proceedings are: internal dynamics of globular clusters and interaction with host galaxies (tidal tails, evolution of cluster masses), accretion of globular clusters, detailed descriptions of nearby cluster systems, ultracompact dwarfs, formations of massive clusters in mergers and elsewhere, the ACS Virgo survey, galaxy formation and globular clusters, dynamics and kinematics of globular cluster systems and dark matter-related problems. With its wide coverage of the topic, this book constitute...

  19. ACS Postflash Characterization

    Science.gov (United States)

    Smith, Linda

    2011-10-01

    This program will evaluate the in-flight performance of the ACS/WFC post-flash lamp. A series of observations of Omega Cen will be taken using short and long exposures. The short exposures will be post-flashed using pre-determined exposure times to produce backgrounds from 0 to 125 e-. The data will be used to {1} make an empirical study of the effectiveness in preserving counts for faint stars on various post-flash backgrounds; {2} validate that our current mechanisms for formula-based and pixel-based corrections provide good fixes for whatever CTE remains; and {3} probe a fine enough range of backgrounds that users will be able to pick the level that optimizes their science, which will be a straightforward compromise between the noise added and the signal preserved.

  20. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  1. Clustering of near clusters versus cluster compactness

    International Nuclear Information System (INIS)

    Yu Gao; Yipeng Jing

    1989-01-01

    The clustering properties of near Zwicky clusters are studied by using the two-point angular correlation function. The angular correlation functions for compact and medium compact clusters, for open clusters, and for all near Zwicky clusters are estimated. The results show much stronger clustering for compact and medium compact clusters than for open clusters, and that open clusters have nearly the same clustering strength as galaxies. A detailed study of the compactness-dependence of correlation function strength is worth investigating. (author)

  2. Supra-galactic colour patterns in globular cluster systems

    Science.gov (United States)

    Forte, Juan C.

    2017-07-01

    An analysis of globular cluster systems associated with galaxies included in the Virgo and Fornax Hubble Space Telescope-Advanced Camera Surveys reveals distinct (g - z) colour modulation patterns. These features appear on composite samples of globular clusters and, most evidently, in galaxies with absolute magnitudes Mg in the range from -20.2 to -19.2. These colour modulations are also detectable on some samples of globular clusters in the central galaxies NGC 1399 and NGC 4486 (and confirmed on data sets obtained with different instruments and photometric systems), as well as in other bright galaxies in these clusters. After discarding field contamination, photometric errors and statistical effects, we conclude that these supra-galactic colour patterns are real and reflect some previously unknown characteristic. These features suggest that the globular cluster formation process was not entirely stochastic but included a fraction of clusters that formed in a rather synchronized fashion over large spatial scales, and in a tentative time lapse of about 1.5 Gy at redshifts z between 2 and 4. We speculate that the putative mechanism leading to that synchronism may be associated with large scale feedback effects connected with violent star-forming events and/or with supermassive black holes.

  3. Superconductive AC current limiter

    International Nuclear Information System (INIS)

    Bekhaled, M.

    1987-01-01

    This patent describes an AC current limiter for a power transport line including a power supply circuit and feeding a load circuit via an overload circuit-breaker member. The limiter comprises a transformer having a primary winding connected in series between the power supply circuit and the load circuit and at least one secondary winding of superconductor material contained in a cryogenic enclosure and short-circuited on itself. The leakage reactance of the transformer as seen from the primary winding is low, and the resistance of the at least one secondary winding when in the non-superconducting state and as seen from the primary is much greater than the nominal impedance of the transformer. The improvement whereby the at least one secondary winding of the transformer comprises an active winding in association with a set of auxiliary windings. The set of auxiliary windings is constituted by an even number of series-connected auxiliary windings wound in opposite directions, with the total number of turns in one direction being equal to the total number of turns in the opposite direction, and with the thermal capacity of the secondary winding as a whole being sufficiently high to limit the expansion thereof to a value which remains small during the time it takes the circuit-breaking member to operate

  4. ACS Photometric Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

  5. Introduction to AC machine design

    CERN Document Server

    Lipo, Thomas A

    2018-01-01

    AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

  6. Open source clustering software.

    Science.gov (United States)

    de Hoon, M J L; Imoto, S; Nolan, J; Miyano, S

    2004-06-12

    We have implemented k-means clustering, hierarchical clustering and self-organizing maps in a single multipurpose open-source library of C routines, callable from other C and C++ programs. Using this library, we have created an improved version of Michael Eisen's well-known Cluster program for Windows, Mac OS X and Linux/Unix. In addition, we generated a Python and a Perl interface to the C Clustering Library, thereby combining the flexibility of a scripting language with the speed of C. The C Clustering Library and the corresponding Python C extension module Pycluster were released under the Python License, while the Perl module Algorithm::Cluster was released under the Artistic License. The GUI code Cluster 3.0 for Windows, Macintosh and Linux/Unix, as well as the corresponding command-line program, were released under the same license as the original Cluster code. The complete source code is available at http://bonsai.ims.u-tokyo.ac.jp/mdehoon/software/cluster. Alternatively, Algorithm::Cluster can be downloaded from CPAN, while Pycluster is also available as part of the Biopython distribution.

  7. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  8. Automatic Clustering Using FSDE-Forced Strategy Differential Evolution

    Science.gov (United States)

    Yasid, A.

    2018-01-01

    Clustering analysis is important in datamining for unsupervised data, cause no adequate prior knowledge. One of the important tasks is defining the number of clusters without user involvement that is known as automatic clustering. This study intends on acquiring cluster number automatically utilizing forced strategy differential evolution (AC-FSDE). Two mutation parameters, namely: constant parameter and variable parameter are employed to boost differential evolution performance. Four well-known benchmark datasets were used to evaluate the algorithm. Moreover, the result is compared with other state of the art automatic clustering methods. The experiment results evidence that AC-FSDE is better or competitive with other existing automatic clustering algorithm.

  9. Nuclear structure of 231Ac

    International Nuclear Information System (INIS)

    Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.

    2008-01-01

    The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus

  10. GLOBULAR CLUSTER ABUNDANCES FROM HIGH-RESOLUTION, INTEGRATED-LIGHT SPECTROSCOPY. II. EXPANDING THE METALLICITY RANGE FOR OLD CLUSTERS AND UPDATED ANALYSIS TECHNIQUES

    Energy Technology Data Exchange (ETDEWEB)

    Colucci, Janet E.; Bernstein, Rebecca A.; McWilliam, Andrew [The Observatories of the Carnegie Institution for Science, 813 Santa Barbara St., Pasadena, CA 91101 (United States)

    2017-01-10

    We present abundances of globular clusters (GCs) in the Milky Way and Fornax from integrated-light (IL) spectra. Our goal is to evaluate the consistency of the IL analysis relative to standard abundance analysis for individual stars in those same clusters. This sample includes an updated analysis of seven clusters from our previous publications and results for five new clusters that expand the metallicity range over which our technique has been tested. We find that the [Fe/H] measured from IL spectra agrees to ∼0.1 dex for GCs with metallicities as high as [Fe/H] = −0.3, but the abundances measured for more metal-rich clusters may be underestimated. In addition we systematically evaluate the accuracy of abundance ratios, [X/Fe], for Na i, Mg i, Al i, Si i, Ca i, Ti i, Ti ii, Sc ii, V i, Cr i, Mn i, Co i, Ni i, Cu i, Y ii, Zr i, Ba ii, La ii, Nd ii, and Eu ii. The elements for which the IL analysis gives results that are most similar to analysis of individual stellar spectra are Fe i, Ca i, Si i, Ni i, and Ba ii. The elements that show the greatest differences include Mg i and Zr i. Some elements show good agreement only over a limited range in metallicity. More stellar abundance data in these clusters would enable more complete evaluation of the IL results for other important elements.

  11. Fission approach to cluster radioactivity

    Indian Academy of Sciences (India)

    2015-08-04

    Aug 4, 2015 ... Also, the analytical superasymmetric fission (ASAF) model is successfully employed to make a systematic search and to predict, with other models, cluster ... those of the staff, the journals, various programmes, and Current Science, has changed from 'ias.ernet.in' (or 'academy.ias.ernet.in') to 'ias.ac.in'. Thus ...

  12. AC ignition of HID lamps

    NARCIS (Netherlands)

    Sobota, A.; Kanters, J.H.M.; Manders, F.; Veldhuizen, van E.M.; Haverlag, M.

    2010-01-01

    Our aim was to examine the starting behaviour of mid-pressure argon discharges in pin-pin (point-to-point) geometry, typically used in HID lamps. We focused our work on AC ignition of 300 and 700 mbar Ar discharges in Philips 70W standard burners. Frequency was varied between 200 kHz and 1 MHz. In

  13. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

  14. Aperture measurements with AC dipole

    CERN Document Server

    Fuster Martinez, Nuria; Dilly, Joschua Werner; Nevay, Laurence James; Bruce, Roderik; Tomas Garcia, Rogelio; Redaelli, Stefano; Persson, Tobias Hakan Bjorn; CERN. Geneva. ATS Department

    2018-01-01

    During the MDs performed on the 15th of September and 29th of November 2017, we measured the LHC global aperture at injection with a new AC dipole method as well as using the Transverse Damper (ADT) blow-up method used during the 2017 LHC commissioning for benchmarking. In this note, the MD procedure is presented as well as the analysis of the comparison between the two methods. The possible benefits of the new method are discussed.

  15. Cluster headache

    Science.gov (United States)

    Histamine headache; Headache - histamine; Migrainous neuralgia; Headache - cluster; Horton's headache; Vascular headache - cluster ... Doctors do not know exactly what causes cluster headaches. They ... (chemical in the body released during an allergic response) or ...

  16. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  17. Weighted Clustering

    DEFF Research Database (Denmark)

    Ackerman, Margareta; Ben-David, Shai; Branzei, Simina

    2012-01-01

    We investigate a natural generalization of the classical clustering problem, considering clustering tasks in which different instances may have different weights.We conduct the first extensive theoretical analysis on the influence of weighted data on standard clustering algorithms in both...... the partitional and hierarchical settings, characterizing the conditions under which algorithms react to weights. Extending a recent framework for clustering algorithm selection, we propose intuitive properties that would allow users to choose between clustering algorithms in the weighted setting and classify...

  18. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  19. The globular cluster system of NGC 1316. IV. Nature of the star cluster complex SH2

    Science.gov (United States)

    Richtler, T.; Husemann, B.; Hilker, M.; Puzia, T. H.; Bresolin, F.; Gómez, M.

    2017-05-01

    Context. The light of the merger remnant NGC 1316 (Fornax A) is dominated by old and intermediate-age stars. The only sign of current star formation in this big galaxy is the Hii region SH2, an isolated star cluster complex with a ring-like morphology and an estimated age of 0.1 Gyr at a galactocentric distance of about 35 kpc. A nearby intermediate-age globular cluster, surrounded by weak line emission and a few more young star clusters, is kinematically associated. The origin of this complex is enigmatic. Aims: We want to investigate the nature of this star cluster complex. The nebular emission lines permit a metallicity determination which can discriminate between a dwarf galaxy or other possible precursors. Methods: We used the Integral Field Unit (IFU) of the VIMOS instrument at the Very Large Telescope of the European Southern Observatory in high dispersion mode to study the morphology, kinematics, and metallicity employing line maps, velocity maps, and line diagnostics of a few characteristic spectra. Results: The line ratios of different spectra vary, indicating highly structured Hii regions, but define a locus of uniform metallicity. The strong-line diagnostic diagrams and empirical calibrations point to a nearly solar or even super-solar oxygen abundance. The velocity dispersion of the gas is highest in the region offset from the bright clusters. Star formation may be active on a low level. There is evidence for a large-scale disk-like structure in the region of SH2, which would make the similar radial velocity of the nearby globular cluster easier to understand. Conclusions: The high metallicity does not fit to a dwarf galaxy as progenitor. We favour the scenario of a free-floating gaseous complex having its origin in the merger 2 Gyr ago. Over a long period the densities increased secularly until finally the threshold for star formation was reached. SH2 illustrates how massive star clusters can form outside starbursts and without a considerable field

  20. SNS AC Power Distribution and Reliability of AC Power Supply

    CERN Document Server

    Holik, Paul S

    2005-01-01

    The SNS Project has 45MW of installed power. A design description under the Construction Design and Maintenance (CDM) with regard to regulations (OSHA, NFPA, NEC), reliability issues and maintenance of the AC power distribution system are herewith presented. The SNS Project has 45MW of installed power. The Accelerator Systems are Front End (FE)and LINAC KLYSTRON Building (LK), Central Helium Liquefier (CHL), High Energy Beam Transport (HEBT), Accumulator Ring and Ring to Target Beam Transport (RTBT) Support Buildings have 30MW installed power. FELK has 16MW installed, majority of which is klystron and magnet power supply system. CHL, supporting the super conducting portion of the accelerator has 7MW installed power and the RING Systems (HEBT, RING and RTBT) have also 7MW installed power.*

  1. Detailed abundance analysis of globular clusters in the Local Group. NGC 147, NGC 6822, and Messier 33

    Science.gov (United States)

    Larsen, S. S.; Brodie, J. P.; Wasserman, A.; Strader, J.

    2018-06-01

    Context. Globular clusters (GCs) are emerging as powerful tracers of the chemical composition of extragalactic stellar populations. Aims: We present new abundance measurements for 11 GCs in the Local Group galaxies NGC 147, NGC 6822, and Messier 33. These are combined with previously published observations of four GCs in the Fornax and Wolf-Lundmark-Melotte (WLM) galaxies. Methods: The abundances were determined from analyses of integrated-light spectra obtained with the HIRES spectrograph on the Keck I telescope and with UVES on the Very Large Telescope (VLT). We used our analysis technique that was developed for this purpose and tested on Milky Way GCs. Results: We find that the clusters with [Fe/H] -1.5, the GCs in M33 are also α-enhanced, while the GCs that belong to dwarfs (NGC 6822 SC7 and Fornax 4) have closer to solar-scaled α-element abundances. The abundance patterns in SC7 are remarkably similar to those in the Galactic GC Ruprecht 106, including significantly subsolar [Na/Fe] and [Ni/Fe] ratios. In NGC 147, the GCs with [Fe/H] account for about 6% of the total luminosity of stars in the same metallicity range, a lower fraction than those previously found in the Fornax and WLM galaxies, but substantially higher than in the Milky Way halo. Conclusions: At low metallicities, the abundance patterns suggest that GCs in the Milky Way, dwarf galaxies, and M33 experienced similar enrichment histories and/or processes. At higher metallicities, the lower levels of α-enhancement in the GCs found in dwarf galaxies resemble the abundance patterns observed in field stars in nearby dwarfs. Constraining the presence of multiple populations in these GCs is complicated by lack of information about detailed abundances in field stars of the corresponding metallicities. We suggest that correlations such as [Na/Fe] versus [Ni/Fe] may prove useful for this purpose if an accuracy of 0.1 dex or better can be reached for integrated-light measurements. Tables A.1-A.15

  2. Cluster management.

    Science.gov (United States)

    Katz, R

    1992-11-01

    Cluster management is a management model that fosters decentralization of management, develops leadership potential of staff, and creates ownership of unit-based goals. Unlike shared governance models, there is no formal structure created by committees and it is less threatening for managers. There are two parts to the cluster management model. One is the formation of cluster groups, consisting of all staff and facilitated by a cluster leader. The cluster groups function for communication and problem-solving. The second part of the cluster management model is the creation of task forces. These task forces are designed to work on short-term goals, usually in response to solving one of the unit's goals. Sometimes the task forces are used for quality improvement or system problems. Clusters are groups of not more than five or six staff members, facilitated by a cluster leader. A cluster is made up of individuals who work the same shift. For example, people with job titles who work days would be in a cluster. There would be registered nurses, licensed practical nurses, nursing assistants, and unit clerks in the cluster. The cluster leader is chosen by the manager based on certain criteria and is trained for this specialized role. The concept of cluster management, criteria for choosing leaders, training for leaders, using cluster groups to solve quality improvement issues, and the learning process necessary for manager support are described.

  3. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  4. The AC photovoltaic module is here!

    Science.gov (United States)

    Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.

    1997-02-01

    This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).

  5. Study on ac losses of HTS coil carrying ac transport current

    International Nuclear Information System (INIS)

    Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan

    2005-01-01

    Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses

  6. Isotopic clusters

    International Nuclear Information System (INIS)

    Geraedts, J.M.P.

    1983-01-01

    Spectra of isotopically mixed clusters (dimers of SF 6 ) are calculated as well as transition frequencies. The result leads to speculations about the suitability of the laser-cluster fragmentation process for isotope separation. (Auth.)

  7. Cluster Headache

    Science.gov (United States)

    ... a role. Unlike migraine and tension headache, cluster headache generally isn't associated with triggers, such as foods, hormonal changes or stress. Once a cluster period begins, however, drinking alcohol ...

  8. Cluster Headache

    OpenAIRE

    Pearce, Iris

    1985-01-01

    Cluster headache is the most severe primary headache with recurrent pain attacks described as worse than giving birth. The aim of this paper was to make an overview of current knowledge on cluster headache with a focus on pathophysiology and treatment. This paper presents hypotheses of cluster headache pathophysiology, current treatment options and possible future therapy approaches. For years, the hypothalamus was regarded as the key structure in cluster headache, but is now thought to be pa...

  9. Categorias Cluster

    OpenAIRE

    Queiroz, Dayane Andrade

    2015-01-01

    Neste trabalho apresentamos as categorias cluster, que foram introduzidas por Aslak Bakke Buan, Robert Marsh, Markus Reineke, Idun Reiten e Gordana Todorov, com o objetivo de categoriíicar as algebras cluster criadas em 2002 por Sergey Fomin e Andrei Zelevinsky. Os autores acima, em [4], mostraram que existe uma estreita relação entre algebras cluster e categorias cluster para quivers cujo grafo subjacente é um diagrama de Dynkin. Para isto desenvolveram uma teoria tilting na estrutura triang...

  10. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  11. Meaningful Clusters

    Energy Technology Data Exchange (ETDEWEB)

    Sanfilippo, Antonio P.; Calapristi, Augustin J.; Crow, Vernon L.; Hetzler, Elizabeth G.; Turner, Alan E.

    2004-05-26

    We present an approach to the disambiguation of cluster labels that capitalizes on the notion of semantic similarity to assign WordNet senses to cluster labels. The approach provides interesting insights on how document clustering can provide the basis for developing a novel approach to word sense disambiguation.

  12. Horticultural cluster

    OpenAIRE

    SHERSTIUK S.V.; POSYLAYEVA K.I.

    2013-01-01

    In the article there are the theoretical and methodological approaches to the nature and existence of the cluster. The cluster differences from other kinds of cooperative and integration associations. Was develop by scientific-practical recommendations for forming a competitive horticultur cluster.

  13. Cluster Matters

    DEFF Research Database (Denmark)

    Gulati, Mukesh; Lund-Thomsen, Peter; Suresh, Sangeetha

    2018-01-01

    sell their products successfully in international markets, but there is also an increasingly large consumer base within India. Indeed, Indian industrial clusters have contributed to a substantial part of this growth process, and there are several hundred registered clusters within the country...... of this handbook, which focuses on the role of CSR in MSMEs. Hence we contribute to the literature on CSR in industrial clusters and specifically CSR in Indian industrial clusters by investigating the drivers of CSR in India’s industrial clusters....

  14. Data Clustering

    Science.gov (United States)

    Wagstaff, Kiri L.

    2012-03-01

    On obtaining a new data set, the researcher is immediately faced with the challenge of obtaining a high-level understanding from the observations. What does a typical item look like? What are the dominant trends? How many distinct groups are included in the data set, and how is each one characterized? Which observable values are common, and which rarely occur? Which items stand out as anomalies or outliers from the rest of the data? This challenge is exacerbated by the steady growth in data set size [11] as new instruments push into new frontiers of parameter space, via improvements in temporal, spatial, and spectral resolution, or by the desire to "fuse" observations from different modalities and instruments into a larger-picture understanding of the same underlying phenomenon. Data clustering algorithms provide a variety of solutions for this task. They can generate summaries, locate outliers, compress data, identify dense or sparse regions of feature space, and build data models. It is useful to note up front that "clusters" in this context refer to groups of items within some descriptive feature space, not (necessarily) to "galaxy clusters" which are dense regions in physical space. The goal of this chapter is to survey a variety of data clustering methods, with an eye toward their applicability to astronomical data analysis. In addition to improving the individual researcher’s understanding of a given data set, clustering has led directly to scientific advances, such as the discovery of new subclasses of stars [14] and gamma-ray bursts (GRBs) [38]. All clustering algorithms seek to identify groups within a data set that reflect some observed, quantifiable structure. Clustering is traditionally an unsupervised approach to data analysis, in the sense that it operates without any direct guidance about which items should be assigned to which clusters. There has been a recent trend in the clustering literature toward supporting semisupervised or constrained

  15. A New Coordinated Voltage Control Scheme for Offshore AC Grid of HVDC Connected Offshore Wind Power Plants

    DEFF Research Database (Denmark)

    Sakamuri, Jayachandra N.; Cutululis, Nicolaos Antonio; Rather, Zakir Hussain

    2015-01-01

    This paper proposes a coordinated voltage control scheme (CVCS) which enhances the voltage ride through (VRT) capability of an offshore AC grid comprised of a cluster of offshore wind power plants (WPP) connected through AC cables to the offshore voltage source converter based high voltage DC (VSC......-HVDC) converter station. Due to limited short circuit power contribution from power electronic interfaced variable speed wind generators and with the onshore main grid decoupled by the HVDC link, the offshore AC grid becomes more vulnerable to dynamic voltage events. Therefore, a short circuit fault...... in the offshore AC Grid is likely to have significant implications on the voltage of the offshore AC grid, hence on the power flow to the onshore mainland grid. The proposed CVCS integrates individual local reactive power control of wind turbines and of the HVDC converter with the secondary voltage controller...

  16. Cluster evolution

    International Nuclear Information System (INIS)

    Schaeffer, R.

    1987-01-01

    The galaxy and cluster luminosity functions are constructed from a model of the mass distribution based on hierarchical clustering at an epoch where the matter distribution is non-linear. These luminosity functions are seen to reproduce the present distribution of objects as can be inferred from the observations. They can be used to deduce the redshift dependence of the cluster distribution and to extrapolate the observations towards the past. The predicted evolution of the cluster distribution is quite strong, although somewhat less rapid than predicted by the linear theory

  17. AC measurements on uranium doped high temperature superconductors

    International Nuclear Information System (INIS)

    Eisterer, M.

    1999-11-01

    The subject of this thesis is the influence of fission tracks on the superconducting properties of melt textured Y-123. The critical current densities, the irreversibility lines and the transition temperature were determined by means of ac measurements. The corresponding ac techniques are explored in detail. Deviations of the ac signal from the expectations according to the Bean model were explained by the dependence of the shielding currents on the electric field. This explanation is supported by the influence of the ac amplitude and frequency on the critical current density but also by a comparison of the obtained data with other experimental techniques. Y-123 has to be doped with uranium in order to induce fission tracks. Uranium forms normal conducting clusters, which are nearly spherical, with a diameter of about 300 nm. Fission of uranium-235 by thermal neutrons creates two high energy ions with a total energy of about 160 MeV. Each of these fission products induces a linear defect with a diameter of about 10 nm. The length of one fission track is 2-4 μm. At 77 K the critical current density is enhanced by the pinning action of the uranium clusters, compared to undoped samples. With decreasing temperature this influence becomes negligible. The critical current densities are strongly enhanced due to the irradiation. At low magnetic fields we find extremely high values for melt textured materials, e.g. 2.5x10 9 Am -2 at 77 K and 0.25 T or 6x10 10 Am -2 at 5 K. Since the critical current was found to be inverse proportional to the square root of the applied magnetic field it decreases rapidly as the field increases. This behavior is predicted by simple theoretical considerations, but is only valid at low temperatures as well as in low magnetic fields at high temperatures. At high fields the critical current drops more rapidly. The irreversibility lines are only slightly changed by this irradiation technique. Only a small shift to higher fields and temperatures

  18. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...

  19. AC distribution system for TFTR pulsed loads

    International Nuclear Information System (INIS)

    Carroll, R.F.; Ramakrishnan, S.; Lemmon, G.N.; Moo, W.I.

    1977-01-01

    This paper outlines the AC distribution system associated with the Tokamak Fusion Test Reactor and discusses the significant areas related to design, protection, and equipment selection, particularly where there is a departure from normal utility and industrial applications

  20. Nonlinear AC susceptibility, surface and bulk shielding

    Science.gov (United States)

    van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.

    1996-02-01

    We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.

  1. Logistics Reduction: Advanced Clothing System (ACS)

    Data.gov (United States)

    National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...

  2. Marketingová komunikace AC Sparta Praha

    OpenAIRE

    Fanta, Jan

    2016-01-01

    Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...

  3. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  4. Transport AC losses in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

    2007-09-15

    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  5. Proportional-Integral-Resonant AC Current Controller

    Directory of Open Access Journals (Sweden)

    STOJIC, D.

    2017-02-01

    Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

  6. Molecular cluster theory of chemical bonding in actinide oxide

    International Nuclear Information System (INIS)

    Ellis, D.E.; Gubanov, V.A.; Rosen, A.

    1978-01-01

    The electronic structure of actinide monoxides AcO and dioxides AcO 2 , where Ac = Th, U, Np, Pu, Am, Cm and Bk has been studied by molecular cluster methods based on the first-principles one-electron local density theory. Molecular orbitals for nearest neighbor clusters AcO 10- 6 and AcO 12- 8 representative of monoxide and dioxide lattices were obtained using non-relativistic spin-restricted and spin-polarized Hartree-Fock-Slater models for the entire series. Fully relativistic Dirac-Slater calculations were performed for ThO, UO and NpO in order to explore magnitude of spin-orbit splittings and level shifts in valence structure. Self-consistent iterations were carried out for NpO, in which the NpO 6 cluster was embedded in the molecular field of the solid. Finally, a ''moment polarized'' model which combines both spin-polarization and relativistic effects in a consistent fashion was applied to the NpO system. Covalent mixing of oxygen 2p and Ac 5f orbitals was found to increase rapidly across the actinide series; metal s,p,d covalency was found to be nearly constant. Mulliken atomic population analysis of cluster eigenvectors shows that free-ion crystal field models are unreliable, except for the light actinides. X-ray photoelectron line shapes have been calculated and are found to compare rather well with experimental data on the dioxides

  7. Clustering Dycom

    KAUST Repository

    Minku, Leandro L.

    2017-10-06

    Background: Software Effort Estimation (SEE) can be formulated as an online learning problem, where new projects are completed over time and may become available for training. In this scenario, a Cross-Company (CC) SEE approach called Dycom can drastically reduce the number of Within-Company (WC) projects needed for training, saving the high cost of collecting such training projects. However, Dycom relies on splitting CC projects into different subsets in order to create its CC models. Such splitting can have a significant impact on Dycom\\'s predictive performance. Aims: This paper investigates whether clustering methods can be used to help finding good CC splits for Dycom. Method: Dycom is extended to use clustering methods for creating the CC subsets. Three different clustering methods are investigated, namely Hierarchical Clustering, K-Means, and Expectation-Maximisation. Clustering Dycom is compared against the original Dycom with CC subsets of different sizes, based on four SEE databases. A baseline WC model is also included in the analysis. Results: Clustering Dycom with K-Means can potentially help to split the CC projects, managing to achieve similar or better predictive performance than Dycom. However, K-Means still requires the number of CC subsets to be pre-defined, and a poor choice can negatively affect predictive performance. EM enables Dycom to automatically set the number of CC subsets while still maintaining or improving predictive performance with respect to the baseline WC model. Clustering Dycom with Hierarchical Clustering did not offer significant advantage in terms of predictive performance. Conclusion: Clustering methods can be an effective way to automatically generate Dycom\\'s CC subsets.

  8. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    International Nuclear Information System (INIS)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  9. Clustering analysis

    International Nuclear Information System (INIS)

    Romli

    1997-01-01

    Cluster analysis is the name of group of multivariate techniques whose principal purpose is to distinguish similar entities from the characteristics they process.To study this analysis, there are several algorithms that can be used. Therefore, this topic focuses to discuss the algorithms, such as, similarity measures, and hierarchical clustering which includes single linkage, complete linkage and average linkage method. also, non-hierarchical clustering method, which is popular name K -mean method ' will be discussed. Finally, this paper will be described the advantages and disadvantages of every methods

  10. Cluster analysis

    CERN Document Server

    Everitt, Brian S; Leese, Morven; Stahl, Daniel

    2011-01-01

    Cluster analysis comprises a range of methods for classifying multivariate data into subgroups. By organizing multivariate data into such subgroups, clustering can help reveal the characteristics of any structure or patterns present. These techniques have proven useful in a wide range of areas such as medicine, psychology, market research and bioinformatics.This fifth edition of the highly successful Cluster Analysis includes coverage of the latest developments in the field and a new chapter dealing with finite mixture models for structured data.Real life examples are used throughout to demons

  11. Cluster editing

    DEFF Research Database (Denmark)

    Böcker, S.; Baumbach, Jan

    2013-01-01

    . The problem has been the inspiration for numerous algorithms in bioinformatics, aiming at clustering entities such as genes, proteins, phenotypes, or patients. In this paper, we review exact and heuristic methods that have been proposed for the Cluster Editing problem, and also applications......The Cluster Editing problem asks to transform a graph into a disjoint union of cliques using a minimum number of edge modifications. Although the problem has been proven NP-complete several times, it has nevertheless attracted much research both from the theoretical and the applied side...

  12. Occupational Clusters.

    Science.gov (United States)

    Pottawattamie County School System, Council Bluffs, IA.

    The 15 occupational clusters (transportation, fine arts and humanities, communications and media, personal service occupations, construction, hospitality and recreation, health occupations, marine science occupations, consumer and homemaking-related occupations, agribusiness and natural resources, environment, public service, business and office…

  13. Fuzzy Clustering

    DEFF Research Database (Denmark)

    Berks, G.; Keyserlingk, Diedrich Graf von; Jantzen, Jan

    2000-01-01

    A symptom is a condition indicating the presence of a disease, especially, when regarded as an aid in diagnosis.Symptoms are the smallest units indicating the existence of a disease. A syndrome on the other hand is an aggregate, set or cluster of concurrent symptoms which together indicate...... and clustering are the basic concerns in medicine. Classification depends on definitions of the classes and their required degree of participant of the elements in the cases' symptoms. In medicine imprecise conditions are the rule and therefore fuzzy methods are much more suitable than crisp ones. Fuzzy c......-mean clustering is an easy and well improved tool, which has been applied in many medical fields. We used c-mean fuzzy clustering after feature extraction from an aphasia database. Factor analysis was applied on a correlation matrix of 26 symptoms of language disorders and led to five factors. The factors...

  14. Cluster generator

    Science.gov (United States)

    Donchev, Todor I [Urbana, IL; Petrov, Ivan G [Champaign, IL

    2011-05-31

    Described herein is an apparatus and a method for producing atom clusters based on a gas discharge within a hollow cathode. The hollow cathode includes one or more walls. The one or more walls define a sputtering chamber within the hollow cathode and include a material to be sputtered. A hollow anode is positioned at an end of the sputtering chamber, and atom clusters are formed when a gas discharge is generated between the hollow anode and the hollow cathode.

  15. Cluster Bulleticity

    OpenAIRE

    Massey, Richard; Kitching, Thomas; Nagai, Daisuke

    2010-01-01

    The unique properties of dark matter are revealed during collisions between clusters of galaxies, such as the bullet cluster (1E 0657−56) and baby bullet (MACS J0025−12). These systems provide evidence for an additional, invisible mass in the separation between the distributions of their total mass, measured via gravitational lensing, and their ordinary ‘baryonic’ matter, measured via its X-ray emission. Unfortunately, the information available from these systems is limited by their rarity. C...

  16. Cluster headache

    OpenAIRE

    Leroux, Elizabeth; Ducros, Anne

    2008-01-01

    Abstract Cluster headache (CH) is a primary headache disease characterized by recurrent short-lasting attacks (15 to 180 minutes) of excruciating unilateral periorbital pain accompanied by ipsilateral autonomic signs (lacrimation, nasal congestion, ptosis, miosis, lid edema, redness of the eye). It affects young adults, predominantly males. Prevalence is estimated at 0.5–1.0/1,000. CH has a circannual and circadian periodicity, attacks being clustered (hence the name) in bouts that can occur ...

  17. Design and synthesis of 225Ac radioimmunopharmaceuticals

    International Nuclear Information System (INIS)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.

    2002-01-01

    The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans

  18. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  19. ac propulsion system for an electric vehicle

    Science.gov (United States)

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  20. Superconducting three element synchronous ac machine

    International Nuclear Information System (INIS)

    Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.

    1975-01-01

    There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition

  1. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

  2. AC conductivity for a holographic Weyl semimetal

    Energy Technology Data Exchange (ETDEWEB)

    Grignani, Gianluca; Marini, Andrea; Peña-Benitez, Francisco; Speziali, Stefano [Dipartimento di Fisica e Geologia, Università di Perugia,I.N.F.N. Sezione di Perugia,Via Pascoli, I-06123 Perugia (Italy)

    2017-03-23

    We study the AC electrical conductivity at zero temperature in a holographic model for a Weyl semimetal. At small frequencies we observe a linear dependence in the frequency. The model shows a quantum phase transition between a topological semimetal (Weyl semimetal phase) with a non vanishing anomalous Hall conductivity and a trivial semimetal. The AC conductivity has an intermediate scaling due to the presence of a quantum critical region in the phase diagram of the system. The phase diagram is reconstructed using the scaling properties of the conductivity. We compare with the experimental data of https://www.doi.org/10.1103/PhysRevB.93.121110 obtaining qualitative agreement.

  3. Mapa acústico parcial de Benetusser

    OpenAIRE

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...

  4. Preliminary study on AC superconducting machines

    International Nuclear Information System (INIS)

    Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.

    1988-01-01

    This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed

  5. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  6. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  7. Statistical time lags in ac discharges

    International Nuclear Information System (INIS)

    Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F

    2011-01-01

    The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

  8. Statistical time lags in ac discharges

    Energy Technology Data Exchange (ETDEWEB)

    Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)

    2011-04-06

    The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms{sup -1}. The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

  9. Cluster Control of Offshore Wind Power Plants Connected to a Common HVDC Station

    DEFF Research Database (Denmark)

    Göksu, Ömer; Sakamuri, Jayachandra N.; Rapp, C. Andrea

    2016-01-01

    of offshore AC grid voltage control and onshore ancillary services provision, i.e. POD by the active power modulation of the cluster. The two cases are simulated using DIgSILENT PowerFactory, where the IEC 61400-27-1 wind turbine and WPP control models and a generic offshore layout with cluster of three WPPs......In this paper a coordinated control for cluster of offshore WPPs connected to the same HVDC connection is being implemented and analyzed. The study is targeting two cases as; coordination of reactive power flow between HVDC converter and the WPP cluster while providing offshore AC grid voltage...... control, and coordinated closed loop control between the HVDC and the WPPs while the cluster is providing Power Oscillation Damping ( POD) via active power modulation. It is shown that the coordinated cluster control helps to improve the steady-state and dynamic response of the offshore AC grid in case...

  10. DEEP CHANDRA OBSERVATIONS OF NGC 1404: CLUSTER PLASMA PHYSICS REVEALED BY AN INFALLING EARLY-TYPE GALAXY

    Energy Technology Data Exchange (ETDEWEB)

    Su, Yuanyuan; Kraft, Ralph P.; Nulsen, Paul; Forman, William R.; Randall, Scott W.; Jones, Christine; Machacek, Marie E. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Roediger, Elke [E.A. Milne Centre for Astrophysics, Department of Physics and Mathematics, University of Hull, Hull, HU6 7RX (United Kingdom); Churazov, Eugene, E-mail: yuanyuan.su@cfa.harvard.edu [Max Planck Institute for Astrophysics, Karl-Schwarzschild-Str. 1, D-85741, Garching (Germany)

    2017-01-01

    The intracluster medium (ICM), as a magnetized and highly ionized fluid, provides an ideal laboratory to study plasma physics under extreme conditions that cannot be achieved on Earth. NGC 1404 is a bright elliptical galaxy that is being gas stripped as it falls through the ICM of the Fornax Cluster. We use the new Chandra X-ray observations of NGC 1404 to study ICM microphysics. The interstellar medium of NGC 1404 is characterized by a sharp leading edge, 8 kpc from the Galaxy center, and a short downstream gaseous tail. Contact discontinuities are resolved on unprecedented spatial scales (0.″5 = 45 pc) due to the combination of the proximity of NGC 1404, the superb spatial resolution of Chandra , and the very deep (670 ks) exposure. At the leading edge, we observe sub-kiloparsec-scale eddies generated by Kelvin–Helmholtz instability (KHI) and put an upper limit of 5% Spitzer on the isotropic viscosity of the hot cluster plasma. We also observe mixing between the hot cluster gas and the cooler galaxy gas in the downstream stripped tail, which provides further evidence of a low viscosity plasma. The assumed ordered magnetic fields in the ICM ought to be smaller than 5 μ G to allow KHI to develop. The lack of an evident magnetic draping layer just outside the contact edge is consistent with such an upper limit.

  11. Multi-phase AC/AC step-down converter for distribution systems

    Science.gov (United States)

    Aeloiza, Eddy C.; Burgos, Rolando P.

    2017-10-25

    A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

  12. AC loss in superconducting tapes and cables

    NARCIS (Netherlands)

    Oomen, M.P.

    2000-01-01

    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers

  13. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  14. Ac-dc converter firing error detection

    International Nuclear Information System (INIS)

    Gould, O.L.

    1996-01-01

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  15. THE ACS NEARBY GALAXY SURVEY TREASURY

    International Nuclear Information System (INIS)

    Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  16. Predicting AC loss in practical superconductors

    International Nuclear Information System (INIS)

    Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P

    2006-01-01

    Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time

  17. Meso Mechanical Analysis of AC Mixture Response

    NARCIS (Netherlands)

    Woldekidan, M.F.; Huurman, M.; Vaccari, E.; Poot, M.

    2012-01-01

    Ongoing research into performance modeling of Asphalt Concrete (AC) mixtures using meso mechanics approaches is being undertaken at Delft University of Technology (TUD). The approach has already been successfully employed for evaluating the long term performance of porous asphalt concrete. The work

  18. Clustering Dycom

    KAUST Repository

    Minku, Leandro L.; Hou, Siqing

    2017-01-01

    baseline WC model is also included in the analysis. Results: Clustering Dycom with K-Means can potentially help to split the CC projects, managing to achieve similar or better predictive performance than Dycom. However, K-Means still requires the number

  19. The Nature and Origin of UCDs in the Coma Cluster

    Science.gov (United States)

    Chiboucas, Kristin; Tully, R. Brent; Madrid, Juan; Phillipps, Steven; Carter, David; Peng, Eric

    2018-01-01

    UCDs are super massive star clusters found largely in dense regions but have also been found around individual galaxies and in smaller groups. Their origin is still under debate but currently favored scenarios include formation as giant star clusters, either as the brightest globular clusters or through mergers of super star clusters, themselves formed during major galaxy mergers, or as remnant nuclei from tidal stripping of nucleated dwarf ellipticals. Establishing the nature of these enigmatic objects has important implications for our understanding of star formation, star cluster formation, the missing satellite problem, and galaxy evolution. We are attempting to disentangle these competing formation scenarios with a large survey of UCDs in the Coma cluster. Using ACS two-passband imaging from the HST/ACS Coma Cluster Treasury Survey, we are using colors and sizes to identify the UCD cluster members. With a large size limited sample of the UCD population within the core region of the Coma cluster, we are investigating the population size, properties, and spatial distribution, and comparing that with the Coma globular cluster and nuclear star cluster populations to discriminate between the threshing and globular cluster scenarios. In previous work, we had found a possible correlation of UCD colors with host galaxy and a possible excess of UCDs around a non-central giant galaxy with an unusually large globular cluster population, both suggestive of a globular cluster origin. With a larger sample size and additional imaging fields that encompass the regions around these giant galaxies, we have found that the color correlation with host persists and the giant galaxy with unusually large globular cluster population does appear to host a large UCD population as well. We present the current status of the survey.

  20. Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.

    Science.gov (United States)

    Han, Xiaomin; Li, Guojing; Zhang, Shuqun

    2017-01-01

    Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.

  1. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Science.gov (United States)

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  2. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  3. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  4. Cluster forcing

    DEFF Research Database (Denmark)

    Christensen, Thomas Budde

    The cluster theory attributed to Michael Porter has significantly influenced industrial policies in countries across Europe and North America since the beginning of the 1990s. Institutions such as the EU, OECD and the World Bank and governments in countries such as the UK, France, The Netherlands...... or management. Both the Accelerate Wales and the Accelerate Cluster programmes target this issue by trying to establish networks between companies that can be used to supply knowledge from research institutions to manufacturing companies. The paper concludes that public sector interventions can make...... businesses. The universities were not considered by the participating companies to be important parts of the local business environment and inputs from universities did not appear to be an important source to access knowledge about new product development or new techniques in production, distribution...

  5. Regional Innovation Clusters

    Data.gov (United States)

    Small Business Administration — The Regional Innovation Clusters serve a diverse group of sectors and geographies. Three of the initial pilot clusters, termed Advanced Defense Technology clusters,...

  6. AC relaxation in the iron(8) molecular magnet

    Science.gov (United States)

    Rose, Geordie

    2000-11-01

    We investigate the low energy magnetic relaxation characteristics of the ``iron eight'' (Fe8) molecular magnet. Each molecule in this material contains a cluster of eight Fe 3+ ions surrounded by organic ligands. The molecules arrange themselves into a regular lattice with triclinic symmetry. At sufficiently low energies, the electronic spins of the Fe3+ ions lock together into a ``quantum rotator'' with spin S = 10. We derive a low energy effective Hamiltonian for this system, valid for temperatures less than Tc ~ 360 mK , where Tc is the temperature at which the Fe8 system crosses over into a ``quantum regime'' where relaxation characteristics become temperature independent. We show that in this regime the dominant environmental coupling is to the environmental spin bath in the molecule. We show how to explicitly calculate these couplings, given crystallographic information about the molecule, and do this for Fe8. We use this information to calculate the linewidth, topological decoherence and orthogonality blocking parameters. All of these quantities are shown to exhibit an isotope effect. We demonstrate that orthogonality blocking in Fe8 is significant and suppresses coherent tunneling. We then use our low energy effective Hamiltonian to calculate the single-molecule relaxation rate in the presence of an external magnetic field with both AC and DC components by solving the Landau-Zener problem in the presence of a nuclear spin bath. Both sawtooth and sinusoidal AC fields are analyzed. This single-molecule relaxation rate is then used as input into a master equation in order to take into account the many-molecule nature of the full system. Our results are then compared to quantum regime relaxation experiments performed on the Fe8 system.

  7. Cluster analysis

    OpenAIRE

    Mucha, Hans-Joachim; Sofyan, Hizir

    2000-01-01

    As an explorative technique, duster analysis provides a description or a reduction in the dimension of the data. It classifies a set of observations into two or more mutually exclusive unknown groups based on combinations of many variables. Its aim is to construct groups in such a way that the profiles of objects in the same groups are relatively homogenous whereas the profiles of objects in different groups are relatively heterogeneous. Clustering is distinct from classification techniques, ...

  8. Faradaic AC Electrokinetic Flow and Particle Traps

    Science.gov (United States)

    Ben, Yuxing; Chang, Hsueh-Chia

    2004-11-01

    Faradaic reaction at higher voltages can produce co-ion polarization at AC electrodes instead of counter-ion polarization due to capacitive charging from the bulk. The Faradaic co-ion polarization also does not screen the external field and hence can produce large net electro-kinetic flows at frequencies lower than the inverse RC time of the double layer. Due to the opposite polarization of capacitve and Faradaic charging, we can reverse the direction of AC flows on electrodes by changing the voltage and frequency. Particles and bacteria are trapped and then dispersed at stagnation lines, at locations predicted by our theory, by using these two flows sequentially. This technique offers a good way to concentrate and detect bacteria.

  9. AC application of second generation HTS wire

    Science.gov (United States)

    Thieme, C. L. H.; Gagnon, K.; Voccio, J.; Aized, D.; Claassen, J.

    2008-02-01

    For the production of Second Generation (2G) YBCO High Temperature Superconductor wire American Superconductor uses a wide-strip MOD-YBCO/RABiTSTM process, a low-cost approach for commercial manufacturing. It can be engineered with a high degree of flexibility to manufacture practical 2G conductors with architectures and properties tailored for specific applications and operating conditions. For ac applications conductor and coil design can be geared towards low hysteretic losses. For applications which experience high frequency ac fields, the stabilizer needs to be adjusted for low eddy current losses. For these applications a stainless-steel laminate is used. An example is a Low Pass Filter Inductor which was developed and built in this work.

  10. Aging, Counterfeiting Configuration Control (AC3)

    Science.gov (United States)

    2010-01-31

    Systems Intergrated Into AC3 CABS - Common As-Built System PRISM - Process Re-inventing Integration Systems for Manufacturing PDM - Product Data...looks forward to deploying the completed tool at Raytheon in a true production environment, for as much as we like the challenge associated with...performance of DoD systems. DoD systems are particularly susceptible to intrusion of counterfeit parts, especially during surge and extended production

  11. The LHC AC Dipole system: an introduction

    CERN Document Server

    Serrano, J; CERN. Geneva. BE Department

    2010-01-01

    The LHC AC Dipole is an instrument to study properties of the LHC lattice by inducing large transverse displacements in the beam. These displacements are generated by exciting the beam with an oscillating magnetic field at a frequency close to the tune. This paper presents the system requirements and the technical solution chosen to meet them, based of high-power audio amplifiers and a resonant parallel RLC circuit.

  12. Modeling photovoltaic systems for AC appliances

    Directory of Open Access Journals (Sweden)

    Andreea Maria Neaca

    2009-10-01

    Full Text Available In this paper is described the development of a model which can simulate the performance of a photovoltaic (PV system under specific meteorological conditions and transforming the DC current into AC current. In this model, the accent stands on the design of a series charge regulator. It is treated also the benefit of creating a circuit, with different methods, that can test the maximum power point trackers (MPPT for different photovoltaic applications.

  13. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    Over the last decade, distributed energy resources (DER) technology has undergone a fast development. Increased penetration of DER units and wide spread use of renewable energy sources challenge the entire architecture of traditional power system. Microgrid, characterizing higher flexibility......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  14. CTE Corrections for WFPC2 and ACS

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The error budget for optical broadband photometry is dominated by three factors: CTE corrections, long-short anomaly corrections, and photometric zero points. Questions about the dependencies of the CTE have largely been resolved, and my CTE corrections have been included in the WFPC2 handbook and tutorial. What remains to be done is the determination of the "final" CTE correction at the end of the WFPC2 mission, which will increase the accuracy of photometry obtained in the final few cycles. The long-short anomaly is still the subject of much debate, as it remains unclear whethere or not this effect is real and, if so, what its size and nature is. Photometric zero points have likewise varied by over 0.05 magnitudes in the literature, and will likely remain unresolved until the long-short anomaly is addressed {given that most calibration exposures are short while most science exposures are long}. It is also becoming apparent that similar issues will affect the accuracy of ACS photometry, and consequently that an ACS CTE study analogous to my WFPC2 work would significantly improve the calibration of ACS. I therefore propose to use archival WFPC2 images of omega Cen and ACS images of 47 Tuc to continue my HST calibration work. I also propose to begin work on "next-generation" CTE corrections, in which corrections are applied to the images based on accurate charge-trapping models rather than to the reduced photometry. This technique will allow for more accurate CTE corrections in certain cases {such as a star above a bright star or on a variable background}, improved PSF-fitting photometry of faint stars, and image restoration for accurate analysis of extended objects.

  15. Direct amplitude detuning measurement with ac dipole

    Directory of Open Access Journals (Sweden)

    S. White

    2013-07-01

    Full Text Available In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning. The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

  16. Dark matter searches with Cherenkov telescopes: nearby dwarf galaxies or local galaxy clusters?

    Energy Technology Data Exchange (ETDEWEB)

    Sánchez-Conde, Miguel A. [SLAC National Laboratory and Kavli Institute for Particle Astrophysics and Cosmology, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States); Cannoni, Mirco; Gómez, Mario E. [Dpto. Física Aplicada, Facultad de Ciencias Experimentales, Universidad de Huelva, 21071 Huelva (Spain); Zandanel, Fabio; Prada, Francisco, E-mail: masc@stanford.edu, E-mail: mirco.cannoni@dfa.uhu.es, E-mail: fabio@iaa.es, E-mail: mario.gomez@dfa.uhu.es, E-mail: fprada@iaa.es [Instituto de Astrofísica de Andalucía (CSIC), E-18008, Granada (Spain)

    2011-12-01

    In this paper, we compare dwarf galaxies and galaxy clusters in order to elucidate which object class is the best target for gamma-ray DM searches with imaging atmospheric Cherenkov telescopes (IACTs). We have built a mixed dwarfs+clusters sample containing some of the most promising nearby dwarf galaxies (Draco, Ursa Minor, Wilman 1 and Segue 1) and local galaxy clusters (Perseus, Coma, Ophiuchus, Virgo, Fornax, NGC 5813 and NGC 5846), and then compute their DM annihilation flux profiles by making use of the latest modeling of their DM density profiles. We also include in our calculations the effect of DM substructure. Willman 1 appears as the best candidate in the sample. However, its mass modeling is still rather uncertain, so probably other candidates with less uncertainties and quite similar fluxes, namely Ursa Minor and Segue 1, might be better options. As for galaxy clusters, Virgo represents the one with the highest flux. However, its large spatial extension can be a serious handicap for IACT observations and posterior data analysis. Yet, other local galaxy cluster candidates with more moderate emission regions, such as Perseus, may represent good alternatives. After comparing dwarfs and clusters, we found that the former exhibit annihilation flux profiles that, at the center, are roughly one order of magnitude higher than those of clusters, although galaxy clusters can yield similar, or even higher, integrated fluxes for the whole object once substructure is taken into account. Even when any of these objects are strictly point-like according to the properties of their annihilation signals, we conclude that dwarf galaxies are best suited for observational strategies based on the search of point-like sources, while galaxy clusters represent best targets for analyses that can deal with rather extended emissions. Finally, we study the detection prospects for present and future IACTs in the framework of the constrained minimal supersymmetric standard model. We

  17. Dark Matter Searches with Cherenkov Telescopes: Nearby Dwarf Galaxies or Local Galaxy Clusters?

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez-Conde, Miguel A.; /KIPAC, Menlo Park /SLAC /IAC, La Laguna /Laguna U., Tenerife; Cannoni, Mirco; /Huelva U.; Zandanel, Fabio; /IAA, Granada; Gomez, Mario E.; /Huelva U.; Prada, Francisco; /IAA, Granada

    2012-06-06

    In this paper, we compare dwarf galaxies and galaxy clusters in order to elucidate which object class is the best target for gamma-ray DM searches with imaging atmospheric Cherenkov telescopes (IACTs). We have built a mixed dwarfs+clusters sample containing some of the most promising nearby dwarf galaxies (Draco, Ursa Minor, Wilman 1 and Segue 1) and local galaxy clusters (Perseus, Coma, Ophiuchus, Virgo, Fornax, NGC 5813 and NGC 5846), and then compute their DM annihilation flux profiles by making use of the latest modeling of their DM density profiles. We also include in our calculations the effect of DM substructure. Willman 1 appears as the best candidate in the sample. However, its mass modeling is still rather uncertain, so probably other candidates with less uncertainties and quite similar fluxes, namely Ursa Minor and Segue 1, might be better options. As for galaxy clusters, Virgo represents the one with the highest flux. However, its large spatial extension can be a serious handicap for IACT observations and posterior data analysis. Yet, other local galaxy cluster candidates with more moderate emission regions, such as Perseus, may represent good alternatives. After comparing dwarfs and clusters, we found that the former exhibit annihilation flux profiles that, at the center, are roughly one order of magnitude higher than those of clusters, although galaxy clusters can yield similar, or even higher, integrated fluxes for the whole object once substructure is taken into account. Even when any of these objects are strictly point-like according to the properties of their annihilation signals, we conclude that dwarf galaxies are best suited for observational strategies based on the search of point-like sources, while galaxy clusters represent best targets for analyses that can deal with rather extended emissions. Finally, we study the detection prospects for present and future IACTs in the framework of the constrained minimal supersymmetric standard model. We

  18. Horizontal transfer of a nitrate assimilation gene cluster and ecological transitions in fungi: a phylogenetic study.

    Directory of Open Access Journals (Sweden)

    Jason C Slot

    Full Text Available High affinity nitrate assimilation genes in fungi occur in a cluster (fHANT-AC that can be coordinately regulated. The clustered genes include nrt2, which codes for a high affinity nitrate transporter; euknr, which codes for nitrate reductase; and NAD(PH-nir, which codes for nitrite reductase. Homologs of genes in the fHANT-AC occur in other eukaryotes and prokaryotes, but they have only been found clustered in the oomycete Phytophthora (heterokonts. We performed independent and concatenated phylogenetic analyses of homologs of all three genes in the fHANT-AC. Phylogenetic analyses limited to fungal sequences suggest that the fHANT-AC has been transferred horizontally from a basidiomycete (mushrooms and smuts to an ancestor of the ascomycetous mold Trichoderma reesei. Phylogenetic analyses of sequences from diverse eukaryotes and eubacteria, and cluster structure, are consistent with a hypothesis that the fHANT-AC was assembled in a lineage leading to the oomycetes and was subsequently transferred to the Dikarya (Ascomycota+Basidiomycota, which is a derived fungal clade that includes the vast majority of terrestrial fungi. We propose that the acquisition of high affinity nitrate assimilation contributed to the success of Dikarya on land by allowing exploitation of nitrate in aerobic soils, and the subsequent transfer of a complete assimilation cluster improved the fitness of T. reesei in a new niche. Horizontal transmission of this cluster of functionally integrated genes supports the "selfish operon" hypothesis for maintenance of gene clusters.

  19. Flame spread over inclined electrical wires with AC electric fields

    KAUST Repository

    Lim, Seung J.; Park, Sun H.; Park, Jeong; Fujita, Osamu; Keel, Sang I.; Chung, Suk-Ho

    2017-01-01

    Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field

  20. The Hubble Legacy Archive ACS grism data

    Science.gov (United States)

    Kümmel, M.; Rosati, P.; Fosbury, R.; Haase, J.; Hook, R. N.; Kuntschner, H.; Lombardi, M.; Micol, A.; Nilsson, K. K.; Stoehr, F.; Walsh, J. R.

    2011-06-01

    A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 μm, with a dispersion of 40 Å/pixel and a resolution of ~80 Å for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47 919 datasets (65% of the total number of extracted spectra) for 32 149 unique objects, with a median iAB-band magnitude of 23.7, reaching 26.5 AB for the faintest objects. Each released dataset contains science-ready 1D and 2D spectra, as well as multi-band image cutouts of corresponding sources and a useful preview page summarising the direct and slitless data, astrometric and photometric parameters. This release is part of the continuing effort to enhance the content of the Hubble Legacy Archive (HLA) with highly processed data products which significantly facilitate the scientific exploitation of the Hubble data. In order to characterize the slitless spectra, emission-line flux and equivalent width sensitivity of the ACS data were compared with public ground-based spectra in the GOODS-South field. An example list of emission line galaxies with two or more identified lines is also included, covering the redshift range 0.2 - 4.6. Almost all redshift determinations outside of the GOODS fields are new. The scope of science projects

  1. Alpha decay 225 Ac → 221Fr

    International Nuclear Information System (INIS)

    Gromov, K. Ya.; Gorozhankin, V.M.; Malov, L.A.; Fominykh, V.I.; Tsupko-Sitnikov, V.V.; Chumin, V.G.; Jakushev, E.A.; Kudrya, S.A.; Sergienko, V.A.; Malikov, Sh.R.

    2004-01-01

    Full text: Considerable attention has been given to nuclei with A = 220 - 230 recently. In this region there occurs transition from the spherical to the deformed nuclear shape, which gives rise to some specific features in the nuclear structure. In particular, negative parity levels with low excitation energies have been found in even-even nuclei from this region [1, 2]. One of the nuclei allowing experimental investigation of the above properties is 221 Fr. The nuclide 221 Fr is from the region of isotopes which does not include stable nuclei and thus it cannot be studied in several-nucleon transfer reactions. In addition, the neutron excess in this nucleus makes it impossible to study the nucleus in reactions with heavy ions. Experimental information on the 221 Fr level structure can only be gained from investigation of the 225 Ac (T 1/2 = 10 days) alpha decay or the 221 Rn (T 1/2 = 25 min) beta decay. In the latter case the possibilities of the investigation are restricted by difficulties in making of 221 Rn sources. Therefore, most information on the structure and properties of 221 Fr is derived from investigation of the 225 Ac α -decay [3]. In-depth investigation of ( α - γ )- coincidences at the 225 Ac decay is carried out. Twenty-one new weak γ - rays are found; 18 γ-rays earlier ascribed to the 225 Ac decay are not confirmed. The quantitative analysis of the ( α - γ )- coincidences makes it possible to find the intensity of 221 Fr levels by the decay and multipolarities of five weak γ -transitions. The conversion electron spectrum is investigated in the range of 5 † 24 keV with a high (some 20 eV) energy resolution. A new M1 type 10.6-keV γ-transition is found. The proposed 225 Ac decay scheme includes 31 excited 221 Fr states. Parities are established for 16 of them. Possible spin values are proposed for 221 Fr levels. Properties of excited 221 Fr states are satisfactorily described by the quasiparticle-phonon nuclear model without the

  2. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  3. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  4. Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)

    Science.gov (United States)

    Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.

    2012-01-01

    The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.

  5. Nuclear clustering - a cluster core model study

    International Nuclear Information System (INIS)

    Paul Selvi, G.; Nandhini, N.; Balasubramaniam, M.

    2015-01-01

    Nuclear clustering, similar to other clustering phenomenon in nature is a much warranted study, since it would help us in understanding the nature of binding of the nucleons inside the nucleus, closed shell behaviour when the system is highly deformed, dynamics and structure at extremes. Several models account for the clustering phenomenon of nuclei. We present in this work, a cluster core model study of nuclear clustering in light mass nuclei

  6. Two-Gyro Pointing Stability of HST measured with ACS

    Science.gov (United States)

    Koekemoer, Anton M.; Kozhurina-Platais, Vera; Riess, Adam; Sirianni, Marco; Biretta, John; Pavlovsky

    2005-06-01

    We present the results of the pointing stability tests for HST, as measured with the ACS/ HRC during the Two-Gyro test program conducted in February 2005. We measure the shifts of 185 exposures of the globular clusters NGC6341 and Omega Centauri, obtained over a total of 13 orbits, and compare the measured pointings to those that were commanded in the observing program. We find in all cases that the measured shifts and rotations have the same level of accuracy as those that were commanded in three-gyro mode. Specifically, the pointing offsets during an orbit relative to the first exposure can be characterized with distributions having a dispersion of 2.3 milliarcseconds for shifts and 0.00097 degrees for rotations, thus less than 0.1 HRC pixels, and agree extremely well with similar values measured for comparable exposures obtained in three-gyro mode. In addition, we successfully processed these two-gyro test data through the MultiDrizzle software which is used in the HST pipeline to perform automated registration, cosmic ray rejection and image combination for multiple exposure sequences, and we find excellent agreement with similar exposures obtained in three-gyro mode. In summary, we find no significant difference between the quality of HST pointing as measured from these two-gyro test data, relative to the nominal behavior of HST in regular three-gyro operations.

  7. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  8. A theoretical study on interaction of proline with gold cluster

    Indian Academy of Sciences (India)

    with Au3 (Pakiari and Jamshidi 2007) and interaction of. ∗. Author for correspondence (harjinder.singh@iiit.ac.in) small gold clusters with xDNA base pairs (Sharma et al. 2009) have motivated us to carry out a theoretical study on interaction of proline with gold nanoparticles. Proline is unique among the natural amino acids ...

  9. AC susceptibility enhancement studies in magnetic systems

    International Nuclear Information System (INIS)

    Mukherjee, S.; Ranganathan, R.; Chakravarti, A.; Sil, S.

    2001-01-01

    Enhancement of AC susceptibility has been observed for typical ferromagnets (Gd), reentrant spin glasses like (Fe 1.5 Mn 1.5 Si) and canted spin systems (Ce(Fe 0.96 Al 0.04 ) 2 ). The data have been interpreted with the help of a simulation model based on dry friction-like pinning of domain walls for systems having ferromagnetic domain structures. A strong pinning mechanism appears in the reentrant spin glass like and canted spin systems at low temperatures in addition to the intrinsic one in the ferromagnetic phase. The temperature variation of the pinning potential has been given qualitatively for the reentrant spin glass like systems

  10. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez

    2015-01-01

    and DC microgrids, and then investigates the existing and promising solutions for the corresponding challenges. To the authors’ knowledge, three parts of smart grids are required to be developed to facilitate implementation of protection scheme in microgrids. The main requirements and open issues......In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  11. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  12. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  13. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

    2009-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

  14. Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

    Directory of Open Access Journals (Sweden)

    Amir V. Tavakoli

    2017-09-01

    Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

  15. HST/ACS Imaging of Omega Centauri: Optical Counterparts of Chandra X-Ray Sources

    Science.gov (United States)

    Cool, Adrienne M.; Haggard, Daryl; Arias, Tersi; Brochmann, Michelle; Dorfman, Jason; Gafford, April; White, Vivian; Anderson, Jay

    2013-02-01

    We present results of a search for optical counterparts of X-ray sources in and toward the globular cluster Omega Centauri (NGC 5139) using the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope. The ACS data consist of a mosaic of Wide Field Channel images obtained using F625W, F435W, and F658N filters; with nine pointings we cover the central ~10' × 10' of the cluster and encompass 109 known Chandra sources. We find promising optical counterparts for 59 of the sources, ~40 of which are likely to be associated with the cluster. These include 27 candidate cataclysmic variables (CVs), 24 of which are reported here for the first time. Fourteen of the CV candidates are very faint, with absolute magnitudes in the range M 625 =10.4-12.6, making them comparable in brightness to field CVs near the period minimum discovered in the Sloan Digital Sky Survey. Additional optical counterparts include three BY Dra candidates, a possible blue straggler, and a previously reported quiescent low-mass X-ray binary. We also identify 3 foreground stars and 11 probable active galactic nuclei. Finally, we report the discovery of a group of seven stars whose X-ray properties are suggestive of magnetically active binaries, and whose optical counterparts lie on or very near the metal-rich anomalous giant and subgiant branches in ω Cen. If the apparent association between these seven stars and the RGB/SGB-a stars is real, then the frequency of X-ray sources in this metal-rich population is enhanced by a factor of at least five relative to the other giant and subgiant populations in the cluster. If these stars are not members of the metal-rich population, then they bring the total number of red stragglers (also known as sub-subgiants) that have been identified in ω to Cen 20, the largest number yet known in any globular cluster.

  16. Bifurcation theory of ac electric arcing

    International Nuclear Information System (INIS)

    Christen, Thomas; Peinke, Emanuel

    2012-01-01

    The performance of alternating current (ac) electric arcing devices is related to arc extinction or its re-ignition at zero crossings of the current (so-called ‘current zero’, CZ). Theoretical investigations thus usually focus on the transient behaviour of arcs near CZ, e.g. by solving the modelling differential equations in the vicinity of CZ. This paper proposes as an alternative approach to investigate global mathematical properties of the underlying periodically driven dynamic system describing the electric circuit containing the arcing device. For instance, the uniqueness of the trivial solution associated with the insulating state indicates the extinction of any arc. The existence of non-trivial attractors (typically a time-periodic state) points to a re-ignition of certain arcs. The performance regions of arcing devices, such as circuit breakers and arc torches, can thus be identified with the regions of absence and existence, respectively, of non-trivial attractors. Most important for applications, the boundary of a performance region in the model parameter space is then associated with the bifurcation of the non-trivial attractors. The concept is illustrated for simple black-box arc models, such as the Mayr and the Cassie model, by calculating for various cases the performance boundaries associated with the bifurcation of ac arcs. (paper)

  17. A nonlinear model for AC induced corrosion

    Directory of Open Access Journals (Sweden)

    N. Ida

    2012-09-01

    Full Text Available The modeling of corrosion poses particular difficulties. The understanding of corrosion as an electrochemical process has led to simple capacitive-resistive models that take into account the resistance of the electrolytic cell and the capacitive effect of the surface potential at the interface between conductors and the electrolyte. In some models nonlinear conduction effects have been added to account for more complex observed behavior. While these models are sufficient to describe the behavior in systems with cathodic protection, the behavior in the presence of induced AC currents from power lines and from RF sources cannot be accounted for and are insufficient to describe the effects observed in the field. Field observations have shown that a rectifying effect exists that affects the cathodic protection potential and this effect is responsible for corrosion in the presence of AC currents. The rectifying effects of the metal-corrosion interface are totally missing from current models. This work proposes a nonlinear model based on finite element analysis that takes into account the nonlinear behavior of the metal-oxide interface and promises to improve modeling by including the rectification effects at the interface.

  18. BioCluster: Tool for Identification and Clustering of Enterobacteriaceae Based on Biochemical Data

    Directory of Open Access Journals (Sweden)

    Ahmed Abdullah

    2015-06-01

    Full Text Available Presumptive identification of different Enterobacteriaceae species is routinely achieved based on biochemical properties. Traditional practice includes manual comparison of each biochemical property of the unknown sample with known reference samples and inference of its identity based on the maximum similarity pattern with the known samples. This process is labor-intensive, time-consuming, error-prone, and subjective. Therefore, automation of sorting and similarity in calculation would be advantageous. Here we present a MATLAB-based graphical user interface (GUI tool named BioCluster. This tool was designed for automated clustering and identification of Enterobacteriaceae based on biochemical test results. In this tool, we used two types of algorithms, i.e., traditional hierarchical clustering (HC and the Improved Hierarchical Clustering (IHC, a modified algorithm that was developed specifically for the clustering and identification of Enterobacteriaceae species. IHC takes into account the variability in result of 1–47 biochemical tests within this Enterobacteriaceae family. This tool also provides different options to optimize the clustering in a user-friendly way. Using computer-generated synthetic data and some real data, we have demonstrated that BioCluster has high accuracy in clustering and identifying enterobacterial species based on biochemical test data. This tool can be freely downloaded at http://microbialgen.du.ac.bd/biocluster/.

  19. The Most Massive Star Clusters: Supermassive Globular Clusters or Dwarf Galaxy Nuclei?

    Science.gov (United States)

    Harris, William

    2004-07-01

    Evidence is mounting that the most massive globular clusters, such as Omega Centauri and M31-G1, may be related to the recently discovered "Ultra-Compact Dwarfs" and the dense nuclei of dE, N galaxies. However, no systematic imaging investigation of these supermassive globular clusters - at the level of Omega Cen and beyond - has been done, and we do not know what fraction of them might bear the signatures {such as large effective radii or tidal tails} of having originated as dE nuclei. We propose to use the ACS/WFC to obtain deep images of 18 such clusters in NGC 5128 and M31, the two nearest rich globular cluster systems. These globulars are the richest star clusters that can be found in nature, the biggest of them reaching 10^7 Solar masses, and they are likely to represent the results of star formation under the densest and most extreme conditions known. Using the profiles of the clusters including their faint outer envelopes, we will carry out state-of-the-art dynamical modelling of their structures, and look for any clear evidence which would indicate that they are associated with stripped satellites. This study will build on our previous work with STIS and WFPC2 imaging designed to study the 'Fundamental Plane' of globular clusters. When our new work is combined with Archival WFPC2, STIS, and ACS material, we will also be able to construct the definitive mapping of the Fundamental Plane of globular clusters at its uppermost mass range, and confirm whether or not the UCD and dE, N objects occupy a different structural parameter space.

  20. Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious

    International Nuclear Information System (INIS)

    Fang Minggang; Nie, Yingchao; Theilmann, David A.

    2009-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.

  1. Modeling and reliability analysis of three phase z-source AC-AC converter

    Directory of Open Access Journals (Sweden)

    Prasad Hanuman

    2017-12-01

    Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

  2. Cluster headache

    Directory of Open Access Journals (Sweden)

    Ducros Anne

    2008-07-01

    Full Text Available Abstract Cluster headache (CH is a primary headache disease characterized by recurrent short-lasting attacks (15 to 180 minutes of excruciating unilateral periorbital pain accompanied by ipsilateral autonomic signs (lacrimation, nasal congestion, ptosis, miosis, lid edema, redness of the eye. It affects young adults, predominantly males. Prevalence is estimated at 0.5–1.0/1,000. CH has a circannual and circadian periodicity, attacks being clustered (hence the name in bouts that can occur during specific months of the year. Alcohol is the only dietary trigger of CH, strong odors (mainly solvents and cigarette smoke and napping may also trigger CH attacks. During bouts, attacks may happen at precise hours, especially during the night. During the attacks, patients tend to be restless. CH may be episodic or chronic, depending on the presence of remission periods. CH is associated with trigeminovascular activation and neuroendocrine and vegetative disturbances, however, the precise cautive mechanisms remain unknown. Involvement of the hypothalamus (a structure regulating endocrine function and sleep-wake rhythms has been confirmed, explaining, at least in part, the cyclic aspects of CH. The disease is familial in about 10% of cases. Genetic factors play a role in CH susceptibility, and a causative role has been suggested for the hypocretin receptor gene. Diagnosis is clinical. Differential diagnoses include other primary headache diseases such as migraine, paroxysmal hemicrania and SUNCT syndrome. At present, there is no curative treatment. There are efficient treatments to shorten the painful attacks (acute treatments and to reduce the number of daily attacks (prophylactic treatments. Acute treatment is based on subcutaneous administration of sumatriptan and high-flow oxygen. Verapamil, lithium, methysergide, prednisone, greater occipital nerve blocks and topiramate may be used for prophylaxis. In refractory cases, deep-brain stimulation of the

  3. Brightest Cluster Galaxies in REXCESS Clusters

    Science.gov (United States)

    Haarsma, Deborah B.; Leisman, L.; Bruch, S.; Donahue, M.

    2009-01-01

    Most galaxy clusters contain a Brightest Cluster Galaxy (BCG) which is larger than the other cluster ellipticals and has a more extended profile. In the hierarchical model, the BCG forms through many galaxy mergers in the crowded center of the cluster, and thus its properties give insight into the assembly of the cluster as a whole. In this project, we are working with the Representative XMM-Newton Cluster Structure Survey (REXCESS) team (Boehringer et al 2007) to study BCGs in 33 X-ray luminous galaxy clusters, 0.055 < z < 0.183. We are imaging the BCGs in R band at the Southern Observatory for Astrophysical Research (SOAR) in Chile. In this poster, we discuss our methods and give preliminary measurements of the BCG magnitudes, morphology, and stellar mass. We compare these BCG properties with the properties of their host clusters, particularly of the X-ray emitting gas.

  4. AC losses in high Tc superconductors

    International Nuclear Information System (INIS)

    Campbell, A.M.

    1998-01-01

    Full text: Although in principle the AC losses in high Tc superconductors can be calculated from the critical current density, a number of complications make this difficult. The Jc is very field dependent, there are intergranular and intragranular critical currents, the material is anisotropic and there is usually a large demagnetising factor. Care must be taken in interpreting electrical measurements since the voltage depends on the position of the contacts. In spite of these complications the simple theory of Norris has proved surprisingly successful and arguments will be presented as to why this is the case. Results on a range of tapes will be compared with theory and numerical methods for predicting losses discussed. Finally a theory for coupling losses will be given for a composite conductor with high resistance barriers round the filaments

  5. Transcranial alternating current stimulation (tACS

    Directory of Open Access Journals (Sweden)

    Andrea eAntal

    2013-06-01

    Full Text Available Transcranial alternating current stimulation (tACS seems likely to open a new era of the field of noninvasive electrical stimulation of the human brain by directly interfering with cortical rhythms. It is expected to synchronize (by one single resonance frequency or desynchronize (e.g. by the application of several frequencies cortical oscillations. If applied long enough it may cause neuroplastic effects. In the theta range it may improve cognition when applied in phase. Alpha rhythms could improve motor performance, whereas beta intrusion may deteriorate them. TACS with both alpha and beta frequencies has a high likelihood to induce retinal phosphenes. Gamma intrusion can possibly interfere with attention. Stimulation in the ripple range induces intensity dependent inhibition or excitation in the motor cortex most likely by entrainment of neuronal networks, whereas stimulation in the low kHz range induces excitation by neuronal membrane interference. TACS in the 200 kHz range may have a potential in oncology.

  6. Ac loss measurement of SSC dipole magnets

    International Nuclear Information System (INIS)

    Delchamps, S.; Hanft, R.; Jaffery, T.; Kinney, W.; Koska, W.; Lamm, M.J.; Mazur, P.O.; Orris, D.; Ozelis, J.P.; Strait, J.; Wake, M.

    1992-09-01

    AC losses in full length and 1.5 m model SSC collider dipoles were successfully measured by the direct observation of energy flow into and out of magnets during a ramp cycle. The measurement was performed by using two double-integrating type digital volt meters (DVM's) for current and voltage measurement. Measurements were performed for six is m long ASST magnets and five 1.5 m long model magnets, inducting one 40 mm diameter magnet. There were large variations in the eddy current losses. Since these magnets use conductors with slight deviations in their internal structures and processing of the copper surface depending on the manufacturer, it is likely that there are differences in the contact resistance between strands. Correlation between the ramp rate dependence of the,quench current and the eddy current loss was evident

  7. Partitional clustering algorithms

    CERN Document Server

    2015-01-01

    This book summarizes the state-of-the-art in partitional clustering. Clustering, the unsupervised classification of patterns into groups, is one of the most important tasks in exploratory data analysis. Primary goals of clustering include gaining insight into, classifying, and compressing data. Clustering has a long and rich history that spans a variety of scientific disciplines including anthropology, biology, medicine, psychology, statistics, mathematics, engineering, and computer science. As a result, numerous clustering algorithms have been proposed since the early 1950s. Among these algorithms, partitional (nonhierarchical) ones have found many applications, especially in engineering and computer science. This book provides coverage of consensus clustering, constrained clustering, large scale and/or high dimensional clustering, cluster validity, cluster visualization, and applications of clustering. Examines clustering as it applies to large and/or high-dimensional data sets commonly encountered in reali...

  8. Ac irreversibility line of bismuth-based high temperature superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)

    1997-09-01

    We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}

  9. Ac irreversibility line of bismuth-based high temperature superconductors

    International Nuclear Information System (INIS)

    Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.

    1997-01-01

    We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society

  10. AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile

    Science.gov (United States)

    El-Nahass, M. M.; Ali, H. A. M.

    2012-06-01

    AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.

  11. Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

    Directory of Open Access Journals (Sweden)

    Evi Ploumpidou

    2017-12-01

    Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

  12. Magnetic irreversibility in granular superconductors: ac susceptibility study

    International Nuclear Information System (INIS)

    Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.

    1991-01-01

    Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)

  13. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  14. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  15. AC susceptibility as a tool to probe the dipolar interaction in magnetic nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Landi, Gabriel T., E-mail: gtlandi@gmail.com [Universidade Federal do ABC, 09210-580 Santo André (Brazil); Arantes, Fabiana R. [Universidade Federal do ABC, 09210-580 Santo André (Brazil); Cornejo, Daniel R. [Instituto de Física da Universidade de São Paulo, São Paulo 05508-090 (Brazil); Bakuzis, Andris F. [Instituto de Física, Universidade Federal de Goiás, 74690-900 Goiânia-GO (Brazil); Andreu, Irene; Natividad, Eva [Instituto de Ciencia de Materiales de Aragón (ICMA), CSIC-Universidad de Zaragoza, Zaragoza 50018 (Spain)

    2017-01-01

    The dipolar interaction is known to substantially affect the properties of magnetic nanoparticles. This is particularly important when the particles are kept in a fluid suspension or packed within nano-carriers. In addition to its usual long-range nature, in these cases the dipolar interaction may also induce the formation of clusters of particles, thereby strongly modifying their magnetic anisotropies. In this paper we show how AC susceptibility may be used to obtain information regarding the influence of the dipolar interaction in a sample. We develop a model which includes both aspects of the dipolar interaction and may be fitted directly to the susceptibility data. The usual long-range nature of the interaction is implemented using a mean-field approximation, whereas the particle-particle aggregation is modeled using a distribution of anisotropy constants. The model is then applied to two samples studied at different concentrations. One consists of spherical magnetite nanoparticles dispersed in oil and the other of cubic magnetite nanoparticles embedded on polymeric nanospheres. We also introduce a simple technique to address the presence of the dipolar interaction in a given sample, based on the height of the AC susceptibility peaks for different driving frequencies. - Highlights: We discuss the importance of the dipolar interaction in magnetic nanoparticle samples. It is shown that AC susceptibility may be used to estimate the extent of this interaction. We develop a model that accounts for particle aggregation. The theoretical model is then fitted to distinct magnetite samples.

  16. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    DEFF Research Database (Denmark)

    Qin, Zian

    . The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...

  17. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  18. Diversity among galaxy clusters

    International Nuclear Information System (INIS)

    Struble, M.F.; Rood, H.J.

    1988-01-01

    The classification of galaxy clusters is discussed. Consideration is given to the classification scheme of Abell (1950's), Zwicky (1950's), Morgan, Matthews, and Schmidt (1964), and Morgan-Bautz (1970). Galaxies can be classified based on morphology, chemical composition, spatial distribution, and motion. The correlation between a galaxy's environment and morphology is examined. The classification scheme of Rood-Sastry (1971), which is based on clusters's morphology and galaxy population, is described. The six types of clusters they define include: (1) a cD-cluster dominated by a single large galaxy, (2) a cluster dominated by a binary, (3) a core-halo cluster, (4) a cluster dominated by several bright galaxies, (5) a cluster appearing flattened, and (6) an irregularly shaped cluster. Attention is also given to the evolution of cluster structures, which is related to initial density and cluster motion

  19. Ruling out dark matter interpretation of the galactic GeV excess by gamma-ray data of galaxy clusters.

    Science.gov (United States)

    Chan, Man Ho; Leung, Chung Hei

    2017-11-02

    Recently, some very tight constraints of annihilating dark matter have been obtained from gamma-ray data of the Milky Way and Milky Way dwarf spheroidal satellite galaxies. In this article, we report that there are two excellent galaxy clusters (A2877 and Fornax) which can provide interesting constraints for annihilating dark matter. The lower limits of the dark matter mass for the thermal relic annihilation cross section are 25 GeV, 6 GeV, 130 GeV and 100 GeV respectively for the e + e - , μ + μ - , τ + τ - and [Formula: see text] channels. For some configuration of our working assumptions, our results improve the Fermi-LAT upper limits of annihilation cross sections by a factor of 1.3 - 1.8 for wide ranges of dark matter mass for e + e - , μ + μ - and [Formula: see text] channels, and a factor of 1.2-1.8 for τ + τ - channel with dark matter mass ≤100 GeV. These limits basically rule out most of the existing popular dark matter interpretation of the GeV excess in the Milky Way.

  20. Power flow control of intertied ac microgrids

    DEFF Research Database (Denmark)

    Nutkani, Inam Ullah; Loh, Poh Chiang; Blaabjerg, Frede

    2013-01-01

    Microgrids are small reliable grids formed by clustering distributed sources and loads together. They can, in principle, operate at different voltages and frequencies like 50, 60, 400 Hz or even dc. Tying them together or to the mains grid for energy sharing would therefore require the insertion...... of interlinking power converters. Active and reactive power flows of these converters should preferably be managed autonomously without demanding for fast communication links. A scheme that can fulfill the objectives is now proposed, which upon realised, will result in more robustly integrated microgrids...

  1. What Makes Clusters Decline?

    DEFF Research Database (Denmark)

    Østergaard, Christian Richter; Park, Eun Kyung

    2015-01-01

    Most studies on regional clusters focus on identifying factors and processes that make clusters grow. However, sometimes technologies and market conditions suddenly shift, and clusters decline. This paper analyses the process of decline of the wireless communication cluster in Denmark. The longit...... but being quick to withdraw in times of crisis....

  2. Clustering of correlated networks

    OpenAIRE

    Dorogovtsev, S. N.

    2003-01-01

    We obtain the clustering coefficient, the degree-dependent local clustering, and the mean clustering of networks with arbitrary correlations between the degrees of the nearest-neighbor vertices. The resulting formulas allow one to determine the nature of the clustering of a network.

  3. Ac and dc motor flooding times

    International Nuclear Information System (INIS)

    Crowley, D.A.; Hinton, J.H.

    1988-01-01

    Reactor safety studies, such as the emergency cooling system (ECS) limits analyses and the probabilistic risk assessment, require that the flood-out times be calculated for the ac and dc motors at the -40 foot level. New calculations are needed because dams of an improved design have been installed between the pump room and motor room, and because updated leak rate calculations have shown that the maximum possible leak rate is larger than that which had been previously calculated. The methodology for calculating the motor flood-out times has also been improved. A computer program has been written to calculate flood-out times for various leak rates and sump pump operabilities. For ECS limits analyses, the worst case dc motor flood-out times are 161 and 297 seconds in LKC and P-areas, respectively. These times are for a 135,468 gpm leak that first flows to the motor room and all of the sump pumps are off

  4. Improving Power Quality in AC Supply Grids

    Directory of Open Access Journals (Sweden)

    Piotr Fabijański

    2015-12-01

    Full Text Available This paper describes a digital and actual model of the UPQC (Unified Power Quality Conditioner integrated system for power quality improvement. The UPQC’s design and its connection to an AC supply grid, 1-phase and 3-phase alike, provide effective compensation of unwanted interferences in the waveforms of load supply voltages and non-linear load currents. This article presents an overview of topologies and control strategies. The study of the UPQC confirmed its positive impact on the power quality. The electricity parameters were significantly improved. Total harmonic distortion in supply voltage THDu decreased six-fold to 1.89%, and total harmonic distortion in load current THDi decreased more than ten-fold to 2.38% for a non-linear load (uncontrolled bridge rectifier with load L. Additionally, symmetrisation of supply voltages and reactive power compensation Q of linear load was obtained. The UPQC integrated system for power quality improvement can be used wherever high-quality and PN-EN 50160 standard – compliant electricity is required.

  5. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  6. Cosmic Shear With ACS Pure Parallels

    Science.gov (United States)

    Rhodes, Jason

    2002-07-01

    Small distortions in the shapes of background galaxies by foreground mass provide a powerful method of directly measuring the amount and distribution of dark matter. Several groups have recently detected this weak lensing by large-scale structure, also called cosmic shear. The high resolution and sensitivity of HST/ACS provide a unique opportunity to measure cosmic shear accurately on small scales. Using 260 parallel orbits in Sloan textiti {F775W} we will measure for the first time: beginlistosetlength sep0cm setlengthemsep0cm setlengthopsep0cm em the cosmic shear variance on scales Omega_m^0.5, with signal-to-noise {s/n} 20, and the mass density Omega_m with s/n=4. They will be done at small angular scales where non-linear effects dominate the power spectrum, providing a test of the gravitational instability paradigm for structure formation. Measurements on these scales are not possible from the ground, because of the systematic effects induced by PSF smearing from seeing. Having many independent lines of sight reduces the uncertainty due to cosmic variance, making parallel observations ideal.

  7. Relevant Subspace Clustering

    DEFF Research Database (Denmark)

    Müller, Emmanuel; Assent, Ira; Günnemann, Stephan

    2009-01-01

    Subspace clustering aims at detecting clusters in any subspace projection of a high dimensional space. As the number of possible subspace projections is exponential in the number of dimensions, the result is often tremendously large. Recent approaches fail to reduce results to relevant subspace...... clusters. Their results are typically highly redundant, i.e. many clusters are detected multiple times in several projections. In this work, we propose a novel model for relevant subspace clustering (RESCU). We present a global optimization which detects the most interesting non-redundant subspace clusters...... achieves top clustering quality while competing approaches show greatly varying performance....

  8. Introduction of hvdc transmission into a predominantly ac network

    Energy Technology Data Exchange (ETDEWEB)

    Casson, W; Last, F H; Huddart, K W

    1966-02-01

    Methods for reinforcing the supply network, including systems employing dc links, without introducing a new primary network are briefly described. The arrangement for dc links is outlined and the application to an existing ac system is considered. The economics of ac and dc for reinforcement schemes are briefly mentioned.

  9. Low ac loss geometries in YBCO coated conductors

    International Nuclear Information System (INIS)

    Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

    2007-01-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

  10. Low ac loss geometries in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

    2007-10-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

  11. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  12. Ammonia treated Mo/AC catalysts for CO hydrogenation with ...

    Indian Academy of Sciences (India)

    SHARIF F ZAMAN

    the influence of acid treated AC as a support with K-Ni-. Mo active ... K-Ni-Mo/AC catalyst was more selective to oxygenates. (>40% ... mineral impurities (K, Si, Sn and Fe) <1%. ...... edge technical support with thanks Science and Technology.

  13. ELECTRONIC SYSTEM FOR EXPERIMENTATION IN AC ELECTROGRAVIMETRY I: TECHNIQUE FUNDAMENTALS

    Directory of Open Access Journals (Sweden)

    Róbinson Torres

    Full Text Available Basic fundamentals of AC electrogravimetry are introduced. Their main requirements and characteristics are detailed to establish the design of an electronic system that allows the appropriate extraction of data needed to determine the electrogravimetric transfer function (EGTF and electrochemical impedance (EI, in an experimental set-up for the AC electrogravimetry technique.

  14. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  15. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...

  16. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...

  17. Effect of temperature on the AC impedance of protein

    Indian Academy of Sciences (India)

    The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...

  18. Effect of temperature on the AC impedance of protein and ...

    Indian Academy of Sciences (India)

    2016-08-26

    Aug 26, 2016 ... The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model ...

  19. Globular Cluster Formation at High Density: A Model for Elemental Enrichment with Fast Recycling of Massive-star Debris

    Energy Technology Data Exchange (ETDEWEB)

    Elmegreen, Bruce G., E-mail: bge@us.ibm.com [IBM Research Division, T.J. Watson Research Center, 1101 Kitchawan Road, Yorktown Heights, NY 10598 (United States)

    2017-02-10

    The self-enrichment of massive star clusters by p -processed elements is shown to increase significantly with increasing gas density as a result of enhanced star formation rates and stellar scatterings compared to the lifetime of a massive star. Considering the type of cloud core where a globular cluster (GC) might have formed, we follow the evolution and enrichment of the gas and the time dependence of stellar mass. A key assumption is that interactions between massive stars are important at high density, including interactions between massive stars and massive-star binaries that can shred stellar envelopes. Massive-star interactions should also scatter low-mass stars out of the cluster. Reasonable agreement with the observations is obtained for a cloud-core mass of ∼4 × 10{sup 6} M {sub ⊙} and a density of ∼2 × 10{sup 6} cm{sup −3}. The results depend primarily on a few dimensionless parameters, including, most importantly, the ratio of the gas consumption time to the lifetime of a massive star, which has to be low, ∼10%, and the efficiency of scattering low-mass stars per unit dynamical time, which has to be relatively large, such as a few percent. Also for these conditions, the velocity dispersions of embedded GCs should be comparable to the high gas dispersions of galaxies at that time, so that stellar ejection by multistar interactions could cause low-mass stars to leave a dwarf galaxy host altogether. This could solve the problem of missing first-generation stars in the halos of Fornax and WLM.

  20. Levitação acústica

    OpenAIRE

    Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar

    2015-01-01

    A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...

  1. Characterisation of AC1: a naturally decaffeinated coffee

    Directory of Open Access Journals (Sweden)

    Luciana Benjamim Benatti

    2012-01-01

    Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

  2. Estimation of the Thurstonian model for the 2-AC protocol

    DEFF Research Database (Denmark)

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    . This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative......The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model...

  3. Successful enrichment of the ubiquitous freshwater acI Actinobacteria.

    Science.gov (United States)

    Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk

    2014-02-01

    Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.

  4. Cluster ion beam facilities

    International Nuclear Information System (INIS)

    Popok, V.N.; Prasalovich, S.V.; Odzhaev, V.B.; Campbell, E.E.B.

    2001-01-01

    A brief state-of-the-art review in the field of cluster-surface interactions is presented. Ionised cluster beams could become a powerful and versatile tool for the modification and processing of surfaces as an alternative to ion implantation and ion assisted deposition. The main effects of cluster-surface collisions and possible applications of cluster ion beams are discussed. The outlooks of the Cluster Implantation and Deposition Apparatus (CIDA) being developed in Guteborg University are shown

  5. PREFACE: Nuclear Cluster Conference; Cluster'07

    Science.gov (United States)

    Freer, Martin

    2008-05-01

    The Cluster Conference is a long-running conference series dating back to the 1960's, the first being initiated by Wildermuth in Bochum, Germany, in 1969. The most recent meeting was held in Nara, Japan, in 2003, and in 2007 the 9th Cluster Conference was held in Stratford-upon-Avon, UK. As the name suggests the town of Stratford lies upon the River Avon, and shortly before the conference, due to unprecedented rainfall in the area (approximately 10 cm within half a day), lay in the River Avon! Stratford is the birthplace of the `Bard of Avon' William Shakespeare, and this formed an intriguing conference backdrop. The meeting was attended by some 90 delegates and the programme contained 65 70 oral presentations, and was opened by a historical perspective presented by Professor Brink (Oxford) and closed by Professor Horiuchi (RCNP) with an overview of the conference and future perspectives. In between, the conference covered aspects of clustering in exotic nuclei (both neutron and proton-rich), molecular structures in which valence neutrons are exchanged between cluster cores, condensates in nuclei, neutron-clusters, superheavy nuclei, clusters in nuclear astrophysical processes and exotic cluster decays such as 2p and ternary cluster decay. The field of nuclear clustering has become strongly influenced by the physics of radioactive beam facilities (reflected in the programme), and by the excitement that clustering may have an important impact on the structure of nuclei at the neutron drip-line. It was clear that since Nara the field had progressed substantially and that new themes had emerged and others had crystallized. Two particular topics resonated strongly condensates and nuclear molecules. These topics are thus likely to be central in the next cluster conference which will be held in 2011 in the Hungarian city of Debrechen. Martin Freer Participants and Cluster'07

  6. Properties of liquid clusters in large-scale molecular dynamics nucleation simulations

    International Nuclear Information System (INIS)

    Angélil, Raymond; Diemand, Jürg; Tanaka, Kyoko K.; Tanaka, Hidekazu

    2014-01-01

    We have performed large-scale Lennard-Jones molecular dynamics simulations of homogeneous vapor-to-liquid nucleation, with 10 9 atoms. This large number allows us to resolve extremely low nucleation rates, and also provides excellent statistics for cluster properties over a wide range of cluster sizes. The nucleation rates, cluster growth rates, and size distributions are presented in Diemand et al. [J. Chem. Phys. 139, 74309 (2013)], while this paper analyses the properties of the clusters. We explore the cluster temperatures, density profiles, potential energies, and shapes. A thorough understanding of the properties of the clusters is crucial to the formulation of nucleation models. Significant latent heat is retained by stable clusters, by as much as ΔkT = 0.1ε for clusters with size i = 100. We find that the clusters deviate remarkably from spherical—with ellipsoidal axis ratios for critical cluster sizes typically within b/c = 0.7 ± 0.05 and a/c = 0.5 ± 0.05. We examine cluster spin angular momentum, and find that it plays a negligible role in the cluster dynamics. The interfaces of large, stable clusters are thinner than planar equilibrium interfaces by 10%−30%. At the critical cluster size, the cluster central densities are between 5% and 30% lower than the bulk liquid expectations. These lower densities imply larger-than-expected surface areas, which increase the energy cost to form a surface, which lowers nucleation rates

  7. Management of cluster headache

    DEFF Research Database (Denmark)

    Tfelt-Hansen, Peer C; Jensen, Rigmor H

    2012-01-01

    The prevalence of cluster headache is 0.1% and cluster headache is often not diagnosed or misdiagnosed as migraine or sinusitis. In cluster headache there is often a considerable diagnostic delay - an average of 7 years in a population-based survey. Cluster headache is characterized by very severe...... or severe orbital or periorbital pain with a duration of 15-180 minutes. The cluster headache attacks are accompanied by characteristic associated unilateral symptoms such as tearing, nasal congestion and/or rhinorrhoea, eyelid oedema, miosis and/or ptosis. In addition, there is a sense of restlessness...... and agitation. Patients may have up to eight attacks per day. Episodic cluster headache (ECH) occurs in clusters of weeks to months duration, whereas chronic cluster headache (CCH) attacks occur for more than 1 year without remissions. Management of cluster headache is divided into acute attack treatment...

  8. Symmetries of cluster configurations

    International Nuclear Information System (INIS)

    Kramer, P.

    1975-01-01

    A deeper understanding of clustering phenomena in nuclei must encompass at least two interrelated aspects of the subject: (A) Given a system of A nucleons with two-body interactions, what are the relevant and persistent modes of clustering involved. What is the nature of the correlated nucleon groups which form the clusters, and what is their mutual interaction. (B) Given the cluster modes and their interaction, what systematic patterns of nuclear structure and reactions emerge from it. Are there, for example, families of states which share the same ''cluster parents''. Which cluster modes are compatible or exclude each other. What quantum numbers could characterize cluster configurations. There is no doubt that we can learn a good deal from the experimentalists who have discovered many of the features relevant to aspect (B). Symmetries specific to cluster configurations which can throw some light on both aspects of clustering are discussed

  9. Estimating BrAC from transdermal alcohol concentration data using the BrAC estimator software program.

    Science.gov (United States)

    Luczak, Susan E; Rosen, I Gary

    2014-08-01

    Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.

  10. Evolution of ferromagnetic interactions from cluster spin glass state in Co–Ga alloy

    Energy Technology Data Exchange (ETDEWEB)

    Mohammad Yasin, Sk. [Department of Physics, Indian Institute of Technology Madras, Chennai 600036 (India); Saha, Ritwik [Department of Condensed Matter Physics and Materials Science, Tata Institute of Fundamental Research, Mumbai 400005 (India); Srinivas, V., E-mail: veeturi@iitm.ac.in [Department of Physics, Indian Institute of Technology Madras, Chennai 600036 (India); Kasiviswanathan, S. [Department of Physics, Indian Institute of Technology Madras, Chennai 600036 (India); Nigam, A.K. [Department of Condensed Matter Physics and Materials Science, Tata Institute of Fundamental Research, Mumbai 400005 (India)

    2016-11-15

    Low temperature magnetic properties of binary Co{sub x}Ga{sub 100−x} (x=54–57) alloy have been investigated. Analysis of frequency dependence of ac susceptibility provided a conclusive evidence for the existence of cluster spin glass like behavior with the freezing temperature ~8, 14 K for x=54, 55.5 respectively. The parameters for conventional ‘slowing down’ of the spin dynamics have been extracted from the acs data, which confirm the presence of glassy phase. The magnitude of Mydosh parameter obtained from the fits is larger than that reported for typical canonical spin glasses and smaller than those for non-interacting ideal superparamagnetic systems but comparable to those of known cluster-glass systems. Memory phenomena using specific cooling protocols also support the spin-glass features in Co{sub 55.5}Ga{sub 44.5} composition. Further the development of ferromagnetic clusters from the cluster spin glass state has been observed in x=57 composition. - Highlights: • Temperature dependence of DC and AC susceptibility (acs) analysis has been carried out on Co{sub x}Ga{sub 1−x,} (x=54–57). • M–H data above transition suggests presence of spin clusters. • A detailed analysis of acs data suggests a cluster glass behavior as oppose to SPM state for x=54 and 55.5. • Memory phenomena using specific cooling protocols also support the spin-glass features in Co{sub 55.5}Ga{sub 44.5} composition. • Development of ferromagnetic like behavior for x≥57 has been suggested from DC and AC magnetization data.

  11. Cluster Decline and Resilience

    DEFF Research Database (Denmark)

    Østergaard, Christian Richter; Park, Eun Kyung

    Most studies on regional clusters focus on identifying factors and processes that make clusters grow. However, sometimes technologies and market conditions suddenly shift, and clusters decline. This paper analyses the process of decline of the wireless communication cluster in Denmark, 1963......-2011. Our longitudinal study reveals that technological lock-in and exit of key firms have contributed to impairment of the cluster’s resilience in adapting to disruptions. Entrepreneurship has a positive effect on cluster resilience, while multinational companies have contradicting effects by bringing...... in new resources to the cluster but being quick to withdraw in times of crisis....

  12. dc Arc Fault Effect on Hybrid ac/dc Microgrid

    Science.gov (United States)

    Fatima, Zahra

    The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.

  13. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Directory of Open Access Journals (Sweden)

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  14. Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte

    International Nuclear Information System (INIS)

    García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.

    2016-01-01

    The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.

  15. Comprehensive cluster analysis with Transitivity Clustering.

    Science.gov (United States)

    Wittkop, Tobias; Emig, Dorothea; Truss, Anke; Albrecht, Mario; Böcker, Sebastian; Baumbach, Jan

    2011-03-01

    Transitivity Clustering is a method for the partitioning of biological data into groups of similar objects, such as genes, for instance. It provides integrated access to various functions addressing each step of a typical cluster analysis. To facilitate this, Transitivity Clustering is accessible online and offers three user-friendly interfaces: a powerful stand-alone version, a web interface, and a collection of Cytoscape plug-ins. In this paper, we describe three major workflows: (i) protein (super)family detection with Cytoscape, (ii) protein homology detection with incomplete gold standards and (iii) clustering of gene expression data. This protocol guides the user through the most important features of Transitivity Clustering and takes ∼1 h to complete.

  16. DC and AC biasing of a transition edge sensor microcalorimeter

    International Nuclear Information System (INIS)

    Cunningham, M.F.; Ullom, J.N.; Miyazaki, T.; Drury, O.; Loshak, A.; Berg, M.L. van den; Labov, S.E.

    2002-01-01

    We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

  17. Systémový pohled na klub AC Sparta

    OpenAIRE

    Čečák, František

    2015-01-01

    Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...

  18. Systémový pohled na klub AC Sparta

    OpenAIRE

    Čečák, František

    2014-01-01

    Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...

  19. Analysis of Input and Output Ripples of PWM AC Choppers

    Directory of Open Access Journals (Sweden)

    Pekik Argo Dahono

    2008-11-01

    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  20. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  1. The Open Cluster NGC 6811: An Eclipsing Binary, the Turnoff, and Age

    DEFF Research Database (Denmark)

    Sandquist, Eric L.; Jessen-Hansen, Jens; Shetrone, Matthew D.

    . The cluster's turnoff also falls completely within the instability strip, and the majority of the brightest main sequence stars have now been identified as δ Scuti pulsators. The eclipsing binary KIC 9777062/Sanders 195 is a cluster member slightly fainter than the turnoff, containing one star that falls...... stars to produce an improved age determination.We gratefully acknowledge support from the NSF to E.L.S. under grant AST-0908536 and for M.L. as part of the REU program at San Diego State University under grant AST-0850564, and from NASA under grants NNX12AC88G and NNX13AC19G....

  2. A microgrid cluster structure and its autonomous coordination control strategy

    DEFF Research Database (Denmark)

    Zhou, Xiaoping; Zhou, Leming; Chen, Yandong

    2018-01-01

    This paper proposes a microgrid cluster structure and its autonomous coordination control strategy. Unlike existing microgrids that are purely AC or DC, the microgrid cluster studied here is an interconnected system with multiple AC and DC microgrids, which enables mutual power support among...... control method combining the normalized droop-based control and adaptive control is proposed for PEU, which can effectively realize mutual power support among microgrids and reduce the bus voltage or frequency deviation in microgrids. In addition, the adaptive control strategy of PEU can ensure...... that the bigger the normalized index of microgrid is, the larger the active power exchange coefficient is, which can make all of microgrids operate around the rated state as much as possible. Besides, EP is mainly used to balance the system power, and the hierarchical coordinated control method of EP is proposed...

  3. HST/ACS IMAGING OF OMEGA CENTAURI: OPTICAL COUNTERPARTS OF CHANDRA X-RAY SOURCES

    International Nuclear Information System (INIS)

    Cool, Adrienne M.; Arias, Tersi; Brochmann, Michelle; Dorfman, Jason; Gafford, April; White, Vivian; Haggard, Daryl; Anderson, Jay

    2013-01-01

    We present results of a search for optical counterparts of X-ray sources in and toward the globular cluster Omega Centauri (NGC 5139) using the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope. The ACS data consist of a mosaic of Wide Field Channel images obtained using F625W, F435W, and F658N filters; with nine pointings we cover the central ∼10' × 10' of the cluster and encompass 109 known Chandra sources. We find promising optical counterparts for 59 of the sources, ∼40 of which are likely to be associated with the cluster. These include 27 candidate cataclysmic variables (CVs), 24 of which are reported here for the first time. Fourteen of the CV candidates are very faint, with absolute magnitudes in the range M 625 =10.4-12.6, making them comparable in brightness to field CVs near the period minimum discovered in the Sloan Digital Sky Survey. Additional optical counterparts include three BY Dra candidates, a possible blue straggler, and a previously reported quiescent low-mass X-ray binary. We also identify 3 foreground stars and 11 probable active galactic nuclei. Finally, we report the discovery of a group of seven stars whose X-ray properties are suggestive of magnetically active binaries, and whose optical counterparts lie on or very near the metal-rich anomalous giant and subgiant branches in ω Cen. If the apparent association between these seven stars and the RGB/SGB-a stars is real, then the frequency of X-ray sources in this metal-rich population is enhanced by a factor of at least five relative to the other giant and subgiant populations in the cluster. If these stars are not members of the metal-rich population, then they bring the total number of red stragglers (also known as sub-subgiants) that have been identified in ω to Cen 20, the largest number yet known in any globular cluster.

  4. LMC clusters: young

    International Nuclear Information System (INIS)

    Freeman, K.C.

    1980-01-01

    The young globular clusters of the LMC have ages of 10 7 -10 8 y. Their masses and structure are similar to those of the smaller galactic globular clusters. Their stellar mass functions (in the mass range 6 solar masses to 1.2 solar masses) vary greatly from cluster to cluster, although the clusters are similar in total mass, age, structure and chemical composition. It would be very interesting to know why these clusters are forming now in the LMC and not in the Galaxy. The author considers the 'young globular' or 'blue populous' clusters of the LMC. The ages of these objects are 10 7 to 10 8 y, and their masses are 10 4 to 10 5 solar masses, so they are populous enough to be really useful for studying the evolution of massive stars. The author concentrates on the structure and stellar content of these young clusters. (Auth.)

  5. Star clusters and associations

    International Nuclear Information System (INIS)

    Ruprecht, J.; Palous, J.

    1983-01-01

    All 33 papers presented at the symposium were inputted to INIS. They dealt with open clusters, globular clusters, stellar associations and moving groups, and local kinematics and galactic structures. (E.S.)

  6. Cluster beam injection

    International Nuclear Information System (INIS)

    Bottiglioni, F.; Coutant, J.; Fois, M.

    1978-01-01

    Areas of possible applications of cluster injection are discussed. The deposition inside the plasma of molecules, issued from the dissociation of the injected clusters, has been computed. Some empirical scaling laws for the penetration are given

  7. RELICS: Strong Lens Models for Five Galaxy Clusters from the Reionization Lensing Cluster Survey

    Science.gov (United States)

    Cerny, Catherine; Sharon, Keren; Andrade-Santos, Felipe; Avila, Roberto J.; Bradač, Maruša; Bradley, Larry D.; Carrasco, Daniela; Coe, Dan; Czakon, Nicole G.; Dawson, William A.; Frye, Brenda L.; Hoag, Austin; Huang, Kuang-Han; Johnson, Traci L.; Jones, Christine; Lam, Daniel; Lovisari, Lorenzo; Mainali, Ramesh; Oesch, Pascal A.; Ogaz, Sara; Past, Matthew; Paterno-Mahler, Rachel; Peterson, Avery; Riess, Adam G.; Rodney, Steven A.; Ryan, Russell E.; Salmon, Brett; Sendra-Server, Irene; Stark, Daniel P.; Strolger, Louis-Gregory; Trenti, Michele; Umetsu, Keiichi; Vulcani, Benedetta; Zitrin, Adi

    2018-06-01

    Strong gravitational lensing by galaxy clusters magnifies background galaxies, enhancing our ability to discover statistically significant samples of galaxies at {\\boldsymbol{z}}> 6, in order to constrain the high-redshift galaxy luminosity functions. Here, we present the first five lens models out of the Reionization Lensing Cluster Survey (RELICS) Hubble Treasury Program, based on new HST WFC3/IR and ACS imaging of the clusters RXC J0142.9+4438, Abell 2537, Abell 2163, RXC J2211.7–0349, and ACT-CLJ0102–49151. The derived lensing magnification is essential for estimating the intrinsic properties of high-redshift galaxy candidates, and properly accounting for the survey volume. We report on new spectroscopic redshifts of multiply imaged lensed galaxies behind these clusters, which are used as constraints, and detail our strategy to reduce systematic uncertainties due to lack of spectroscopic information. In addition, we quantify the uncertainty on the lensing magnification due to statistical and systematic errors related to the lens modeling process, and find that in all but one cluster, the magnification is constrained to better than 20% in at least 80% of the field of view, including statistical and systematic uncertainties. The five clusters presented in this paper span the range of masses and redshifts of the clusters in the RELICS program. We find that they exhibit similar strong lensing efficiencies to the clusters targeted by the Hubble Frontier Fields within the WFC3/IR field of view. Outputs of the lens models are made available to the community through the Mikulski Archive for Space Telescopes.

  8. Ferromagnetic clusters in polycrystalline BaCoO3

    International Nuclear Information System (INIS)

    Botta, P.M.; Pardo, V.; Calle, C. de la; Baldomir, D.; Alonso, J.A.; Rivas, J.

    2007-01-01

    Polycrystalline BaCoO 3 was synthesized by a citrate technique using thermal treatments at high oxygen pressure. Magnetic susceptibility measurements on the compound were carried out under AC conditions. The magnetic properties of the material at low temperatures were found to be determined by the appearance of nanoscale ferromagnetic (FM) regions and not by a true magnetic phase transition. These clusters have a mean size of about 1 nm in diameter and obey an Arrhenius-like thermal relaxation

  9. Clustering at high redshifts

    International Nuclear Information System (INIS)

    Shaver, P.A.

    1986-01-01

    Evidence for clustering of and with high-redshift QSOs is discussed. QSOs of different redshifts show no clustering, but QSOs of similar redshifts appear to be clustered on a scale comparable to that of galaxies at the present epoch. In addition, spectroscopic studies of close pairs of QSOs indicate that QSOs are surrounded by a relatively high density of absorbing matter, possibly clusters of galaxies

  10. PREVENTION AND CONTROL OF TUBERCULOSIS *A.C. Okoh ...

    African Journals Online (AJOL)

    drclement

    *A.C. Okoh. Department of Community Health, University of Teaching Hospital Benin City,. Nigeria ... tuberculosis to be a global emergency. There is an ... laboratory capacity as few laboratories are ... control: Survelliance, planning, financing.

  11. Nontrivial ac spin response in the effective Luttinger model

    International Nuclear Information System (INIS)

    Hu Liangbin; Zhong Jiansong; Hu Kaige

    2006-01-01

    Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before

  12. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan

    2015-01-01

    Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received

  13. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  14. AC/CRC adjacent lane surfacing : construction report.

    Science.gov (United States)

    1991-06-01

    Asphaltic Concrete (AC) and Portland Cement Concrete (PCC) are common roadway materials used in Oregon. In a recent construction project -- Poverty Flats/Mecham Section -- the Oregon State Highway Division (OSHD) designed, as part of the project, a "...

  15. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

    2013-01-01

    sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment.......This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...

  16. Detection of Genetic Modification 'ac2' in Potato Foodstuffs

    Directory of Open Access Journals (Sweden)

    Petr Kralik

    2009-01-01

    Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.

  17. c-axis ac susceptibility in high-Tc superconductors

    International Nuclear Information System (INIS)

    Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.

    1996-01-01

    We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society

  18. Fast electric dipole transitions in Ra-Ac nuclei

    International Nuclear Information System (INIS)

    Ahmad, I.

    1985-01-01

    Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs

  19. National Fuel Cell Bus Program : Accelerated Testing Report, AC Transit

    Science.gov (United States)

    2009-01-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 throu...

  20. A THREE-PHASE BOOST DC-AC CONVERTER

    African Journals Online (AJOL)

    dc-ac converter (inverter) based on the dc-dc boost converters. ... Sliding mode controllers are designed to perform a robust control for the ... Computer simulations and spectral analysis demon- ... the conventional three-phase buck inverter,.

  1. AC/ARNG Integrated Division Concept Study, Appendices, Volume 3

    National Research Council Canada - National Science Library

    Twohig, John

    1997-01-01

    ...) division headquarters. The US Army Training and Doctrine Command (TRADOC) was tasked to conduct a viability assessment of the AC/ARNG Integrated Division concept and focus on merits and implementation issues...

  2. EHV AC undergrounding electrical power performance and planning

    CERN Document Server

    Benato, Roberto

    2014-01-01

    Analytical methods of cable performance in EHV AC electrical power are discussed in this comprehensive reference. Descriptions of energization, power quality, cable safety constraints and more, guide readers in cable planning and power network operations.

  3. Extension to AC Loss Minimisation in High Temperature Superconductors

    National Research Council Canada - National Science Library

    Campbell, Archie

    2004-01-01

    ...: (a) Measure the AC losses of appropriate Yttrium Barium Copper Oxide (YBCO) samples with strong potential for minimizing losses at high frequencies and magnetic fields with the existing equipment. (b...

  4. Cluster Physics with Merging Galaxy Clusters

    Directory of Open Access Journals (Sweden)

    Sandor M. Molnar

    2016-02-01

    Full Text Available Collisions between galaxy clusters provide a unique opportunity to study matter in a parameter space which cannot be explored in our laboratories on Earth. In the standard LCDM model, where the total density is dominated by the cosmological constant ($Lambda$ and the matter density by cold dark matter (CDM, structure formation is hierarchical, and clusters grow mostly by merging.Mergers of two massive clusters are the most energetic events in the universe after the Big Bang,hence they provide a unique laboratory to study cluster physics.The two main mass components in clusters behave differently during collisions:the dark matter is nearly collisionless, responding only to gravity, while the gas is subject to pressure forces and dissipation, and shocks and turbulenceare developed during collisions. In the present contribution we review the different methods used to derive the physical properties of merging clusters. Different physical processes leave their signatures on different wavelengths, thusour review is based on a multifrequency analysis. In principle, the best way to analyze multifrequency observations of merging clustersis to model them using N-body/HYDRO numerical simulations. We discuss the results of such detailed analyses.New high spatial and spectral resolution ground and space based telescopeswill come online in the near future. Motivated by these new opportunities,we briefly discuss methods which will be feasible in the near future in studying merging clusters.

  5. Size selected metal clusters

    Indian Academy of Sciences (India)

    First page Back Continue Last page Overview Graphics. The Optical Absorption Spectra of Small Silver Clusters (5-11) ... Soft Landing and Fragmentation of Small Clusters Deposited in Noble-Gas Films. Harbich, W.; Fedrigo, S.; Buttet, J. Phys. Rev. B 1998, 58, 7428. CO combustion on supported gold clusters. Arenz M ...

  6. The Durban Auto Cluster

    DEFF Research Database (Denmark)

    Lorentzen, Jochen; Robbins, Glen; Barnes, Justin

    2004-01-01

    The paper describes the formation of the Durban Auto Cluster in the context of trade liberalization. It argues that the improvement of operational competitiveness of firms in the cluster is prominently due to joint action. It tests this proposition by comparing the gains from cluster activities...

  7. Marketing research cluster analysis

    Directory of Open Access Journals (Sweden)

    Marić Nebojša

    2002-01-01

    Full Text Available One area of applications of cluster analysis in marketing is identification of groups of cities and towns with similar demographic profiles. This paper considers main aspects of cluster analysis by an example of clustering 12 cities with the use of Minitab software.

  8. Marketing research cluster analysis

    OpenAIRE

    Marić Nebojša

    2002-01-01

    One area of applications of cluster analysis in marketing is identification of groups of cities and towns with similar demographic profiles. This paper considers main aspects of cluster analysis by an example of clustering 12 cities with the use of Minitab software.

  9. Minimalist's linux cluster

    International Nuclear Information System (INIS)

    Choi, Chang-Yeong; Kim, Jeong-Hyun; Kim, Seyong

    2004-01-01

    Using barebone PC components and NIC's, we construct a linux cluster which has 2-dimensional mesh structure. This cluster has smaller footprint, is less expensive, and use less power compared to conventional linux cluster. Here, we report our experience in building such a machine and discuss our current lattice project on the machine

  10. Range-clustering queries

    NARCIS (Netherlands)

    Abrahamsen, M.; de Berg, M.T.; Buchin, K.A.; Mehr, M.; Mehrabi, A.D.

    2017-01-01

    In a geometric k -clustering problem the goal is to partition a set of points in R d into k subsets such that a certain cost function of the clustering is minimized. We present data structures for orthogonal range-clustering queries on a point set S : given a query box Q and an integer k>2 , compute

  11. Cosmology with cluster surveys

    Indian Academy of Sciences (India)

    Abstract. Surveys of clusters of galaxies provide us with a powerful probe of the den- sity and nature of the dark energy. The red-shift distribution of detected clusters is highly sensitive to the dark energy equation of state parameter w. Upcoming Sunyaev–. Zel'dovich (SZ) surveys would provide us large yields of clusters to ...

  12. Spectroscopy of nuclei 215Fr and 219 Ac: a contribution to the study of the nuclear structure of light actinides

    International Nuclear Information System (INIS)

    Khazrouni, S.

    1985-06-01

    Using α-particle and γ-ray spectroscopy, it has been possible to establish the high spin pattern in 215 Fr and propose a decay scheme up to I π = (47/2 + ) containing six isomeric states. These results are interpreted using the recent version of the deformed Woods-Saxon model and the Strutinsky normalisation technique. A similar study in 219 Ac has revealed the existence of two quasi-bands each formed of states of alternating parity and connected by strong E1 transitions. This data for 219 Ac fits better with the stable octupole deformation model, mainly because of the high-spin parity doublets observed for the first time, than with the α-cluster model [fr

  13. Controlled formation of metallic nanowires via Au nanoparticle ac trapping

    International Nuclear Information System (INIS)

    Bernard, L; Calame, M; Molen, S J van der; Liao, J; Schoenenberger, C

    2007-01-01

    Applying ac voltages, we trapped gold nanoparticles between micro-fabricated electrodes under well-defined conditions. We demonstrate that the nanoparticles can be controllably fused together to form homogeneous gold nanowires with pre-defined diameters and conductance values. Whereas electromigration is known to form a gap when a dc voltage is applied, this ac technique achieves the opposite, thereby completing the toolkit for the fabrication of nanoscale junctions

  14. Controlled formation of metallic nanowires via Au nanoparticle ac trapping

    Energy Technology Data Exchange (ETDEWEB)

    Bernard, L; Calame, M; Molen, S J van der; Liao, J; Schoenenberger, C [Institute of Physics, University of Basel, CH-4056 Basel (Switzerland)

    2007-06-13

    Applying ac voltages, we trapped gold nanoparticles between micro-fabricated electrodes under well-defined conditions. We demonstrate that the nanoparticles can be controllably fused together to form homogeneous gold nanowires with pre-defined diameters and conductance values. Whereas electromigration is known to form a gap when a dc voltage is applied, this ac technique achieves the opposite, thereby completing the toolkit for the fabrication of nanoscale junctions.

  15. AC-Induced Bias Potential Effect on Corrosion of Steels

    Science.gov (United States)

    2009-02-05

    induction, variable conduction Experimental Setup Super- martensitic stainless steel composition Analysis: C Mn Si Cr Ni Mo Cu N Typical 13 Cr ɘ.01 0.6... stainless steel used in pipelines. •Low carbon (ɘ.01): allows the formation of a “soft” martensite that is more resistant than standard martensitic ...Proposed AC Corrosion Models  AC Simulated Corrosion testing  Stainless steel pipe and coating  Cathodic protection  Experimental Setup  Preliminary

  16. Antifriction coatings based on a-C for biomedicine applications

    International Nuclear Information System (INIS)

    Yurjev, Y N; Kiseleva, D V; Zaitcev, D A; Sidelev, D V; Korneva, O S

    2016-01-01

    This article reports on the investigation of mechanical properties of carbon films deposited by dual magnetron sputtering system with closed and mirror magnetic field. There is shown that a-C films with predominantly sp 2 -phase have relatively high hardness (up to 20 GPa) and low friction index (∼0.01). The influence of magnetic field on friction index is determined. The analysis of experimental data shows the obtained a-C samples can be used for biomedicine applications. (paper)

  17. AC Calorimetric Design for Dynamic of Biological Materials

    OpenAIRE

    Shigeo Imaizumi

    2006-01-01

    We developed a new AC calorimeter for the measurement of dynamic specific heat capacity in liquids, including aqueous suspensions of biological materials. This method has several advantages. The first is that a high-resolution measurement of heat capacity, inmillidegrees, can be performed as a function of temperature, even with a very small sample. Therefore, AC calorimeter is a powerful tool to study critical behavior a tphase transition in biological materials. The second advantage is that ...

  18. Optimal football strategies: AC Milan versus FC Barcelona

    OpenAIRE

    Papahristodoulou, Christos

    2012-01-01

    In a recent UEFA Champions League game between AC Milan and FC Barcelona, played in Italy (final score 2-3), the collected match statistics, classified into four offensive and two defensive strategies, were in favour of FC Barcelona (by 13 versus 8 points). The aim of this paper is to examine to what extent the optimal game strategies derived from some deterministic, possibilistic, stochastic and fuzzy LP models would improve the payoff of AC Milan at the cost of FC Barcelona.

  19. Controlled clustering of carboxylated SPIONs through polyethylenimine

    Energy Technology Data Exchange (ETDEWEB)

    Nesztor, Dániel; Bali, Krisztina; Tóth, Ildikó Y.; Szekeres, Márta; Tombácz, Etelka, E-mail: tombacz@chem.u-szeged.hu

    2015-04-15

    Clusters of magnetite nanoparticles (MNPs) were synthesized using poly(acrylic acid-co-maleic acid) coated MNPs (PAM@MNP) and branched polyethylenimine (PEI). Materials were characterized by potentiometric titration, zeta potential and dynamic light scattering (DLS) measurements. PEI and PAM@MNP are oppositely charged as characterized by zeta potential measurements (+8, −34 mV respectively) and titration (10.30 mmol −NH{sub 3}{sup +}/g PEI; 0.175 mmol −COO{sup −}/g PAM@MNP) at pH 6.5±0.2; therefore magnetic clusters are formed by electrostatic adhesion. Two different preparation methods and the effect of PEI and electrolyte (NaCl) concentration on the cluster formation was studied. Choosing an optimal concentration of PEI (charge ratio of PEI to PAM@MNP: 0.17) and electrolyte (10 mM), a concentrated (10 g MNP/L) product containing PEI–PAM@MNP nanoclusters with size of 165±10 nm was prepared. Its specific absorption rate (SAR) measured in AC magnetic field (110 kHz, 25 mT) is 12 W/g Fe. The clustered product is expected to have enhanced contrast efficiency in MRI. - Highlights: • SPION clusters of controlled size were prepared by means of electrostatic adhesion. • Nanocluster formation optimum was at 0.17 charge ratio of PEI to PAM@MNP. • Huge aggregates form at higher PEI to PAM@MNP charge ratio. • Higher ionic strength promotes the formation of clusters at lower PEI concentrations.

  20. A large-aperture, low-resolution quadrupole separator for producing deposited cluster materials

    CERN Document Server

    Denby, P M

    2000-01-01

    A wide-aperture, low-resolution quadrupole separator for metal clusters is described. Its performance has been evaluated by numerical calculations of the trajectories of clusters. Operating in the frequency range from 5 to 100 KHz allows one to separate clusters in the mass range from 30000 to 300000 AMU and by suitable choice of the AC and DC voltages one can obtain a resolution of 0.15. At this resolution the transmission of clusters from a source is 100% over the selected mass range. By biasing the quadrupole it has been possible to obtain a very sharp cut-off between the transmitted clusters and those outside the selected range. Trajectory calculation for clusters deposited onto a biased 2 cm diameter substrate show that it is possible to keep the deposition energy below 25 eV for 90% of the clusters when the quadrupole is itself biased.

  1. A large-aperture, low-resolution quadrupole separator for producing deposited cluster materials

    Energy Technology Data Exchange (ETDEWEB)

    Denby, P.M.; Eastham, D.A. E-mail: d.a.eastham@dl.ac.uk

    2000-03-01

    A wide-aperture, low-resolution quadrupole separator for metal clusters is described. Its performance has been evaluated by numerical calculations of the trajectories of clusters. Operating in the frequency range from 5 to 100 KHz allows one to separate clusters in the mass range from 30000 to 300000 AMU and by suitable choice of the AC and DC voltages one can obtain a resolution of 0.15. At this resolution the transmission of clusters from a source is 100% over the selected mass range. By biasing the quadrupole it has been possible to obtain a very sharp cut-off between the transmitted clusters and those outside the selected range. Trajectory calculation for clusters deposited onto a biased 2 cm diameter substrate show that it is possible to keep the deposition energy below 25 eV for 90% of the clusters when the quadrupole is itself biased.

  2. A large-aperture, low-resolution quadrupole separator for producing deposited cluster materials

    International Nuclear Information System (INIS)

    Denby, P.M.; Eastham, D.A.

    2000-01-01

    A wide-aperture, low-resolution quadrupole separator for metal clusters is described. Its performance has been evaluated by numerical calculations of the trajectories of clusters. Operating in the frequency range from 5 to 100 KHz allows one to separate clusters in the mass range from 30000 to 300000 AMU and by suitable choice of the AC and DC voltages one can obtain a resolution of 0.15. At this resolution the transmission of clusters from a source is 100% over the selected mass range. By biasing the quadrupole it has been possible to obtain a very sharp cut-off between the transmitted clusters and those outside the selected range. Trajectory calculation for clusters deposited onto a biased 2 cm diameter substrate show that it is possible to keep the deposition energy below 25 eV for 90% of the clusters when the quadrupole is itself biased

  3. AC quantum voltmeter for the industry; AC-Quantenvoltmeter fuer die Industrie

    Energy Technology Data Exchange (ETDEWEB)

    Behr, Ralf [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Arbeitsgruppe 2.63 ' ' Josephson-Effekt, Spannung' ' ; Smandek, Bernhard [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Arbeitsgruppe Q.33 ' ' Technologietransfer' '

    2016-09-15

    In a first part difficulties and challenges of the novel operation principle, the ''differential scanning system'' are discussed and explained, how with highest metrological precision the proof of principle succeeded. By common research with other national metrology institutes the concept was consolidated and improved. In a second part it was exemplarically illuminated, how by an efficient dovetailing of European and national promotion programs with different application neighbourhood consolidated knowledge of basic metrological research could be transferred to economy and especially small and medium companies. With an AC quantum voltmeter up to 10 V and 1 kHz already a unique commercial device is available. How the development foreseeable goes on illuminates the final part of the article.

  4. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    independent producers/consumers to connect to multiple distribution grids in order to optimise the electricity price, as this will vary during the day from one power distribution company to another one. It will be needed to have a load that can smoothly adjust the power consumed from each power grid in order......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...... to minimize the overall energy cost or in case of special applications, to improve the system redundancy. Also, having a generator that can simultaneously feed fractions of its power into multiple grids which are not coupled (different voltage, frequency, displacement angle) and continuously adjust...

  5. A multi-channel AC power supply controller

    International Nuclear Information System (INIS)

    Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei

    2003-01-01

    A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system

  6. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  7. Cluster analysis for applications

    CERN Document Server

    Anderberg, Michael R

    1973-01-01

    Cluster Analysis for Applications deals with methods and various applications of cluster analysis. Topics covered range from variables and scales to measures of association among variables and among data units. Conceptual problems in cluster analysis are discussed, along with hierarchical and non-hierarchical clustering methods. The necessary elements of data analysis, statistics, cluster analysis, and computer implementation are integrated vertically to cover the complete path from raw data to a finished analysis.Comprised of 10 chapters, this book begins with an introduction to the subject o

  8. Use of an AC/DC/AC Electrochemical Technique to Assess the Durability of Protection Systems for Magnesium Alloys

    Science.gov (United States)

    Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming

    One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.

  9. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  10. Clusters in nuclei

    CERN Document Server

    Following the pioneering discovery of alpha clustering and of molecular resonances, the field of nuclear clustering is today one of those domains of heavy-ion nuclear physics that faces the greatest challenges, yet also contains the greatest opportunities. After many summer schools and workshops, in particular over the last decade, the community of nuclear molecular physicists has decided to collaborate in producing a comprehensive collection of lectures and tutorial reviews covering the field. This third volume follows the successful Lect. Notes Phys. 818 (Vol. 1) and 848 (Vol. 2), and comprises six extensive lectures covering the following topics:  - Gamma Rays and Molecular Structure - Faddeev Equation Approach for Three Cluster Nuclear Reactions - Tomography of the Cluster Structure of Light Nuclei Via Relativistic Dissociation - Clustering Effects Within the Dinuclear Model : From Light to Hyper-heavy Molecules in Dynamical Mean-field Approach - Clusterization in Ternary Fission - Clusters in Light N...

  11. Spatial cluster modelling

    CERN Document Server

    Lawson, Andrew B

    2002-01-01

    Research has generated a number of advances in methods for spatial cluster modelling in recent years, particularly in the area of Bayesian cluster modelling. Along with these advances has come an explosion of interest in the potential applications of this work, especially in epidemiology and genome research. In one integrated volume, this book reviews the state-of-the-art in spatial clustering and spatial cluster modelling, bringing together research and applications previously scattered throughout the literature. It begins with an overview of the field, then presents a series of chapters that illuminate the nature and purpose of cluster modelling within different application areas, including astrophysics, epidemiology, ecology, and imaging. The focus then shifts to methods, with discussions on point and object process modelling, perfect sampling of cluster processes, partitioning in space and space-time, spatial and spatio-temporal process modelling, nonparametric methods for clustering, and spatio-temporal ...

  12. Clusters and how to make it work : Cluster Strategy Toolkit

    NARCIS (Netherlands)

    Manickam, Anu; van Berkel, Karel

    2014-01-01

    Clusters are the magic answer to regional economic development. Firms in clusters are more innovative; cluster policy dominates EU policy; ‘top-sectors’ and excellence are the choice of national policy makers; clusters are ‘in’. But, clusters are complex, clusters are ‘messy’; there is no clear

  13. Thermally Assisted Macroscopic Quantum Resonance on a Single-Crystal of Mn12-ac

    Science.gov (United States)

    Lionti, F.; Thomas, L.; Ballou, R.; Wernsdorfer, W.; Barbara, B.; Sulpice, A.; Sessoli, R.; Gatteschi, D.

    1997-03-01

    Magnetization measurements have been performed on a single mono-crystal of the molecule Mn12-acetate (L. Thomas, F. Lionti, R. Ballou, R. Sessoli, D. Gatteschi and B. Barbara, Nature, 383, 145 (1996).). Steps were observed in the hysteresis loop for values of the applied field at which level crossings of the collective spin states of each manganese clusters take place. The influence of quartic terms is taken into account. At these fields, the magnetization relaxes at short time scales, being otherwise essentially blocked. This novel behavior is interpreted in terms of resonant quantum tunneling of the magnetization from thermally activated energy levels. Hysteresis loop measurements performed for different field orientations and ac-susceptibility experiments, confirm general trends of this picture.

  14. AC power flow importance measures considering multi-element failures

    International Nuclear Information System (INIS)

    Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling

    2017-01-01

    Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.

  15. Agricultural Clusters in the Netherlands

    NARCIS (Netherlands)

    Schouten, M.A.; Heijman, W.J.M.

    2012-01-01

    Michael Porter was the first to use the term cluster in an economic context. He introduced the term in The Competitive Advantage of Nations (1990). The term cluster is also known as business cluster, industry cluster, competitive cluster or Porterian cluster. This article aims at determining and

  16. Aragonite coating solutions (ACS) based on artificial seawater

    Science.gov (United States)

    Tas, A. Cuneyt

    2015-03-01

    Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  17. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

    2002-12-01

    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  18. Induced AC voltages on pipelines may present a serious hazard

    International Nuclear Information System (INIS)

    Kirkpatrick, E.L.

    1997-01-01

    The problem of induced AC voltages on pipelines has always been with us. Early pipeline construction consisted of bare steel or cast iron pipe, which was very well grounded. Bell and spigot, mechanical, or dresser-style joint couplings often were used, creating electrically discontinuous pipelines which are less susceptible to AC induction. Although induced AC affects any pipeline parallel to a high-voltage alternating current (HVAC) power line, the effects were not noticeable on bare pipelines. With the advent of welded steel pipelines, modern cathodic protection (CP) methods and materials, and the vastly improved quality of protective coatings, induced AC effects on pipelines have become a significant consideration on many pipeline rights-of-way. In the last two to three decades, one has been seeing much more joint occupancy of the same right-of-way by one or more pipelines and power lines. As the cost of right-of-way and the difficulty in acquisition, particularly in urban areas, have risen, the concept of joint occupancy rights-of-way has become more attractive to many utility companies. Federal and state regulations usually insist on joint-use right-of-way when a utility proposes crossing regulated or publicly owned lands, wherever there is an existing easement. Such joint use allows the induced AC phenomena to occur and may create electrical hazards and interference to pipeline facilities. Underground pipelines are especially susceptible if they are well-coated and electrically isolated for CP

  19. Development of low AC loss windings for superconducting traction transformer

    International Nuclear Information System (INIS)

    Kamijo, H; Hata, H; Fukumoto, Y; Tomioka, A; Bohno, T; Yamada, H; Ayai, N; Yamasaki, K; Kato, T; Iwakuma, M; Funaki, K

    2010-01-01

    We have been developing a light weight and high efficiency superconducting traction transformer for railway rolling stock. We designed and fabricated a prototype superconducting traction transformer of a floor-mount type for Shinkansen rolling stock in 2004. We performed the type-test, the system-test, and the vibration-test. Consequently, we could verify that the transformer satisfied the requirement almost exactly as initially planned. However, there have been raised some problems to be solved to put superconducting traction transformer into practical use such that AC loss of the superconducting tape must be lower and the capacity of the refrigerator must be larger. Especially it is the most important to reduce the AC loss of superconducting windings for lightweight and high efficiency. The AC loss must be reduced near the theoretical value of superconducting tape with multifilament. In this study, we fabricated and evaluated the Bi2223 tapes as introduced various measures to reduce the AC loss. We confirmed that the AC loss of the narrow type of Bi2223 tapes with twist of filaments is lower, and we fabricated windings of this tape for use in superconducting traction transformer.

  20. ACS and STEMI treatment: gender-related issues.

    Science.gov (United States)

    Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude

    2012-08-01

    Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.

  1. Electron: Cluster interactions

    International Nuclear Information System (INIS)

    Scheidemann, A.A.; Knight, W.D.

    1994-02-01

    Beam depletion spectroscopy has been used to measure absolute total inelastic electron-sodium cluster collision cross sections in the energy range from E ∼ 0.1 to E ∼ 6 eV. The investigation focused on the closed shell clusters Na 8 , Na 20 , Na 40 . The measured cross sections show an increase for the lowest collision energies where electron attachment is the primary scattering channel. The electron attachment cross section can be understood in terms of Langevin scattering, connecting this measurement with the polarizability of the cluster. For energies above the dissociation energy the measured electron-cluster cross section is energy independent, thus defining an electron-cluster interaction range. This interaction range increases with the cluster size

  2. Clustering high dimensional data

    DEFF Research Database (Denmark)

    Assent, Ira

    2012-01-01

    High-dimensional data, i.e., data described by a large number of attributes, pose specific challenges to clustering. The so-called ‘curse of dimensionality’, coined originally to describe the general increase in complexity of various computational problems as dimensionality increases, is known...... to render traditional clustering algorithms ineffective. The curse of dimensionality, among other effects, means that with increasing number of dimensions, a loss of meaningful differentiation between similar and dissimilar objects is observed. As high-dimensional objects appear almost alike, new approaches...... for clustering are required. Consequently, recent research has focused on developing techniques and clustering algorithms specifically for high-dimensional data. Still, open research issues remain. Clustering is a data mining task devoted to the automatic grouping of data based on mutual similarity. Each cluster...

  3. Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

    Energy Technology Data Exchange (ETDEWEB)

    Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

    2008-07-01

    Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

  4. Epidemiology Analysis of Streptococcus pyogenes in a Hospital in Southern Taiwan by Use of the Updated emm Cluster Typing System.

    Science.gov (United States)

    Chiang-Ni, Chuan; Zheng, Po-Xing; Wang, Shu-Ying; Tsai, Pei-Jane; Chuang, Woei-Jer; Lin, Yee-Shin; Liu, Ching-Chuan; Wu, Jiunn-Jong

    2016-01-01

    emm typing is the most widely used molecular typing method for the human pathogen Streptococcus pyogenes (group A streptococcus [GAS]). emm typing is based on a small variable region of the emm gene; however, the emm cluster typing system defines GAS types according to the nearly complete sequence of the emm gene. Therefore, emm cluster typing is considered to provide more information regarding the functional and structural properties of M proteins in different emm types of GAS. In the present study, 677 isolates collected between 1994 and 2008 in a hospital in southern Taiwan were analyzed by the emm cluster typing system. emm clusters A-C4, E1, E6, and A-C3 were the most prevalent emm cluster types and accounted for 67.4% of total isolates. emm clusters A-C4 and E1 were associated with noninvasive diseases, whereas E6 was significantly associated with both invasive and noninvasive manifestations. In addition, emm clusters D4, E2, and E3 were significantly associated with invasive manifestations. Furthermore, we found that the functional properties of M protein, including low fibrinogen-binding and high IgG-binding activities, were correlated significantly with invasive manifestations. In summary, the present study provides updated epidemiological information on GAS emm cluster types in southern Taiwan. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  5. Substructure in clusters of galaxies

    International Nuclear Information System (INIS)

    Fitchett, M.J.

    1988-01-01

    Optical observations suggesting the existence of substructure in clusters of galaxies are examined. Models of cluster formation and methods used to detect substructure in clusters are reviewed. Consideration is given to classification schemes based on a departure of bright cluster galaxies from a spherically symmetric distribution, evidence for statistically significant substructure, and various types of substructure, including velocity, spatial, and spatial-velocity substructure. The substructure observed in the galaxy distribution in clusters is discussed, focusing on observations from general cluster samples, the Virgo cluster, the Hydra cluster, Centaurus, the Coma cluster, and the Cancer cluster. 88 refs

  6. Nuclear cluster states

    International Nuclear Information System (INIS)

    Rae, W.D.M.; Merchant, A.C.

    1993-01-01

    We review clustering in light nuclei including molecular resonances in heavy ion reactions. In particular we study the systematics, paying special attention to the relationships between cluster states and superdeformed configurations. We emphasise the selection rules which govern the formation and decay of cluster states. We review some recent experimental results from Daresbury and elsewhere. In particular we report on the evidence for a 7-α chain state in 28 Si in experiments recently performed at the NSF, Daresbury. Finally we begin to address theoretically the important question of the lifetimes of cluster states as deduced from the experimental energy widths of the resonances. (Author)

  7. 15th Cluster workshop

    CERN Document Server

    Laakso, Harri; Escoubet, C. Philippe; The Cluster Active Archive : Studying the Earth’s Space Plasma Environment

    2010-01-01

    Since the year 2000 the ESA Cluster mission has been investigating the small-scale structures and processes of the Earth's plasma environment, such as those involved in the interaction between the solar wind and the magnetospheric plasma, in global magnetotail dynamics, in cross-tail currents, and in the formation and dynamics of the neutral line and of plasmoids. This book contains presentations made at the 15th Cluster workshop held in March 2008. It also presents several articles about the Cluster Active Archive and its datasets, a few overview papers on the Cluster mission, and articles reporting on scientific findings on the solar wind, the magnetosheath, the magnetopause and the magnetotail.

  8. Clusters in simple fluids

    International Nuclear Information System (INIS)

    Sator, N.

    2003-01-01

    This article concerns the correspondence between thermodynamics and the morphology of simple fluids in terms of clusters. Definitions of clusters providing a geometric interpretation of the liquid-gas phase transition are reviewed with an eye to establishing their physical relevance. The author emphasizes their main features and basic hypotheses, and shows how these definitions lead to a recent approach based on self-bound clusters. Although theoretical, this tutorial review is also addressed to readers interested in experimental aspects of clustering in simple fluids

  9. Structural, ac conductivity and dielectric properties of 3-formyl chromone

    Science.gov (United States)

    Ali, H. A. M.

    2017-07-01

    The structure for the powder of 3-formyl chromone was examined by X-ray diffraction technique in the 2θ° range ( 4° - 60° . The configuration of Al/3-formyl chromone/Al samples was designed. The electrical and dielectric properties were studied as a function of frequency (42- 5 × 106 Hz) and temperature (298-408K). The ac conductivity data of bulk of 3-formyl chromone varies as a power law with the frequency at different temperatures. The predominant mechanism for ac conduction was deduced. The ac conductivity shows a thermally activated process at different frequencies. The dielectric constant and dielectric loss were determined using the capacitance and dissipation factor measurements at different temperatures. The dielectric loss shows a peak of relaxation time that shifted to higher frequency with an increase in the temperature. The activation energy of the relaxation process was estimated.

  10. On the Application of TLS Techniques to AC Electrical Drives

    Directory of Open Access Journals (Sweden)

    M. Cirrincione

    2005-03-01

    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  11. AC Conductivity Studies of Lithium Based Phospho Vanadate Glasses

    International Nuclear Information System (INIS)

    Nagendra, K.; Babu, G. Satish; Gowda, Veeranna; Reddy, C. Narayana

    2011-01-01

    Glasses in the system xLi 2 SO 4 -20Li 2 O-(80-x) [80P 2 O 5 -20V 2 O 5 ](5≥x≥20 mol%) has been prepared by melt quenching method. Dc and ac conductivity has been studied over a wide range of frequency (10 Hz to 10 MHz) and temperature (298 K-523 K). The dc conductivity found to increase with increase of Li 2 SO 4 concentration. The ac conductivities have been fitted to the Almond-West type single power law equation σ(ω) = σ(0)+Aω s where 's' is the power law exponent. The ac conductivity found to increase with increase of Li 2 SO 4 concentration. An attempt is made to elucidate the enhancement of lithium ion conduction in phosphor-vanadate glasses by considering the expansion of network structure.

  12. Objectives and status of development of AC600

    International Nuclear Information System (INIS)

    Zhao Chengkun

    1997-01-01

    AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600

  13. AC Application of HTS Conductors in Highly Dynamic Electric Motors

    International Nuclear Information System (INIS)

    Oswald, B; Best, K-J; Setzer, M; Duffner, E; Soell, M; Gawalek, W; Kovalev, L K

    2006-01-01

    Based on recent investigations we design highly dynamic electric motors up to 400 kW and linear motors up to 120 kN linear force using HTS bulk material and HTS tapes. The introduction of HTS tapes into AC applications in electric motors needs fundamental studies on double pancake coils under transversal magnetic fields. First theoretical and experimental results on AC field distributions in double-pancake-coils and corresponding AC losses will be presented. Based on these results the simulation of the motor performance confirms extremely high power density and efficiency of both types of electric motors. Improved characteristics of rare earth permanent magnets used in our motors at low temperatures give an additional technological benefit

  14. Reliability of emergency ac power systems at nuclear power plants

    International Nuclear Information System (INIS)

    Battle, R.E.; Campbell, D.J.

    1983-07-01

    Reliability of emergency onsite ac power systems at nuclear power plants has been questioned within the Nuclear Regulatory Commission (NRC) because of the number of diesel generator failures reported by nuclear plant licensees and the reactor core damage that could result from diesel failure during an emergency. This report contains the results of a reliability analysis of the onsite ac power system, and it uses the results of a separate analysis of offsite power systems to calculate the expected frequency of station blackout. Included is a design and operating experience review. Eighteen plants representative of typical onsite ac power systems and ten generic designs were selected to be modeled by fault trees. Operating experience data were collected from the NRC files and from nuclear plant licensee responses to a questionnaire sent out for this project

  15. Neural network based PWM AC chopper fed induction motor drive

    Directory of Open Access Journals (Sweden)

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  16. 21 CFR 880.6320 - AC-powered medical examination light.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...

  17. AC power losses in Bi-2223/Ag HTS tapes

    International Nuclear Information System (INIS)

    Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.

    1998-01-01

    Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour

  18. Hybrid AC-High Voltage DC Grid Stability and Controls

    Science.gov (United States)

    Yu, Jicheng

    The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient

  19. Application of ac impedance in fuel cell research and development

    Energy Technology Data Exchange (ETDEWEB)

    Selman, J R; Lin, Y P [Illinois Inst. of Tech., Chicago, IL (United States). Dept. of Chemical Engineering

    1993-10-01

    In applying ac impedance to fuel cells and their porous (gas diffusion) electrodes the emphasis lies on different fuel cell components, and their properties, according to the fuel cell type. The focus has been directed at the electrode/electrolyte interface in MCFC and PAFC, whereas in SOFC and PEMFC the ionic/electronic conductivity of the electrolyte or the characteristics of its composite with the electrocatalyst is of primary interest. The limitations of ac impedance in fuel cell application are in part due to difficulties of interpretation and in part due to experimental difficulties because of the generally fast electrode reaction kinetics. Further research directions are indicated. (author)

  20. Droop-free Distributed Control for AC Microgrids

    DEFF Research Database (Denmark)

    Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.

    2016-01-01

    A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...

  1. Productos «Celotex» para acondicionamientos Acústicos

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1958-02-01

    Full Text Available Not availableBajo la denominación general «Celotex», que es un nombre registrado, la Casa Americana The Celotex Corporation, cuyo domicilio social es 120 South, La Salle Street, Chicago J. lllinois, fabrica diversos materiales para fines de acondicionamiento acústico elaborados, según los tipos de que se trate, con fibra de caña de azúcar, lanas minerales, acero, amianto, etc., perforados o no y de acuerdo con el efecto estético y acústico que se desee obtener.

  2. Stretched exponential relaxation and ac universality in disordered dielectrics

    DEFF Research Database (Denmark)

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens

    2007-01-01

    This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are stretc......This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues...

  3. A.C. losses in current-carrying superconductors

    International Nuclear Information System (INIS)

    Reuver, J.L. de.

    1985-01-01

    The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)

  4. Programmable Power Supply for AC Switching Magnet of Proton Accelerator

    CERN Document Server

    Jeong, Seong-Hun; Kang Heung Sik; Lee, Chi-Hwan; Lee, Hong-Gi; Park, Ki-Hyeon; Ryu, Chun-Kil; Sik Han, Hong; Suck Suh, Hyung

    2005-01-01

    The 100-MeV PEFP proton linac has two proton beam extraction lines for user' experiment. Each extraction line has 5 beamlines and has 5 Hz operating frequency. An AC switching magnet is used to distribute the proton beam to the 5 beamlines, An AC switching magnet is powered by PWM-controlled bipolar switching-mode converters. This converter is designed to operate at ±350A, 5 Hz programmable step output. The power supply is employed IGBT module and has controlled by a DSP (Digital Signal Process). This paper describes the design and test results of the power supply.

  5. Ac system interruption analysis of an orthogonal-core type dc-ac converter. Koryu keito shadanji no chokko jishinkei dc-ac renkeiyo henkanki no dosa kaiseki

    Energy Technology Data Exchange (ETDEWEB)

    Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College

    1991-04-30

    This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.

  6. Lifting to cluster-tilting objects in higher cluster categories

    OpenAIRE

    Liu, Pin

    2008-01-01

    In this note, we consider the $d$-cluster-tilted algebras, the endomorphism algebras of $d$-cluster-tilting objects in $d$-cluster categories. We show that a tilting module over such an algebra lifts to a $d$-cluster-tilting object in this $d$-cluster category.

  7. Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

    Directory of Open Access Journals (Sweden)

    LISTYA UTAMI KARMAWAN

    2009-03-01

    Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

  8. Modeling the formation of globular cluster systems in the Virgo cluster

    International Nuclear Information System (INIS)

    Li, Hui; Gnedin, Oleg Y.

    2014-01-01

    The mass distribution and chemical composition of globular cluster (GC) systems preserve fossil record of the early stages of galaxy formation. The observed distribution of GC colors within massive early-type galaxies in the ACS Virgo Cluster Survey (ACSVCS) reveals a multi-modal shape, which likely corresponds to a multi-modal metallicity distribution. We present a simple model for the formation and disruption of GCs that aims to match the ACSVCS data. This model tests the hypothesis that GCs are formed during major mergers of gas-rich galaxies and inherit the metallicity of their hosts. To trace merger events, we use halo merger trees extracted from a large cosmological N-body simulation. We select 20 halos in the mass range of 2 × 10 12 to 7 × 10 13 M ☉ and match them to 19 Virgo galaxies with K-band luminosity between 3 × 10 10 and 3 × 10 11 L ☉ . To set the [Fe/H] abundances, we use an empirical galaxy mass-metallicity relation. We find that a minimal merger ratio of 1:3 best matches the observed cluster metallicity distribution. A characteristic bimodal shape appears because metal-rich GCs are produced by late mergers between massive halos, while metal-poor GCs are produced by collective merger activities of less massive hosts at early times. The model outcome is robust to alternative prescriptions for cluster formation rate throughout cosmic time, but a gradual evolution of the mass-metallicity relation with redshift appears to be necessary to match the observed cluster metallicities. We also affirm the age-metallicity relation, predicted by an earlier model, in which metal-rich clusters are systematically several billion younger than their metal-poor counterparts.

  9. Apple MdACS6 Regulates Ethylene Biosynthesis During Fruit Development Involving Ethylene-Responsive Factor.

    Science.gov (United States)

    Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide

    2015-10-01

    Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  10. Neurostimulation in cluster headache

    DEFF Research Database (Denmark)

    Pedersen, Jeppe L; Barloese, Mads; Jensen, Rigmor H

    2013-01-01

    PURPOSE OF REVIEW: Neurostimulation has emerged as a viable treatment for intractable chronic cluster headache. Several therapeutic strategies are being investigated including stimulation of the hypothalamus, occipital nerves and sphenopalatine ganglion. The aim of this review is to provide...... effective strategy must be preferred as first-line therapy for intractable chronic cluster headache....

  11. Cauchy cluster process

    DEFF Research Database (Denmark)

    Ghorbani, Mohammad

    2013-01-01

    In this paper we introduce an instance of the well-know Neyman–Scott cluster process model with clusters having a long tail behaviour. In our model the offspring points are distributed around the parent points according to a circular Cauchy distribution. Using a modified Cramér-von Misses test...

  12. When Clusters become Networks

    NARCIS (Netherlands)

    S.M.W. Phlippen (Sandra); G.A. van der Knaap (Bert)

    2007-01-01

    textabstractPolicy makers spend large amounts of public resources on the foundation of science parks and other forms of geographically clustered business activities, in order to stimulate regional innovation. Underlying the relation between clusters and innovation is the assumption that co-located

  13. Mixed-Initiative Clustering

    Science.gov (United States)

    Huang, Yifen

    2010-01-01

    Mixed-initiative clustering is a task where a user and a machine work collaboratively to analyze a large set of documents. We hypothesize that a user and a machine can both learn better clustering models through enriched communication and interactive learning from each other. The first contribution or this thesis is providing a framework of…

  14. Coma cluster of galaxies

    Science.gov (United States)

    1999-01-01

    Atlas Image mosaic, covering 34' x 34' on the sky, of the Coma cluster, aka Abell 1656. This is a particularly rich cluster of individual galaxies (over 1000 members), most prominently the two giant ellipticals, NGC 4874 (right) and NGC 4889 (left). The remaining members are mostly smaller ellipticals, but spiral galaxies are also evident in the 2MASS image. The cluster is seen toward the constellation Coma Berenices, but is actually at a distance of about 100 Mpc (330 million light years, or a redshift of 0.023) from us. At this distance, the cluster is in what is known as the 'Hubble flow,' or the overall expansion of the Universe. As such, astronomers can measure the Hubble Constant, or the universal expansion rate, based on the distance to this cluster. Large, rich clusters, such as Coma, allow astronomers to measure the 'missing mass,' i.e., the matter in the cluster that we cannot see, since it gravitationally influences the motions of the member galaxies within the cluster. The near-infrared maps the overall luminous mass content of the member galaxies, since the light at these wavelengths is dominated by the more numerous older stellar populations. Galaxies, as seen by 2MASS, look fairly smooth and homogeneous, as can be seen from the Hubble 'tuning fork' diagram of near-infrared galaxy morphology. Image mosaic by S. Van Dyk (IPAC).

  15. Cluster growth kinetics

    International Nuclear Information System (INIS)

    Dubovik, V.M.; Gal'perin, A.G.; Rikhvitskij, V.S.; Lushnikov, A.A.

    2000-01-01

    Processes of some traffic blocking coming into existence are considered as probabilistic ones. We study analytic solutions for models for the dynamics of both cluster growth and cluster growth with fragmentation in the systems of finite number of objects. Assuming rates constancy of both coalescence and fragmentation, the models under consideration are linear on the probability functions

  16. Alpha clustering in nuclei

    International Nuclear Information System (INIS)

    Hodgson, P.E.

    1990-01-01

    The effects of nucleon clustering in nuclei are described, with reference to both nuclear structure and nuclear reactions, and the advantages of using the cluster formalism to describe a range of phenomena are discussed. It is shown that bound and scattering alpha-particle states can be described in a unified way using an energy-dependent alpha-nucleus potential. (author)

  17. Negotiating Cluster Boundaries

    DEFF Research Database (Denmark)

    Giacomin, Valeria

    2017-01-01

    Palm oil was introduced to Malay(si)a as an alternative to natural rubber, inheriting its cluster organizational structure. In the late 1960s, Malaysia became the world’s largest palm oil exporter. Based on archival material from British colonial institutions and agency houses, this paper focuses...... on the governance dynamics that drove institutional change within this cluster during decolonization. The analysis presents three main findings: (i) cluster boundaries are defined by continuous tug-of-war style negotiations between public and private actors; (ii) this interaction produces institutional change...... within the cluster, in the form of cumulative ‘institutional rounds’ – the correction or disruption of existing institutions or the creation of new ones; and (iii) this process leads to a broader inclusion of local actors in the original cluster configuration. The paper challenges the prevalent argument...

  18. Mathematical classification and clustering

    CERN Document Server

    Mirkin, Boris

    1996-01-01

    I am very happy to have this opportunity to present the work of Boris Mirkin, a distinguished Russian scholar in the areas of data analysis and decision making methodologies. The monograph is devoted entirely to clustering, a discipline dispersed through many theoretical and application areas, from mathematical statistics and combina­ torial optimization to biology, sociology and organizational structures. It compiles an immense amount of research done to date, including many original Russian de­ velopments never presented to the international community before (for instance, cluster-by-cluster versions of the K-Means method in Chapter 4 or uniform par­ titioning in Chapter 5). The author's approach, approximation clustering, allows him both to systematize a great part of the discipline and to develop many in­ novative methods in the framework of optimization problems. The optimization methods considered are proved to be meaningful in the contexts of data analysis and clustering. The material presented in ...

  19. Neutrosophic Hierarchical Clustering Algoritms

    Directory of Open Access Journals (Sweden)

    Rıdvan Şahin

    2014-03-01

    Full Text Available Interval neutrosophic set (INS is a generalization of interval valued intuitionistic fuzzy set (IVIFS, whose the membership and non-membership values of elements consist of fuzzy range, while single valued neutrosophic set (SVNS is regarded as extension of intuitionistic fuzzy set (IFS. In this paper, we extend the hierarchical clustering techniques proposed for IFSs and IVIFSs to SVNSs and INSs respectively. Based on the traditional hierarchical clustering procedure, the single valued neutrosophic aggregation operator, and the basic distance measures between SVNSs, we define a single valued neutrosophic hierarchical clustering algorithm for clustering SVNSs. Then we extend the algorithm to classify an interval neutrosophic data. Finally, we present some numerical examples in order to show the effectiveness and availability of the developed clustering algorithms.

  20. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... communications industry. Applicant states that, on a pro forma basis post-Transaction, its assets will consist of... providing wholesale wireless communications services to its members. The Transaction agreements contemplate... portion of the ACS Wireless' revenue. Applicant states that post-Transaction, on a pro forma basis, for...

  1. AC conductivity of a quantum Hall line junction

    International Nuclear Information System (INIS)

    Agarwal, Amit; Sen, Diptiman

    2009-01-01

    We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.

  2. Reliability assurance program for operational emergency ac power system

    International Nuclear Information System (INIS)

    Heineman, J.B.; Ragland, W.A.; Mueller, C.J.

    1985-01-01

    A comprehensive review of emergency ac power systems in nuclear generating plants (the vast majority of these plants contain redundant diesel generator systems) delineates several operational areas that can be improved by instituting a reliability assurance program (RAP), which initially upgrades the diesel generator performance and provides for ongoing monitoring and maintenance based upon alert levels

  3. AC-600 reactor reloading pattern optimization by using genetic algorithms

    International Nuclear Information System (INIS)

    Wu Hongchun; Xie Zhongsheng; Yao Dong; Li Dongsheng; Zhang Zongyao

    2000-01-01

    The use of genetic algorithms to optimize reloading pattern of the nuclear power plant reactor is proposed. And a new encoding and translating method is given. Optimization results of minimizing core power peak and maximizing cycle length for both low-leakage and out-in loading pattern of AC-600 reactor are obtained

  4. Ammonia treated Mo/AC catalysts for CO hydrogenation with ...

    Indian Academy of Sciences (India)

    A series of ammonia treated Mo/Activated Carbon (AC) catalysts were synthesized by wet impregnation method by nominal incorporation of 5, 10 and 15 wt% of molybdenum. The calcined catalysts (500◦C, 4 h, N₂ flow) were subjected to a stepwise ammonia treatment at temperatures from 25 up to 700◦C. This work ...

  5. AC-Conductivity measurements on γ-aluminium oxynitride

    NARCIS (Netherlands)

    Willems, H.X.; Hal, van P.F.; Metselaar, R.; With, de G.

    1995-01-01

    AC-conductivity measurements were performed on aluminium oxynitrides (Alons) because of their interesting defect structure. Although it became apparent that these Alons are not stable in the temperature range used, the electrical properties of the materials could be measured with impedance

  6. Introducing AC Inductive Reactance with a Power Tool

    Science.gov (United States)

    Bryant, Wesley; Baker, Blane

    2016-01-01

    The concept of reactance in AC electrical circuits is often non-intuitive and difficult for students to grasp. In order to address this lack of conceptual understanding, classroom exercises compare the predicted resistance of a power tool, based on electrical specifications, to measured resistance. Once students discover that measured resistance…

  7. Time-reversal symmetry breaking by ac field: Effect of ...

    Indian Academy of Sciences (India)

    deviate from 2 thus signalling on the time-reversal breaking by the ac field. ... is also the parity effect: the enchancement is only present if either P or Q is even. ... analysis (see figure 1) is possible and the ergodic zero-dimensional approx-.

  8. Self-field AC losses in Bi-2223 superconducting tapes

    International Nuclear Information System (INIS)

    Mueller, K. H.; Leslie, K.E.

    1996-01-01

    Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed

  9. Novel dielectric reduces corona breakdown in ac capacitors

    Science.gov (United States)

    Loehner, J. L.

    1972-01-01

    Dielectric system was developed which consists of two layers of 25-gage paper separated by one layer of 50-gage polypropylene to reduce corona breakdown in ac capacitors. System can be used in any alternating current application where constant voltage does not exceed 400 V rms. With a little research it could probably be increased to 700 to 800 V rms.

  10. a.c. conductance study of polycrystal C60

    International Nuclear Information System (INIS)

    Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin

    1995-01-01

    The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))

  11. Model for the dynamic study of AC contactors

    Energy Technology Data Exchange (ETDEWEB)

    Corcoles, F.; Pedra, J.; Garrido, J.P.; Baza, R. [Dep. d' Eng. Electrica ETSEIB. UPC, Barcelona (Spain)

    2000-08-01

    This paper proposes a model for the dynamic analysis of AC contactors. The calculation algorithm and implementation are discussed. The proposed model can be used to study the influence of the design parameters and the supply in their dynamic behaviour. The high calculation speed of the implemented algorithm allows extensive ranges of parameter variations to be analysed. (orig.)

  12. Team-oriented Adaptive Droop Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Nasirian, Vahidreza; Guerrero, Josep M.

    2014-01-01

    This paper proposes a distributed control strategy for voltage and reactive power regulation in ac Microgrids. First, the control module introduces a voltage regulator that maintains the average voltage of the system on the rated value, keeping all bus voltages within an acceptable range. Dynamic...

  13. Unbalanced Voltage Compensation in Low Voltage Residential AC Grids

    DEFF Research Database (Denmark)

    Trintis, Ionut; Douglass, Philip; Munk-Nielsen, Stig

    2016-01-01

    This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling...

  14. Evaluation of ac conductivity behaviour of graphite filled

    Indian Academy of Sciences (India)

    Composites of epoxy resin having different amounts of graphite particles have been prepared by solution casting method. Temperature dependence of dielectric constant, tan and a.c. conductivity was measured in the frequency range, 1–20 kHz, temperature range, 40–180°C for 0.99, 1.96 and 2.91 wt% graphite filled ...

  15. Herd Clustering: A synergistic data clustering approach using collective intelligence

    KAUST Repository

    Wong, Kachun; Peng, Chengbin; Li, Yue; Chan, Takming

    2014-01-01

    , this principle is used to develop a new clustering algorithm. Inspired by herd behavior, the clustering method is a synergistic approach using collective intelligence called Herd Clustering (HC). The novel part is laid in its first stage where data instances

  16. Activation and clustering of a Plasmodium falciparum var gene are affected by subtelomeric sequences.

    Science.gov (United States)

    Duffy, Michael F; Tang, Jingyi; Sumardy, Fransisca; Nguyen, Hanh H T; Selvarajah, Shamista A; Josling, Gabrielle A; Day, Karen P; Petter, Michaela; Brown, Graham V

    2017-01-01

    The Plasmodium falciparum var multigene family encodes the cytoadhesive, variant antigen PfEMP1. P. falciparum antigenic variation and cytoadhesion specificity are controlled by epigenetic switching between the single, or few, simultaneously expressed var genes. Most var genes are maintained in perinuclear clusters of heterochromatic telomeres. The active var gene(s) occupy a single, perinuclear var expression site. It is unresolved whether the var expression site forms in situ at a telomeric cluster or whether it is an extant compartment to which single chromosomes travel, thus controlling var switching. Here we show that transcription of a var gene did not require decreased colocalisation with clusters of telomeres, supporting var expression site formation in situ. However following recombination within adjacent subtelomeric sequences, the same var gene was persistently activated and did colocalise less with telomeric clusters. Thus, participation in stable, heterochromatic, telomere clusters and var switching are independent but are both affected by subtelomeric sequences. The var expression site colocalised with the euchromatic mark H3K27ac to a greater extent than it did with heterochromatic H3K9me3. H3K27ac was enriched within the active var gene promoter even when the var gene was transiently repressed in mature parasites and thus H3K27ac may contribute to var gene epigenetic memory. © 2016 Federation of European Biochemical Societies.

  17. Aragonite coating solutions (ACS) based on artificial seawater

    International Nuclear Information System (INIS)

    Tas, A. Cuneyt

    2015-01-01

    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO 3 , calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca 10 (PO 4 ) 6 (OH) 2 ), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry

  18. Aragonite coating solutions (ACS) based on artificial seawater

    Energy Technology Data Exchange (ETDEWEB)

    Tas, A. Cuneyt, E-mail: c_tas@hotmail.com

    2015-03-01

    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  19. Flame spread over inclined electrical wires with AC electric fields

    KAUST Repository

    Lim, Seung J.

    2017-07-21

    Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field applied, the flame spread rate and the flame width of downwardly spreading flames (DSFs) decreased from the horizontal case for −20° ≤ θ < 0° and maintained near constant values for −90° ≤ θ < −20°, while the flame spread rate increased appreciably as the inclination angle of upwardly spreading flames (USFs) increased. When an AC electric field was applied, the behavior of flame spread rate in DSFs (USFs) could be classified into two (three) sub-regimes characterized by various functional dependences on VAC, fAC, and θ. In nearly all cases of DSFs, a globular molten polyethylene formed ahead of the spreading flame edge, occasionally dripping onto the ground. In these cases, an effective flame spread rate was defined to represent the burning rate by measuring the mass loss due to dripping. This effective spread rate was independent of AC frequency, while it decreased linearly with voltage and was independent of the inclination angle. In DSFs, when excessively high voltage and frequency were applied, the dripping led to flame extinction during propagation and the extinction frequency correlated well with applied voltage. In USFs, when high voltage and frequency were applied, multiple globular molten PEs formed at several locations, leading to ejections of multiple small flame segments from the main flame, thereby reducing the flame spread rate, which could be attributed to the electrospray phenomenon.

  20. Globular Cluster Candidates for Hosting a Central Black Hole

    Science.gov (United States)

    Noyola, Eva

    2009-07-01

    We are continuing our study of the dynamical properties of globular clusters and we propose to obtain surface brightness profiles for high concentration clusters. Our results to date show that the distribution of central surface brightness slopes do not conform to standard models. This has important implications for how they form and evolve, and suggest the possible presence of central intermediate-mass black holes. From our previous archival proposals {AR-9542 and AR-10315}, we find that many high concentration globular clusters do not have flat cores or steep central cusps, instead they show weak cusps. Numerical simulations suggest that clusters with weak cusps may harbor intermediate-mass black holes and we have one confirmation of this connection with omega Centauri. This cluster shows a shallow cusp in its surface brightness profile, while kinematical measurements suggest the presence of a black hole in its center. Our goal is to extend these studies to a sample containing 85% of the Galactic globular clusters with concentrations higher than 1.7 and look for objects departing from isothermal behavior. The ACS globular cluster survey {GO-10775} provides enough objects to have an excellent coverage of a wide range of galactic clusters, but it contains only a couple of the ones with high concentration. The proposed sample consists of clusters whose light profile can only be adequately measured from space-based imaging. This would take us close to completeness for the high concentration cases and therefore provide a more complete list of candidates for containing a central black hole. The dataset will also be combined with our existing kinematic measurements and enhanced with future kinematic studies to perform detailed dynamical modeling.

  1. Document clustering methods, document cluster label disambiguation methods, document clustering apparatuses, and articles of manufacture

    Science.gov (United States)

    Sanfilippo, Antonio [Richland, WA; Calapristi, Augustin J [West Richland, WA; Crow, Vernon L [Richland, WA; Hetzler, Elizabeth G [Kennewick, WA; Turner, Alan E [Kennewick, WA

    2009-12-22

    Document clustering methods, document cluster label disambiguation methods, document clustering apparatuses, and articles of manufacture are described. In one aspect, a document clustering method includes providing a document set comprising a plurality of documents, providing a cluster comprising a subset of the documents of the document set, using a plurality of terms of the documents, providing a cluster label indicative of subject matter content of the documents of the cluster, wherein the cluster label comprises a plurality of word senses, and selecting one of the word senses of the cluster label.

  2. Cluster-cluster correlations and constraints on the correlation hierarchy

    Science.gov (United States)

    Hamilton, A. J. S.; Gott, J. R., III

    1988-01-01

    The hypothesis that galaxies cluster around clusters at least as strongly as they cluster around galaxies imposes constraints on the hierarchy of correlation amplitudes in hierachical clustering models. The distributions which saturate these constraints are the Rayleigh-Levy random walk fractals proposed by Mandelbrot; for these fractal distributions cluster-cluster correlations are all identically equal to galaxy-galaxy correlations. If correlation amplitudes exceed the constraints, as is observed, then cluster-cluster correlations must exceed galaxy-galaxy correlations, as is observed.

  3. Formation of stable products from cluster-cluster collisions

    International Nuclear Information System (INIS)

    Alamanova, Denitsa; Grigoryan, Valeri G; Springborg, Michael

    2007-01-01

    The formation of stable products from copper cluster-cluster collisions is investigated by using classical molecular-dynamics simulations in combination with an embedded-atom potential. The dependence of the product clusters on impact energy, relative orientation of the clusters, and size of the clusters is studied. The structures and total energies of the product clusters are analysed and compared with those of the colliding clusters before impact. These results, together with the internal temperature, are used in obtaining an increased understanding of cluster fusion processes

  4. The Cluster Population of UGC 2885

    Science.gov (United States)

    Holwerda, Benne

    2017-08-01

    UGC 2885 was discoverd to be the most extended disk galaxy [250 kpc diameter] by Vera Rubin in the 1980's. We ask for HST observations of UGC 2885 as it is close enough to resolve the GC population with HST but it is a substantially more extended disk than any studied before. LCDM galaxy assembly implies that the GC population comes from small accreted systems and the disk -and the clusters associated with it- predominantly from gas accretion (matching angular momentum to the disk). Several scaling relations between the GC population and parent galaxy have been observed but these differ for disk and spheroidal (massive) galaxies.We propose to observe this galaxy with HST in 4 point WFC3 mosaic with coordinated ACS parallels to probe both the disk and outer halo component of the GC population. GC populations have been studied extensively using HST color mosaics of local disk galaxies and these can serve as comparison samples. How UGC 2885 cluster populations relate to its stellar and halo mass, luminosity and with radius will reveal the formation history of extra-ordinary disk.Our goals are twofold: our science goal is to map the luminosity, (some) size, and color distributions of the stellar and globular clusters in and around this disk. In absolute terms, we expect to find many GC but the relative relation of the GC population to this galaxy's mass (stellar and halo) and size will shed light on its formation history; similar to a group or cluster central elliptical or to a field galaxy (albeit one with a disk 10x the Milky Way's size)? Our secondary motive is to make an HST tribute image to the late Vera Rubin.

  5. Tune Your Brown Clustering, Please

    DEFF Research Database (Denmark)

    Derczynski, Leon; Chester, Sean; Bøgh, Kenneth Sejdenfaden

    2015-01-01

    Brown clustering, an unsupervised hierarchical clustering technique based on ngram mutual information, has proven useful in many NLP applications. However, most uses of Brown clustering employ the same default configuration; the appropriateness of this configuration has gone predominantly...

  6. Abscisic Acid Antagonizes Ethylene Production through the ABI4-Mediated Transcriptional Repression of ACS4 and ACS8 in Arabidopsis.

    Science.gov (United States)

    Dong, Zhijun; Yu, Yanwen; Li, Shenghui; Wang, Juan; Tang, Saijun; Huang, Rongfeng

    2016-01-04

    Increasing evidence has revealed that abscisic acid (ABA) negatively modulates ethylene biosynthesis, although the underlying mechanism remains unclear. To identify the factors involved, we conducted a screen for ABA-insensitive mutants with altered ethylene production in Arabidopsis. A dominant allele of ABI4, abi4-152, which produces a putative protein with a 16-amino-acid truncation at the C-terminus of ABI4, reduces ethylene production. By contrast, two recessive knockout alleles of ABI4, abi4-102 and abi4-103, result in increased ethylene evolution, indicating that ABI4 negatively regulates ethylene production. Further analyses showed that expression of the ethylene biosynthesis genes ACS4, ACS8, and ACO2 was significantly decreased in abi4-152 but increased in the knockout mutants, with partial dependence on ABA. Chromatin immunoprecipitation-quantitative PCR assays showed that ABI4 directly binds the promoters of these ethylene biosynthesis genes and that ABA enhances this interaction. A fusion protein containing the truncated ABI4-152 peptide accumulated to higher levels than its full-length counterpart in transgenic plants, suggesting that ABI4 is destabilized by its C terminus. Therefore, our results demonstrate that ABA negatively regulates ethylene production through ABI4-mediated transcriptional repression of the ethylene biosynthesis genes ACS4 and ACS8 in Arabidopsis. Copyright © 2016 The Author. Published by Elsevier Inc. All rights reserved.

  7. A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network

    Science.gov (United States)

    Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.

    2017-05-01

    Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.

  8. Cluster Management Institutionalization

    DEFF Research Database (Denmark)

    Normann, Leo; Agger Nielsen, Jeppe

    2015-01-01

    of how it was legitimized as a “ready-to-use” management model. Further, our account reveals how cluster management translated into considerably different local variants as it travelled into specific organizations. However, these processes have not occurred sequentially with cluster management first...... legitimized at the field level, then spread, and finally translated into action in the adopting organizations. Instead, we observed entangled field and organizational-level processes. Accordingly, we argue that cluster management institutionalization is most readily understood by simultaneously investigating...

  9. The concept of cluster

    DEFF Research Database (Denmark)

    Laursen, Lea Louise Holst; Møller, Jørgen

    2013-01-01

    villages in order to secure their future. This paper will address the concept of cluster-villages as a possible approach to strengthen the conditions of contemporary Danish villages. Cluster-villages is a concept that gather a number of villages in a network-structure where the villages both work together...... to forskellige positioner ser vi en ny mulighed for landsbyudvikling, som vi kalder Clustervillages. In order to investigate the potentials and possibilities of the cluster-village concept the paper will seek to unfold the concept strategically; looking into the benefits of such concept. Further, the paper seeks...

  10. Raspberry Pi super cluster

    CERN Document Server

    Dennis, Andrew K

    2013-01-01

    This book follows a step-by-step, tutorial-based approach which will teach you how to develop your own super cluster using Raspberry Pi computers quickly and efficiently.Raspberry Pi Super Cluster is an introductory guide for those interested in experimenting with parallel computing at home. Aimed at Raspberry Pi enthusiasts, this book is a primer for getting your first cluster up and running.Basic knowledge of C or Java would be helpful but no prior knowledge of parallel computing is necessary.

  11. Introduction to cluster dynamics

    CERN Document Server

    Reinhard, Paul-Gerhard

    2008-01-01

    Clusters as mesoscopic particles represent an intermediate state of matter between single atoms and solid material. The tendency to miniaturise technical objects requires knowledge about systems which contain a ""small"" number of atoms or molecules only. This is all the more true for dynamical aspects, particularly in relation to the qick development of laser technology and femtosecond spectroscopy. Here, for the first time is a highly qualitative introduction to cluster physics. With its emphasis on cluster dynamics, this will be vital to everyone involved in this interdisciplinary subje

  12. Contextualizing the Cluster

    DEFF Research Database (Denmark)

    Giacomin, Valeria

    This dissertation examines the case of the palm oil cluster in Malaysia and Indonesia, today one of the largest agricultural clusters in the world. My analysis focuses on the evolution of the cluster from the 1880s to the 1970s in order to understand how it helped these two countries to integrate...... into the global economy in both colonial and post-colonial times. The study is based on empirical material drawn from five UK archives and background research using secondary sources, interviews, and archive visits to Malaysia and Singapore. The dissertation comprises three articles, each discussing a major under...

  13. Atomic cluster collisions

    Science.gov (United States)

    Korol, Andrey V.; Solov'yov, Andrey

    2013-01-01

    Atomic cluster collisions are a field of rapidly emerging research interest by both experimentalists and theorists. The international symposium on atomic cluster collisions (ISSAC) is the premier forum to present cutting-edge research in this field. It was established in 2003 and the most recent conference was held in Berlin, Germany in July of 2011. This Topical Issue presents original research results from some of the participants, who attended this conference. This issues specifically focuses on two research areas, namely Clusters and Fullerenes in External Fields and Nanoscale Insights in Radiation Biodamage.

  14. Combining cluster number counts and galaxy clustering

    Energy Technology Data Exchange (ETDEWEB)

    Lacasa, Fabien; Rosenfeld, Rogerio, E-mail: fabien@ift.unesp.br, E-mail: rosenfel@ift.unesp.br [ICTP South American Institute for Fundamental Research, Instituto de Física Teórica, Universidade Estadual Paulista, São Paulo (Brazil)

    2016-08-01

    The abundance of clusters and the clustering of galaxies are two of the important cosmological probes for current and future large scale surveys of galaxies, such as the Dark Energy Survey. In order to combine them one has to account for the fact that they are not independent quantities, since they probe the same density field. It is important to develop a good understanding of their correlation in order to extract parameter constraints. We present a detailed modelling of the joint covariance matrix between cluster number counts and the galaxy angular power spectrum. We employ the framework of the halo model complemented by a Halo Occupation Distribution model (HOD). We demonstrate the importance of accounting for non-Gaussianity to produce accurate covariance predictions. Indeed, we show that the non-Gaussian covariance becomes dominant at small scales, low redshifts or high cluster masses. We discuss in particular the case of the super-sample covariance (SSC), including the effects of galaxy shot-noise, halo second order bias and non-local bias. We demonstrate that the SSC obeys mathematical inequalities and positivity. Using the joint covariance matrix and a Fisher matrix methodology, we examine the prospects of combining these two probes to constrain cosmological and HOD parameters. We find that the combination indeed results in noticeably better constraints, with improvements of order 20% on cosmological parameters compared to the best single probe, and even greater improvement on HOD parameters, with reduction of error bars by a factor 1.4-4.8. This happens in particular because the cross-covariance introduces a synergy between the probes on small scales. We conclude that accounting for non-Gaussian effects is required for the joint analysis of these observables in galaxy surveys.

  15. Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Eriko Kage-Nakadai

    Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

  16. Advanced reliability improvement of AC-modules (ARIA)

    International Nuclear Information System (INIS)

    Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.

    2001-09-01

    The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string

  17. The first high resolution image of coronal gas in a starbursting cool core cluster

    Science.gov (United States)

    Johnson, Sean

    2017-08-01

    Galaxy clusters represent a unique laboratory for directly observing gas cooling and feedback due to their high masses and correspondingly high gas densities and temperatures. Cooling of X-ray gas observed in 1/3 of clusters, known as cool-core clusters, should fuel star formation at prodigious rates, but such high levels of star formation are rarely observed. Feedback from active galactic nuclei (AGN) is a leading explanation for the lack of star formation in most cool clusters, and AGN power is sufficient to offset gas cooling on average. Nevertheless, some cool core clusters exhibit massive starbursts indicating that our understanding of cooling and feedback is incomplete. Observations of 10^5 K coronal gas in cool core clusters through OVI emission offers a sensitive means of testing our understanding of cooling and feedback because OVI emission is a dominant coolant and sensitive tracer of shocked gas. Recently, Hayes et al. 2016 demonstrated that synthetic narrow-band imaging of OVI emission is possible through subtraction of long-pass filters with the ACS+SBC for targets at z=0.23-0.29. Here, we propose to use this exciting new technique to directly image coronal OVI emitting gas at high resolution in Abell 1835, a prototypical starbursting cool-core cluster at z=0.252. Abell 1835 hosts a strong cooling core, massive starburst, radio AGN, and at z=0.252, it offers a unique opportunity to directly image OVI at hi-res in the UV with ACS+SBC. With just 15 orbits of ACS+SBC imaging, the proposed observations will complete the existing rich multi-wavelength dataset available for Abell 1835 to provide new insights into cooling and feedback in clusters.

  18. Metal cluster compounds - chemistry and importance; clusters containing isolated main group element atoms, large metal cluster compounds, cluster fluxionality

    International Nuclear Information System (INIS)

    Walther, B.

    1988-01-01

    This part of the review on metal cluster compounds deals with clusters containing isolated main group element atoms, with high nuclearity clusters and metal cluster fluxionality. It will be obvious that main group element atoms strongly influence the geometry, stability and reactivity of the clusters. High nuclearity clusters are of interest in there own due to the diversity of the structures adopted, but their intermediate position between molecules and the metallic state makes them a fascinating research object too. These both sites of the metal cluster chemistry as well as the frequently observed ligand and core fluxionality are related to the cluster metal and surface analogy. (author)

  19. Disentangling Porterian Clusters

    DEFF Research Database (Denmark)

    Jagtfelt, Tue

    , contested theory become so widely disseminated and applied as a normative and prescriptive strategy for economic development? The dissertation traces the introduction of the cluster notion into the EU’s Lisbon Strategy and demonstrates how its inclusion originates from Porter’s colleagues: Professor Örjan...... to his membership on the Commission on Industrial Competitiveness, and that the cluster notion found in his influential book, Nations, represents a significant shift in his conception of cluster compared with his early conceptions. This shift, it is argued, is a deliberate attempt by Porter to create...... a paradigmatic textbook that follows Kuhn’s blueprint for scientific revolutions by instilling Nations with circular references and thus creating a local linguistic holism conceptualized through an encompassing notion of cluster. The dissertation concludes that the two research questions are philosophically...

  20. Remarks on stellar clusters

    International Nuclear Information System (INIS)

    Teller, E.

    1985-01-01

    In the following, a few simple remarks on the evolution and properties of stellar clusters will be collected. In particular, globular clusters will be considered. Though details of such clusters are often not known, a few questions can be clarified with the help of primitive arguments. These are:- why are spherical clusters spherical, why do they have high densities, why do they consist of approximately a million stars, how may a black hole of great mass form within them, may they be the origin of gamma-ray bursts, may their invisible remnants account for the missing mass of our galaxy. The available data do not warrant a detailed evaluation. However, it is remarkable that exceedingly simple models can shed some light on the questions enumerated above. (author)

  1. From collisions to clusters

    DEFF Research Database (Denmark)

    Loukonen, Ville; Bork, Nicolai; Vehkamaki, Hanna

    2014-01-01

    -principles molecular dynamics collision simulations of (sulphuric acid)1(water)0, 1 + (dimethylamine) → (sulphuric acid)1(dimethylamine)1(water)0, 1 cluster formation processes. The simulations indicate that the sticking factor in the collisions is unity: the interaction between the molecules is strong enough...... control. As a consequence, the clusters show very dynamic ion pair structure, which differs from both the static structure optimisation calculations and the equilibrium first-principles molecular dynamics simulations. In some of the simulation runs, water mediates the proton transfer by acting as a proton...... to overcome the possible initial non-optimal collision orientations. No post-collisional cluster break up is observed. The reasons for the efficient clustering are (i) the proton transfer reaction which takes place in each of the collision simulations and (ii) the subsequent competition over the proton...

  2. Clustering of Emerging Flux

    Science.gov (United States)

    Ruzmaikin, A.

    1997-01-01

    Observations show that newly emerging flux tends to appear on the Solar surface at sites where there is flux already. This results in clustering of solar activity. Standard dynamo theories do not predict this effect.

  3. How Clusters Work

    Science.gov (United States)

    Technology innovation clusters are geographic concentrations of interconnected companies, universities, and other organizations with a focus on environmental technology. They play a key role in addressing the nation’s pressing environmental problems.

  4. Evolution of clustered storage

    CERN Multimedia

    CERN. Geneva; Van de Vyvre, Pierre

    2007-01-01

    The session actually featured two presentations: * Evolution of clustered storage by Lance Hukill, Quantum Corporation * ALICE DAQ - Usage of a Cluster-File System: Quantum StorNext by Pierre Vande Vyvre, CERN-PH the second one prepared at short notice by Pierre (thanks!) to present how the Quantum technologies are being used in the ALICE experiment. The abstract to Mr Hukill's follows. Clustered Storage is a technology that is driven by business and mission applications. The evolution of Clustered Storage solutions starts first at the alignment between End-users needs and Industry trends: * Push-and-Pull between managing for today versus planning for tomorrow * Breaking down the real business problems to the core applications * Commoditization of clients, servers, and target devices * Interchangeability, Interoperability, Remote Access, Centralized control * Oh, and yes, there is a budget and the "real world" to deal with This presentation will talk through these needs and trends, and then ask the question, ...

  5. Galaxy clusters and cosmology

    CERN Document Server

    White, S

    1994-01-01

    Galaxy clusters are the largest coherent objects in Universe. It has been known since 1933 that their dynamical properties require either a modification of the theory of gravity, or the presence of a dominant component of unseen material of unknown nature. Clusters still provide the best laboratories for studying the amount and distribution of this dark matter relative to the material which can be observed directly -- the galaxies themselves and the hot,X-ray-emitting gas which lies between them.Imaging and spectroscopy of clusters by satellite-borne X -ray telescopes has greatly improved our knowledge of the structure and composition of this intergalactic medium. The results permit a number of new approaches to some fundamental cosmological questions,but current indications from the data are contradictory. The observed irregularity of real clusters seems to imply recent formation epochs which would require a universe with approximately the critical density. On the other hand, the large baryon fraction observ...

  6. Applications of Clustering

    Indian Academy of Sciences (India)

    First page Back Continue Last page Overview Graphics. Applications of Clustering. Biology – medical imaging, bioinformatics, ecology, phylogenies problems etc. Market research. Data Mining. Social Networks. Any problem measuring similarity/correlation. (dimensions represent different parameters)

  7. Clustering Game Behavior Data

    DEFF Research Database (Denmark)

    Bauckhage, C.; Drachen, Anders; Sifa, Rafet

    2015-01-01

    of the causes, the proliferation of behavioral data poses the problem of how to derive insights therefrom. Behavioral data sets can be large, time-dependent and high-dimensional. Clustering offers a way to explore such data and to discover patterns that can reduce the overall complexity of the data. Clustering...... and other techniques for player profiling and play style analysis have, therefore, become popular in the nascent field of game analytics. However, the proper use of clustering techniques requires expertise and an understanding of games is essential to evaluate results. With this paper, we address game data...... scientists and present a review and tutorial focusing on the application of clustering techniques to mine behavioral game data. Several algorithms are reviewed and examples of their application shown. Key topics such as feature normalization are discussed and open problems in the context of game analytics...

  8. Clustering on Membranes

    DEFF Research Database (Denmark)

    Johannes, Ludger; Pezeshkian, Weria; Ipsen, John H

    2018-01-01

    Clustering of extracellular ligands and proteins on the plasma membrane is required to perform specific cellular functions, such as signaling and endocytosis. Attractive forces that originate in perturbations of the membrane's physical properties contribute to this clustering, in addition to direct...... protein-protein interactions. However, these membrane-mediated forces have not all been equally considered, despite their importance. In this review, we describe how line tension, lipid depletion, and membrane curvature contribute to membrane-mediated clustering. Additional attractive forces that arise...... from protein-induced perturbation of a membrane's fluctuations are also described. This review aims to provide a survey of the current understanding of membrane-mediated clustering and how this supports precise biological functions....

  9. Air void clustering.

    Science.gov (United States)

    2015-06-01

    Air void clustering around coarse aggregate in concrete has been identified as a potential source of : low strengths in concrete mixes by several Departments of Transportation around the country. Research was : carried out to (1) develop a quantitati...

  10. Speaker segmentation and clustering

    OpenAIRE

    Kotti, M; Moschou, V; Kotropoulos, C

    2008-01-01

    07.08.13 KB. Ok to add the accepted version to Spiral, Elsevier says ok whlile mandate not enforced. This survey focuses on two challenging speech processing topics, namely: speaker segmentation and speaker clustering. Speaker segmentation aims at finding speaker change points in an audio stream, whereas speaker clustering aims at grouping speech segments based on speaker characteristics. Model-based, metric-based, and hybrid speaker segmentation algorithms are reviewed. Concerning speaker...

  11. Fermion cluster algorithms

    International Nuclear Information System (INIS)

    Chandrasekharan, Shailesh

    2000-01-01

    Cluster algorithms have been recently used to eliminate sign problems that plague Monte-Carlo methods in a variety of systems. In particular such algorithms can also be used to solve sign problems associated with the permutation of fermion world lines. This solution leads to the possibility of designing fermion cluster algorithms in certain cases. Using the example of free non-relativistic fermions we discuss the ideas underlying the algorithm

  12. BUILDING e-CLUSTERS

    OpenAIRE

    Milan Davidovic

    2013-01-01

    E-clusters are strategic alliance in TIMES technology sector (Telecommunication, Information technology, Multimedia, Entertainment, Security) where products and processes are digitalized. They enable horizontal and vertical integration of small and medium companies and establish new added value e-chains. E-clusters also build supply chains based on cooperation relationship, innovation, organizational knowledge and compliance of intellectual properties. As an innovative approach for economic p...

  13. Clusters and exotic processes

    International Nuclear Information System (INIS)

    Schiffer, J.P.

    1975-01-01

    An attempt is made to present some data which may be construed as indicating that perhaps clusters play a role in high energy and exotic pion or kaon interactions with complex (A much greater than 16) nuclei. Also an attempt is made to summarize some very recent experimental work on pion interactions with nuclei which may or may not in the end support a picture in which clusters play an important role. (U.S.)

  14. Robust continuous clustering.

    Science.gov (United States)

    Shah, Sohil Atul; Koltun, Vladlen

    2017-09-12

    Clustering is a fundamental procedure in the analysis of scientific data. It is used ubiquitously across the sciences. Despite decades of research, existing clustering algorithms have limited effectiveness in high dimensions and often require tuning parameters for different domains and datasets. We present a clustering algorithm that achieves high accuracy across multiple domains and scales efficiently to high dimensions and large datasets. The presented algorithm optimizes a smooth continuous objective, which is based on robust statistics and allows heavily mixed clusters to be untangled. The continuous nature of the objective also allows clustering to be integrated as a module in end-to-end feature learning pipelines. We demonstrate this by extending the algorithm to perform joint clustering and dimensionality reduction by efficiently optimizing a continuous global objective. The presented approach is evaluated on large datasets of faces, hand-written digits, objects, newswire articles, sensor readings from the Space Shuttle, and protein expression levels. Our method achieves high accuracy across all datasets, outperforming the best prior algorithm by a factor of 3 in average rank.

  15. Cluster bomb ocular injuries.

    Science.gov (United States)

    Mansour, Ahmad M; Hamade, Haya; Ghaddar, Ayman; Mokadem, Ahmad Samih; El Hajj Ali, Mohamad; Awwad, Shady

    2012-01-01

    To present the visual outcomes and ocular sequelae of victims of cluster bombs. This retrospective, multicenter case series of ocular injury due to cluster bombs was conducted for 3 years after the war in South Lebanon (July 2006). Data were gathered from the reports to the Information Management System for Mine Action. There were 308 victims of clusters bombs; 36 individuals were killed, of which 2 received ocular lacerations and; 272 individuals were injured with 18 receiving ocular injury. These 18 surviving individuals were assessed by the authors. Ocular injury occurred in 6.5% (20/308) of cluster bomb victims. Trauma to multiple organs occurred in 12 of 18 cases (67%) with ocular injury. Ocular findings included corneal or scleral lacerations (16 eyes), corneal foreign bodies (9 eyes), corneal decompensation (2 eyes), ruptured cataract (6 eyes), and intravitreal foreign bodies (10 eyes). The corneas of one patient had extreme attenuation of the endothelium. Ocular injury occurred in 6.5% of cluster bomb victims and 67% of the patients with ocular injury sustained trauma to multiple organs. Visual morbidity in civilians is an additional reason for a global ban on the use of cluster bombs.

  16. Determination of atomic cluster structure with cluster fusion algorithm

    DEFF Research Database (Denmark)

    Obolensky, Oleg I.; Solov'yov, Ilia; Solov'yov, Andrey V.

    2005-01-01

    We report an efficient scheme of global optimization, called cluster fusion algorithm, which has proved its reliability and high efficiency in determination of the structure of various atomic clusters.......We report an efficient scheme of global optimization, called cluster fusion algorithm, which has proved its reliability and high efficiency in determination of the structure of various atomic clusters....

  17. Context based computational analysis and characterization of ARS consensus sequences (ACS of Saccharomyces cerevisiae genome

    Directory of Open Access Journals (Sweden)

    Vinod Kumar Singh

    2016-09-01

    Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.

  18. Analytical solution of the PNP equations at AC applied voltage

    International Nuclear Information System (INIS)

    Golovnev, Anatoly; Trimper, Steffen

    2012-01-01

    A symmetric binary polymer electrolyte subjected to an AC voltage is considered. The analytical solution of the Poisson–Nernst–Planck equations (PNP) is found and analyzed for small applied voltages. Three distinct time regimes offering different behavior can be discriminated. The experimentally realized stationary behavior is discussed in detail. An expression for the external current is derived. Based on the theoretical result a simple method is suggested of measuring the ion mobility and their concentration separately. -- Highlights: ► Analytical solution of Poisson–Nernst–Planck equations. ► Binary polymer electrolyte subjected to an external AC voltage. ► Three well separated time scales exhibiting different behavior. ► The experimentally realized stationary behavior is discussed in detail. ► A method is proposed measuring the mobility and the concentration separately.

  19. SNL software manual for the ACS Data Analytics Project.

    Energy Technology Data Exchange (ETDEWEB)

    Stearley, Jon R.; McLendon, William Clarence, III; Rodrigues, Arun F.; Williams, Aaron S.; Hooper, Russell Warren; Robinson, David Gerald; Stickland, Michael G.

    2011-10-01

    In the ACS Data Analytics Project (also known as 'YumYum'), a supercomputer is modeled as a graph of components and dependencies, jobs and faults are simulated, and component fault rates are estimated using the graph structure and job pass/fail outcomes. This report documents the successful completion of all SNL deliverables and tasks, describes the software written by SNL for the project, and presents the data it generates. Readers should understand what the software tools are, how they fit together, and how to use them to reproduce the presented data and additional experiments as desired. The SNL YumYum tools provide the novel simulation and inference capabilities desired by ACS. SNL also developed and implemented a new algorithm, which provides faster estimates, at finer component granularity, on arbitrary directed acyclic graphs.

  20. Security analysis of interconnected AC/DC systems

    DEFF Research Database (Denmark)

    Eriksson, Robert

    2015-01-01

    This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid...... any line or transformer limits. Simulations were performed in a model of the Nordic power system where a dc grid is placed on top. The simulation supports the method as a tool to consider transfer limits in the grid to avoid violate the same and increase the security after a converter outage........ The redistribution of power has a sudden effect on the power-flow in the interconnected ac system. This may cause overloading of lines and transformers resulting in disconnection of equipment, and as a consequence cascading failure. The PTDF is used as a method to analyze and avoid violating limits by in the dc...

  1. Development of AC-DC power system simulator

    International Nuclear Information System (INIS)

    Ichikawa, Tatsumi; Ueda, Kiyotaka; Inoue, Toshio

    1984-01-01

    A modeling and realization technique is described for realtime plant dynamics simulation of nuclear power generating unit in AC-DC power system simulator. Dynamic behavior of reactor system and steam system is important for investigation a further adequate unit control and protection system to system faults in AC and DC power system. Each unit of two nuclear power generating unit in the power system simulator consists of micro generator, DC motors, flywheels and process computer. The DC motor and flywheel simulates dynamic characteristics of steam turbine, and process computer simulates plant dynamics by digital simulation. We have realized real-time plant dynamics simulation by utilizing a high speed process I/O and a high speed digital differential analyzing processor (DDA) in which we builted a newly developed simple plant model. (author)

  2. Autonomous power management for interlinked AC-DC microgrids

    DEFF Research Database (Denmark)

    Nutkani, Inam Ullah; Meegahapola, Lasantha; Andrew, Loh Poh Chiang

    2018-01-01

    of the DC micro-grid before importing power from the interlinked AC microgrid. This strategy enables voltage regulation in the DC microgrid, and also reduces the number of converters in operation. The proposed scheme is fully autonomous while it retains the plug-n-play features for generators and tie......The existing power management schemes for inter-linked AC-DC microgrids have several operational drawbacks. Some of the existing control schemes are designed with the main objective of sharing power among the interlinked microgrids based on their loading conditions, while other schemes regulate...... the voltage of the interlinked microgrids without considering the specific loading conditions. However, the existing schemes cannot achieve both objectives efficiently. To address these issues, an autonomous power management scheme is proposed, which explicitly considers the specific loading condition...

  3. Offshore windfarm connection with low frequency AC transmission technology

    DEFF Research Database (Denmark)

    Qin, Nan; Xu, Zhao; You, Shi

    2009-01-01

    This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared...... to the conventional AC solution at the nominal frequency, e.g. 50 Hz or 60 Hz. and reduces the investment cost compared to the HVDC solution. It is estimated that the LFAC system is competitive in the transmission distance of about 30-150 km. The simulation model of the wind integration using the LFAC system has been...... developed, which consists of three parts, the fixed-speed wind turbine representing a wind farm, the transmission line and the frequency converter. Although the transmission capability is greatly improved by the LFAC system, simulation shows it gives negative influences on the wind turbine operation due...

  4. Design and AC loss analysis of a superconducting synchronous motor

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Q [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Majoros, M [Department of Materials Science and Engineering, Ohio State University (United States); Hong, Z [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Campbell, A M [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Coombs, T A [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom)

    2006-11-15

    This paper gives a conceptual design of a superconducting synchronous motor consisting of both high-temperature superconducting rotating field winding and armature winding. The AC losses of the armature winding of the motor have been investigated experimentally and numerically, by considering the self-field of the superconducting coils and the rotating magnetic field exposed on the armature winding. The recent developments of YBCO-coated conductors present the possibility of achieving a wholly superconducting machine of significantly smaller size and weight than a conventional machine. Both the rotating field winding and the armature winding are composed of YBCO high-temperature superconducting (HTS) coils. A low AC loss armature winding design has been developed for this superconducting synchronous motor. The performance of the machine was investigated by modelling with the finite-element method. The machine's torque is calculated from first principles by considering the angle between the field and the armature main flux lines.

  5. Indoor Air Pollution in Non Ac Passenger Bus

    Science.gov (United States)

    El Husna, Iksiroh; Unzilatirrizqi, Rizal D. Yan El; Karyanto, Yudi; Sunoko, Henna R.

    2018-02-01

    Passenger buses have been one of favorite means of transportation in Indonesia due to its affordability and flexibility. Intensity of human activities during the trip in the buses have a potential of causing indoor air pollution (polusi udara dalam ruang; PUDR). The indoor air pollution has an impact of 1000-time bigger than outdoor air pollution (polusi udara luar ruang; PULR) on lung. This study aimed to find out indoor air pollution rate of non air conditioned buses using an approach to biological agent pollutant source. The study applied an analysis restricted to microorganisms persistence as one of the sources of the indoor air pollution. The media were placed in different parts of the non AC buses. This study revealed that fungs were found in the non AC buses. They became contaminants and developed pathogenic bacteria that caused air pollution.

  6. On-Chip AC self-test controller

    Science.gov (United States)

    Flanagan, John D [Rhinebeck, NY; Herring, Jay R [Poughkeepsie, NY; Lo, Tin-Chee [Fishkill, NY

    2009-09-29

    A system for performing AC self-test on an integrated circuit that includes a system clock for normal operation is provided. The system includes the system clock, self-test circuitry, a first and second test register to capture and launch test data in response to a sequence of data pulses, and a logic circuit to be tested. The self-test circuitry includes an AC self-test controller and a clock splitter. The clock splitter generates the sequence of data pulses including a long data capture pulse followed by an at speed data launch pulse and an at speed data capture pulse followed by a long data launch pulse. The at speed data launch pulse and the at speed data capture pulse are generated for a common cycle of the system clock.

  7. Development of Nb3Sn AC superconducting wire. Pt. 2

    International Nuclear Information System (INIS)

    Kasahara, Hobun; Torii, Shinji; Akita, Shirabe; Ueda, Kiyotaka; Kubota, Yoji; Yasohama, Kazuhiko; Kobayashi, Hisayasu; Ogasawara, Takeshi.

    1993-01-01

    For the realization of superconducting power apparatus, it is important that the development of highly stable superconducting cables. Nb 3 Sn wire has higher critical temperature than NbTi wire. Therefore, it is possible to make highly stable superconducting wires. In this report, we examine a manufacturing process of Ac Nb 3 Sn wire. This manufacturing process has four times higher critical current density than conventional processes. We have made a 400 kVA class AC coil with React and Wind method. The loss density of this coil was 20MW/m 3 at just before the quench. In this case, the temperature of cable increased about 3.8 K. This means that the Nb 3 Sn coil has a very high stability. (author)

  8. ac power control in the Core Flow Test Loop

    International Nuclear Information System (INIS)

    McDonald, D.W.

    1980-01-01

    This work represents a status report on a development effort to design an ac power controller for the Core Flow Test Loop. The Core Flow Test Loop will be an engineering test facility which will simulate the thermal environment of a gas-cooled fast-breeder reactor. The problems and limitations of using sinusoidal ac power to simulate the power generated within a nuclear reactor are addressed. The transformer-thyristor configuration chosen for the Core Flow Test Loop power supply is presented. The initial considerations, design, and analysis of a closed-loop controller prototype are detailed. The design is then analyzed for improved performance possibilities and failure modes are investigated at length. A summary of the work completed to date and a proposed outline for continued development completes the report

  9. 27-Level DC–AC inverter with single energy source

    International Nuclear Information System (INIS)

    Tsang, K.M.; Chan, W.L.

    2012-01-01

    Highlights: ► This paper reports a novel 27-level DC–AC inverter using only single renewable energy source. ► The efficiency of the inverter is very high. The output waveform is almost sinusoidal. ► The cost is low as the number of power switches required is only 12. - Abstract: A novel design of multilevel DC–AC inverter using only single renewable energy source is presented in this paper. The proposed approach enables multilevel output to be realised by a few cascaded H-bridges and a single energy source. As an illustration, a 27-level inverter has been implemented based on three cascaded H-bridges with a single energy source and two capacitors. Using the proposed novel switching strategy, 27 levels can be realized and the two virtual energy sources can be well regulated. Experimental results are included to demonstrate the effectiveness of the proposed inverter.

  10. Indoor Air Pollution in Non Ac Passenger Bus

    Directory of Open Access Journals (Sweden)

    El Husna Iksiroh

    2018-01-01

    Full Text Available Passenger buses have been one of favorite means of transportation in Indonesia due to its affordability and flexibility. Intensity of human activities during the trip in the buses have a potential of causing indoor air pollution (polusi udara dalam ruang; PUDR. The indoor air pollution has an impact of 1000-time bigger than outdoor air pollution (polusi udara luar ruang; PULR on lung. This study aimed to find out indoor air pollution rate of non air conditioned buses using an approach to biological agent pollutant source. The study applied an analysis restricted to microorganisms persistence as one of the sources of the indoor air pollution. The media were placed in different parts of the non AC buses. This study revealed that fungs were found in the non AC buses. They became contaminants and developed pathogenic bacteria that caused air pollution.

  11. Spectroscopic AC susceptibility imaging (sASI) of magnetic nanoparticles

    International Nuclear Information System (INIS)

    Ficko, Bradley W.; Nadar, Priyanka M.; Diamond, Solomon G.

    2015-01-01

    This study demonstrates a method for alternating current (AC) susceptibility imaging (ASI) of magnetic nanoparticles (mNPs) using low cost instrumentation. The ASI method uses AC magnetic susceptibility measurements to create tomographic images using an array of drive coils, compensation coils and fluxgate magnetometers. Using a spectroscopic approach in conjunction with ASI, a series of tomographic images can be created for each frequency measurement set and is termed sASI. The advantage of sASI is that mNPs can be simultaneously characterized and imaged in a biological medium. System calibration was performed by fitting the in-phase and out-of-phase susceptibility measurements of an mNP sample with a hydrodynamic diameter of 100 nm to a Brownian relaxation model (R 2 =0.96). Samples of mNPs with core diameters of 10 and 40 nm and a sample of 100 nm hydrodynamic diameter were prepared in 0.5 ml tubes. Three mNP samples were arranged in a randomized array and then scanned using sASI with six frequencies between 425 and 925 Hz. The sASI scans showed the location and quantity of the mNP samples (R 2 =0.97). Biological compatibility of the sASI method was demonstrated by scanning mNPs that were injected into a pork sausage. The mNP response in the biological medium was found to correlate with a calibration sample (R 2 =0.97, p<0.001). These results demonstrate the concept of ASI and advantages of sASI. - Highlights: • Development of an AC susceptibility imaging model. • Comparison of AC susceptibility imaging (ASI) and susceptibility magnitude imaging (SMI). • Demonstration of ASI and spectroscopic ASI (sASI) using three different magnetic nanoparticle types. • SASI scan separation of three different magnetic nanoparticles samples using 5 spectroscopic frequencies. • Demonstration of biological feasibility of sASI

  12. AC electrical conductivity in amorphous indium selenide thin films

    International Nuclear Information System (INIS)

    Di Giulio, H.; Rella, R.; Tepore, A.

    1987-01-01

    In order to obtain additional information about the nature of the conduction mechanism in amorphous InSe films results of an experimental study concerning the frequency and temperature dependence of the ac conductivity are reported. The measurements were performed on specimens of different thickness and different electrode contact areas. The results can be explained assuming that conduction occurs by phonon-assisted hopping between localized states near the Fermi level

  13. DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-05-01

    Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.

  14. AC system stabilization via phase shift transformer with thyristor commutation

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Jose Carlos de; Guimaraes, Geraldo Caixeta; Moraes, Adelio Jose [Uberlandia Univ., MG (Brazil); Abreu, Jose Policarpo G. de [Escola Federal de Engenharia de Itajuba, MG (Brazil); Oliveira, Edimar Jose de [Juiz de Fora Univ., MG (Brazil)

    1994-12-31

    This article aims to present initially the constructive and operative forms of a phase-shift autotransformer which provides both magnitude and phase angle change through thyristor commutation, including a technic to reduce the number of thyristors. Following, it is proposed a control system to make such equipment an efficient AC system stabilizing tool. It is presented some simulation results to show the operation of this transformer in an electrical system. (author) 3 refs., 11 figs., 3 tabs.

  15. Hybrid immersed interface-immersed boundary methods for AC dielectrophoresis

    International Nuclear Information System (INIS)

    Hossan, Mohammad Robiul; Dillon, Robert; Dutta, Prashanta

    2014-01-01

    Dielectrophoresis, a nonlinear electrokinetic transport mechanism, has become popular in many engineering applications including manipulation, characterization and actuation of biomaterials, particles and biological cells. In this paper, we present a hybrid immersed interface–immersed boundary method to study AC dielectrophoresis where an algorithm is developed to solve the complex Poisson equation using a real variable formulation. An immersed interface method is employed to obtain the AC electric field in a fluid media with suspended particles and an immersed boundary method is used for the fluid equations and particle transport. The convergence of the proposed algorithm as well as validation of the hybrid scheme with experimental results is presented. In this paper, the Maxwell stress tensor is used to calculate the dielectrophoretic force acting on particles by considering the physical effect of particles in the computational domain. Thus, this study eliminates the approximations used in point dipole methods for calculating dielectrophoretic force. A comparative study between Maxwell stress tensor and point dipole methods for computing dielectrophoretic forces are presented. The hybrid method is used to investigate the physics of dielectrophoresis in microfluidic devices using an AC electric field. The numerical results show that with proper design and appropriate selection of applied potential and frequency, global electric field minima can be obtained to facilitate multiple particle trapping by exploiting the mechanism of negative dielectrophoresis. Our numerical results also show that electrically neutral particles form a chain parallel to the applied electric field irrespective of their initial orientation when an AC electric field is applied. This proposed hybrid numerical scheme will help to better understand dielectrophoresis and to design and optimize microfluidic devices

  16. MD 349: Impedance Localization with AC-dipole

    CERN Document Server

    Biancacci, Nicolo; Metral, Elias; Salvant, Benoit; Papotti, Giulia; Persson, Tobias Hakan Bjorn; Tomas Garcia, Rogelio; CERN. Geneva. ATS Department

    2016-01-01

    The purpose of this MD is to measure the distribution of the transverse impedance of the LHC by observing the phase advance variation with intensity between the machine BPMs. Four injected bunches with different intensities are excited with an AC dipole and the turn by turn data is acquired from the BPM system. Through post-processing analysis the phase variation along the machine is depicted and, from this information, first conclusions of the impedance distribution can be drawn.

  17. Travel Support for Scientists to Participate in ACS Symposium

    Science.gov (United States)

    2017-08-31

    ESPCI- Paris , France) at the 252nd ACS National Meeting in Philadelphia, Aug 21-25, 2016. In this two-day event, we have 30 oral presentations (17...Scott Grayson (Tulane University), Prof. Jemeriah Johnson (MIT), Prof. Julien Nicolas (Université Paris -Sud). Training Opportunities: Among the 30...polymer catalysts, to self-healing materials and pollution salvation materials. On this aspect, both academia and industrial laboratories have reached

  18. Cluster dynamics at different cluster size and incident laser wavelengths

    International Nuclear Information System (INIS)

    Desai, Tara; Bernardinello, Andrea

    2002-01-01

    X-ray emission spectra from aluminum clusters of diameter -0.4 μm and gold clusters of dia. ∼1.25 μm are experimentally studied by irradiating the cluster foil targets with 1.06 μm laser, 10 ns (FWHM) at an intensity ∼10 12 W/cm 2 . Aluminum clusters show a different spectra compared to bulk material whereas gold cluster evolve towards bulk gold. Experimental data are analyzed on the basis of cluster dimension, laser wavelength and pulse duration. PIC simulations are performed to study the behavior of clusters at higher intensity I≥10 17 W/cm 2 for different size of the clusters irradiated at different laser wavelengths. Results indicate the dependence of cluster dynamics on cluster size and incident laser wavelength

  19. Cluster fusion algorithm: application to Lennard-Jones clusters

    DEFF Research Database (Denmark)

    Solov'yov, Ilia; Solov'yov, Andrey V.; Greiner, Walter

    2006-01-01

    paths up to the cluster size of 150 atoms. We demonstrate that in this way all known global minima structures of the Lennard-Jones clusters can be found. Our method provides an efficient tool for the calculation and analysis of atomic cluster structure. With its use we justify the magic number sequence......We present a new general theoretical framework for modelling the cluster structure and apply it to description of the Lennard-Jones clusters. Starting from the initial tetrahedral cluster configuration, adding new atoms to the system and absorbing its energy at each step, we find cluster growing...... for the clusters of noble gas atoms and compare it with experimental observations. We report the striking correspondence of the peaks in the dependence of the second derivative of the binding energy per atom on cluster size calculated for the chain of the Lennard-Jones clusters based on the icosahedral symmetry...

  20. Cluster fusion algorithm: application to Lennard-Jones clusters

    DEFF Research Database (Denmark)

    Solov'yov, Ilia; Solov'yov, Andrey V.; Greiner, Walter

    2008-01-01

    paths up to the cluster size of 150 atoms. We demonstrate that in this way all known global minima structures of the Lennard-Jones clusters can be found. Our method provides an efficient tool for the calculation and analysis of atomic cluster structure. With its use we justify the magic number sequence......We present a new general theoretical framework for modelling the cluster structure and apply it to description of the Lennard-Jones clusters. Starting from the initial tetrahedral cluster configuration, adding new atoms to the system and absorbing its energy at each step, we find cluster growing...... for the clusters of noble gas atoms and compare it with experimental observations. We report the striking correspondence of the peaks in the dependence of the second derivative of the binding energy per atom on cluster size calculated for the chain of the Lennard-Jones clusters based on the icosahedral symmetry...

  1. New Subarray Readout Patterns for the ACS Wide Field Channel

    Science.gov (United States)

    Golimowski, D.; Anderson, J.; Arslanian, S.; Chiaberge, M.; Grogin, N.; Lim, Pey Lian; Lupie, O.; McMaster, M.; Reinhart, M.; Schiffer, F.; Serrano, B.; Van Marshall, M.; Welty, A.

    2017-04-01

    At the start of Cycle 24, the original CCD-readout timing patterns used to generate ACS Wide Field Channel (WFC) subarray images were replaced with new patterns adapted from the four-quadrant readout pattern used to generate full-frame WFC images. The primary motivation for this replacement was a substantial reduction of observatory and staff resources needed to support WFC subarray bias calibration, which became a new and challenging obligation after the installation of the ACS CCD Electronics Box Replacement during Servicing Mission 4. The new readout patterns also improve the overall efficiency of observing with WFC subarrays and enable the processing of subarray images through stages of the ACS data calibration pipeline (calacs) that were previously restricted to full-frame WFC images. The new readout patterns replace the original 512×512, 1024×1024, and 2048×2046-pixel subarrays with subarrays having 2048 columns and 512, 1024, and 2048 rows, respectively. Whereas the original square subarrays were limited to certain WFC quadrants, the new rectangular subarrays are available in all four quadrants. The underlying bias structure of the new subarrays now conforms with those of the corresponding regions of the full-frame image, which allows raw frames in all image formats to be calibrated using one contemporaneous full-frame "superbias" reference image. The original subarrays remain available for scientific use, but calibration of these image formats is no longer supported by STScI.

  2. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan

    2015-04-01

    Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the

  3. AC Electric Field Communication for Human-Area Networking

    Science.gov (United States)

    Kado, Yuichi; Shinagawa, Mitsuru

    We have proposed a human-area networking technology that uses the surface of the human body as a data transmission path and uses an AC electric field signal below the resonant frequency of the human body. This technology aims to achieve a “touch and connect” intuitive form of communication by using the electric field signal that propagates along the surface of the human body, while suppressing both the electric field radiating from the human body and mutual interference. To suppress the radiation field, the frequency of the AC signal that excites the transmitter electrode must be lowered, and the sensitivity of the receiver must be raised while reducing transmission power to its minimally required level. We describe how we are developing AC electric field communication technologies to promote the further evolution of a human-area network in support of ubiquitous services, focusing on three main characteristics, enabling-transceiver technique, application-scenario modeling, and communications quality evaluation. Special attention is paid to the relationship between electro-magnetic compatibility evaluation and regulations for extremely low-power radio stations based on Japan's Radio Law.

  4. DC response of dust to low frequency AC signals

    Science.gov (United States)

    McKinlay, Michael; Konopka, Uwe; Thomas, Edward

    2017-10-01

    Macroscopic changes in the shape and equilibrium position of clouds of charged microparticles suspended in a plasma have been observed in response to low frequency AC signals. In these experiments, dusty plasmas consisting of 2-micron diameter silica microspheres suspended between an anode and cathode in an argon, DC glow discharge plasma are produced in a grounded, 6-way cross vacuum chamber. An AC signal, produced by a function generator and amplified by a bipolar op-amp, is superimposed onto the potential from the cathode. The frequencies of the applied AC signals, ranging from tens to hundreds of kHz, are comparable to the ion-neutral collision frequency; well below the ion/electron plasma frequencies, but also considerably higher than the dust plasma frequency. This presentation will detail the experimental setup, present documentation and categorization of observations of the dust response, and present an initial model of the response. This work is supported by funding from the US Dept. of Energy, Grant Number DE-SC0016330, and by the National Science Foundation, Grant Number PHY-1613087.

  5. AC Conductivity and Dielectric Properties of Borotellurite Glass

    Science.gov (United States)

    Taha, T. A.; Azab, A. A.

    2016-10-01

    Borotellurite glasses with formula 60B2O3-10ZnO-(30 - x)NaF- xTeO2 ( x = 0 mol.%, 5 mol.%, 10 mol.%, and 15 mol.%) have been synthesized by thermal melting. X-ray diffraction (XRD) analysis confirmed that the glasses were amorphous. The glass density ( ρ) was determined by the Archimedes method at room temperature. The density ( ρ) and molar volume ( V m) were found to increase with increasing TeO2 content. The direct-current (DC) conductivity was measured in the temperature range from 473 K to 623 K, in which the electrical activation energy of ionic conduction increased from 0.27 eV to 0.48 eV with increasing TeO2 content from 0 mol.% to 15 mol.%. The dielectric parameters and alternating-current (AC) conductivity ( σ ac) were investigated in the frequency range from 1 kHz to 1 MHz and temperature range from 300 K to 633 K. The AC conductivity and dielectric constant decreased with increasing TeO2 content from 0 mol.% to 15 mol.%.

  6. The ACS-NUCL Division 50th Anniversary: Introduction

    Energy Technology Data Exchange (ETDEWEB)

    Hobart, David E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-01-10

    The ACS Division of Nuclear Chemistry and Technology was initiated in 1955 as a subdivision of the Division of Industrial and Engineering Chemistry. Probationary divisional status was lifted in 1965. The Division’s first symposium was held in Denver in 1964 and it is fitting that we kicked-off the 50th Anniversary in Denver in the spring of 2015. Listed as a small ACS Division with only about 1,000 members, NUCL’s impact over the past fifty years has been remarkable. National ACS meetings have had many symposia sponsored or cosponsored by NUCL that included Nobel Laureates, U.S. Senators, other high-ranking officials and many students as speakers. The range of subjects has been exceptional as are the various prestigious awards established by the Division. Of major impact has been the past 30 years of the NUCL Nuclear Chemistry Summer Schools to help fill the void of qualified nuclear scientists and technicians. In celebrating the 50th Anniversary we honor the past, celebrate the present and shape the future of the Division and nuclear science and technology. To celebrate this auspicious occasion a commemorative lapel pin has been designed for distribution to NUCL Division members.

  7. Topologically protected loop flows in high voltage AC power grids

    International Nuclear Information System (INIS)

    Coletta, T; Delabays, R; Jacquod, Ph; Adagideli, I

    2016-01-01

    Geographical features such as mountain ranges or big lakes and inland seas often result in large closed loops in high voltage AC power grids. Sizable circulating power flows have been recorded around such loops, which take up transmission line capacity and dissipate but do not deliver electric power. Power flows in high voltage AC transmission grids are dominantly governed by voltage angle differences between connected buses, much in the same way as Josephson currents depend on phase differences between tunnel-coupled superconductors. From this previously overlooked similarity we argue here that circulating power flows in AC power grids are analogous to supercurrents flowing in superconducting rings and in rings of Josephson junctions. We investigate how circulating power flows can be created and how they behave in the presence of ohmic dissipation. We show how changing operating conditions may generate them, how significantly more power is ohmically dissipated in their presence and how they are topologically protected, even in the presence of dissipation, so that they persist when operating conditions are returned to their original values. We identify three mechanisms for creating circulating power flows, (i) by loss of stability of the equilibrium state carrying no circulating loop flow, (ii) by tripping of a line traversing a large loop in the network and (iii) by reclosing a loop that tripped or was open earlier. Because voltages are uniquely defined, circulating power flows can take on only discrete values, much in the same way as circulation around vortices is quantized in superfluids. (paper)

  8. AC electric field induced vortex in laminar coflow diffusion flames

    KAUST Repository

    Xiong, Yuan; Cha, Min; Chung, Suk-Ho

    2014-01-01

    Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.

  9. Simulation of the AC corona phenomenon with experimental validation

    International Nuclear Information System (INIS)

    Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R

    2017-01-01

    The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach. (paper)

  10. AC-600 passive containment cooling system performance research

    International Nuclear Information System (INIS)

    Jia Baoshan; Yu Jiyang; Shi Junying

    1997-01-01

    a code named PCCSAC which is able to predict both the evaporating film on the outside surface of the vessel and the condensed film on its inside is developed successfully. It is a special software tool to analyze the passive containment cooling system (PCCS) performance in the design of AC-600. The author includes the establishment of physical models, selection of numerical methods, debugging and verification of the code and application of the code in the AC-600 PCCS. In physical models, the fundamental conservation equations about various areas and heat conduction equations are established. In order to make the equations to meet the closed form of solution, a lot of structure formulae are complemented. After repeated selection and demonstration of the numerical methods, the backward difference method Gear which is generally used for stiff problem is chosen for the solution of ordinary differential equations derived from the physical models. The results of standard example calculated by the PCCSAC code and the COMMIX code which is used to analyze westinghouse AP-600 are same in the main. The reliability and validity are verified from the calculations. The PCCSAC code is applied in the calculations of two important LOCA used in the containment safety analyses. The sensitivity of main parameters in the system based on LOCA are studied. All the results are reasonable and in agreement with the theoretical analyses. It can be concluded that the PCCSAC code is able to be used for the analyses of AC-600 PCCS performance

  11. AC electric field induced vortex in laminar coflow diffusion flames

    KAUST Repository

    Xiong, Yuan

    2014-09-22

    Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.

  12. Metallicity Spreads in M31 Globular Clusters

    Science.gov (United States)

    Bridges, Terry

    2003-07-01

    Our recent deep HST photometry of the M31 halo globular cluster {GC} Mayall II, also called G1, has revealed a red-giant branch with a clear spread that we attribute to an intrinsic metallicity dispersion of at least 0.4 dex in [Fe/H]. The only other GC exhibiting such a metallicity dispersion is Omega Centauri, the brightest and most massive Galactic GC, whose range in [Fe/H] is about 0.5 dex. These observations are obviously linked to the fact that both G1 and Omega Cen are bright and massive GC, with potential wells deep enough to keep part of their gas, which might have been recycled, producing a metallicity scatter among cluster stars. These observations dramatically challenge the notion of chemical homogeneity as a defining characteristic of GCs. It is critically important to find out how common this phenomenon is and how it can constrain scenarios/models of GC formation. The obvious targets are other bright and massive GCs, which exist in M31 but not in our Galaxy where Omega Cen is an isolated giant. We propose to acquire, with ACS/HRC, deep imaging of 3 of the brightest M31 GCs for which we have observed velocity dispersion values similar to those observed in G1 and Omega Cen. A sample of GCs with chemical abundance dispersions will provide essential information about their formation mechanism. This would represent a major step for the studies of the origin and evolution of stellar populations.

  13. GibbsCluster: unsupervised clustering and alignment of peptide sequences

    DEFF Research Database (Denmark)

    Andreatta, Massimo; Alvarez, Bruno; Nielsen, Morten

    2017-01-01

    motif characterizing each cluster. Several parameters are available to customize cluster analysis, including adjustable penalties for small clusters and overlapping groups and a trash cluster to remove outliers. As an example application, we used the server to deconvolute multiple specificities in large......-scale peptidome data generated by mass spectrometry. The server is available at http://www.cbs.dtu.dk/services/GibbsCluster-2.0....

  14. Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi

    Directory of Open Access Journals (Sweden)

    Rudy Ariyanto

    2017-11-01

    Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu

  15. Cluster Implantation and Deposition Apparatus

    DEFF Research Database (Denmark)

    Hanif, Muhammad; Popok, Vladimir

    2015-01-01

    In the current report, a design and capabilities of a cluster implantation and deposition apparatus (CIDA) involving two different cluster sources are described. The clusters produced from gas precursors (Ar, N etc.) by PuCluS-2 can be used to study cluster ion implantation in order to develop...

  16. Subspace K-means clustering

    NARCIS (Netherlands)

    Timmerman, Marieke E.; Ceulemans, Eva; De Roover, Kim; Van Leeuwen, Karla

    2013-01-01

    To achieve an insightful clustering of multivariate data, we propose subspace K-means. Its central idea is to model the centroids and cluster residuals in reduced spaces, which allows for dealing with a wide range of cluster types and yields rich interpretations of the clusters. We review the

  17. The Use of AC-DC-AC Methods in Assessing Corrosion Resistance Performance of Coating Systems for Magnesium Alloys

    Science.gov (United States)

    McCune, Robert C.; Upadhyay, Vinod; Wang, Yar-Ming; Battocchi, Dante

    The potential utility of AC-DC-AC electrochemical methods in comparative measures of corrosion-resisting coating system performance for magnesium alloys under consideration for the USAMP "Magnesium Front End Research and Development" project was previously shown in this forum [1]. Additional studies of this approach using statistically-designed experiments have been conducted with focus on alloy types, pretreatment, topcoat material and topcoat thickness as the variables. Additionally, sample coupons made for these designed experiments were also subjected to a typical automotive cyclic corrosion test cycle (SAE J2334) as well as ASTM B117 for comparison of relative performance. Results of these studies are presented along with advantages and limitations of the proposed methodology.

  18. Projected coupled cluster theory.

    Science.gov (United States)

    Qiu, Yiheng; Henderson, Thomas M; Zhao, Jinmo; Scuseria, Gustavo E

    2017-08-14

    Coupled cluster theory is the method of choice for weakly correlated systems. But in the strongly correlated regime, it faces a symmetry dilemma, where it either completely fails to describe the system or has to artificially break certain symmetries. On the other hand, projected Hartree-Fock theory captures the essential physics of many kinds of strong correlations via symmetry breaking and restoration. In this work, we combine and try to retain the merits of these two methods by applying symmetry projection to broken symmetry coupled cluster wave functions. The non-orthogonal nature of states resulting from the application of symmetry projection operators furnishes particle-hole excitations to all orders, thus creating an obstacle for the exact evaluation of overlaps. Here we provide a solution via a disentanglement framework theory that can be approximated rigorously and systematically. Results of projected coupled cluster theory are presented for molecules and the Hubbard model, showing that spin projection significantly improves unrestricted coupled cluster theory while restoring good quantum numbers. The energy of projected coupled cluster theory reduces to the unprojected one in the thermodynamic limit, albeit at a much slower rate than projected Hartree-Fock.

  19. Spanning Tree Based Attribute Clustering

    DEFF Research Database (Denmark)

    Zeng, Yifeng; Jorge, Cordero Hernandez

    2009-01-01

    Attribute clustering has been previously employed to detect statistical dependence between subsets of variables. We propose a novel attribute clustering algorithm motivated by research of complex networks, called the Star Discovery algorithm. The algorithm partitions and indirectly discards...... inconsistent edges from a maximum spanning tree by starting appropriate initial modes, therefore generating stable clusters. It discovers sound clusters through simple graph operations and achieves significant computational savings. We compare the Star Discovery algorithm against earlier attribute clustering...

  20. A direct power conversion topology for grid integrations of hybrid AC/DC resources

    DEFF Research Database (Denmark)

    Liu, Xiong; Loh, Poh Chiang; Wang, Peng

    2012-01-01

    and modulation schemes are proposed to extract the commanded current from the input ac/dc sources to the grid and guarantee high quality ac/dc inputs and ac output current waveforms with unity power factors. The proposed modulation scheme for sinusoidal outputs of the VMC is mathematically proved...

  1. Risk prediction of ventricular arrhythmias and myocardial function in Lamin A/C mutation positive subjects

    DEFF Research Database (Denmark)

    Hasselberg, Nina E; Edvardsen, Thor; Petri, Helle

    2014-01-01

    Mutations in the Lamin A/C gene may cause atrioventricular block, supraventricular arrhythmias, ventricular arrhythmias (VA), and dilated cardiomyopathy. We aimed to explore the predictors and the mechanisms of VA in Lamin A/C mutation-positive subjects.METHODS AND RESULTS: We included 41 Lamin A/C...

  2. 21 CFR 880.5100 - AC-powered adjustable hospital bed.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...

  3. Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly

    International Nuclear Information System (INIS)

    Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi

    2008-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production

  4. Pantallas acústicas submarinas de material compuesto multilaminar con matriz metálica

    OpenAIRE

    Gallego, V.; Laguna, M.; Vázquez, A. J.

    1999-01-01

    7 pp.-- PACS nr.: 43.30.Ky.-- Comunicación presentada en los siguientes congresos: XXX Jornadas Nacionales de Acústica – TecniAcústica 1999. Encuentro Ibérico de Acústica (Ávila, 20-22 Octubre 1999).

  5. Exotic cluster structures on

    CERN Document Server

    Gekhtman, M; Vainshtein, A

    2017-01-01

    This is the second paper in the series of papers dedicated to the study of natural cluster structures in the rings of regular functions on simple complex Lie groups and Poisson-Lie structures compatible with these cluster structures. According to our main conjecture, each class in the Belavin-Drinfeld classification of Poisson-Lie structures on \\mathcal{G} corresponds to a cluster structure in \\mathcal{O}(\\mathcal{G}). The authors have shown before that this conjecture holds for any \\mathcal{G} in the case of the standard Poisson-Lie structure and for all Belavin-Drinfeld classes in SL_n, n<5. In this paper the authors establish it for the Cremmer-Gervais Poisson-Lie structure on SL_n, which is the least similar to the standard one.

  6. From superdeformation to clusters

    Energy Technology Data Exchange (ETDEWEB)

    Betts, R R [Argonne National Lab., IL (United States). Physics Div.

    1992-08-01

    Much of the discussion at the conference centred on superdeformed states and their study by precise gamma spectrometry. The author suggests that the study of superdeformation by fission fragments and by auto-scattering is of importance, and may become more important. He concludes that there exists clear evidence of shell effects at extreme deformation in light nuclei studied by fission or cluster decay. The connection between the deformed shell model and the multi-center shell model can be exploited to give give insight into the cluster structure of these extremely deformed states, and also gives hope of a spectroscopy based on selection rules for cluster decay. A clear disadvantage at this stage is inability to make this spectroscopy more quantitative through calculation of the decay widths. The introduction of a new generation of high segmentation, high resolution, particle arrays has and will have a major impact on this aspect of the study of highly deformed nuclei. 20 refs., 16 figs.

  7. Refractory chronic cluster headache

    DEFF Research Database (Denmark)

    Mitsikostas, Dimos D; Edvinsson, Lars; Jensen, Rigmor H

    2014-01-01

    Chronic cluster headache (CCH) often resists to prophylactic pharmaceutical treatments resulting in patients' life damage. In this rare but pragmatic situation escalation to invasive management is needed but framing criteria are lacking. We aimed to reach a consensus for refractory CCH definition...... for clinical and research use. The preparation of the final consensus followed three stages. Internal between authors, a larger between all European Headache Federation members and finally an international one among all investigators that have published clinical studies on cluster headache the last five years...

  8. I Cluster geografici

    Directory of Open Access Journals (Sweden)

    Maurizio Rosina

    2010-03-01

    Full Text Available Geographic ClustersOver the past decade, public alphanumeric database have been growing at exceptional rate. Most of data can be georeferenced, so that is possible gaining new knowledge from such databases. The contribution of this paper is two-fold. We first present a model of geographic clusters, which uses only geographic and functionally data properties. The model is useful to process huge amount of public/government data, even daily upgrading. After that, we merge the model into the framework GEOPOI (GEOcoding Points Of Interest, and show some graphic map results.

  9. I Cluster geografici

    Directory of Open Access Journals (Sweden)

    Maurizio Rosina

    2010-03-01

    Full Text Available Geographic Clusters Over the past decade, public alphanumeric database have been growing at exceptional rate. Most of data can be georeferenced, so that is possible gaining new knowledge from such databases. The contribution of this paper is two-fold. We first present a model of geographic clusters, which uses only geographic and functionally data properties. The model is useful to process huge amount of public/government data, even daily upgrading. After that, we merge the model into the framework GEOPOI (GEOcoding Points Of Interest, and show some graphic map results.

  10. Clustering via Kernel Decomposition

    DEFF Research Database (Denmark)

    Have, Anna Szynkowiak; Girolami, Mark A.; Larsen, Jan

    2006-01-01

    Methods for spectral clustering have been proposed recently which rely on the eigenvalue decomposition of an affinity matrix. In this work it is proposed that the affinity matrix is created based on the elements of a non-parametric density estimator. This matrix is then decomposed to obtain...... posterior probabilities of class membership using an appropriate form of nonnegative matrix factorization. The troublesome selection of hyperparameters such as kernel width and number of clusters can be obtained using standard cross-validation methods as is demonstrated on a number of diverse data sets....

  11. Molecular dynamics simulation of gold cluster growth during sputter deposition

    Energy Technology Data Exchange (ETDEWEB)

    Abraham, J. W., E-mail: abraham@theo-physik.uni-kiel.de; Bonitz, M., E-mail: bonitz@theo-physik.uni-kiel.de [Institut für Theoretische Physik und Astrophysik, Christian-Albrechts-Universität zu Kiel, Leibnizstraße 15, D-24098 Kiel (Germany); Strunskus, T.; Faupel, F. [Institut für Materialwissenschaft, Lehrstuhl für Materialverbunde, Christian-Albrechts-Universität zu Kiel, Kaiserstraße 2, D-24143 Kiel (Germany)

    2016-05-14

    We present a molecular dynamics simulation scheme that we apply to study the time evolution of the self-organized growth process of metal cluster assemblies formed by sputter-deposited gold atoms on a planar surface. The simulation model incorporates the characteristics of the plasma-assisted deposition process and allows for an investigation over a wide range of deposition parameters. It is used to obtain data for the cluster properties which can directly be compared with recently published experimental data for gold on polystyrene [M. Schwartzkopf et al., ACS Appl. Mater. Interfaces 7, 13547 (2015)]. While good agreement is found between the two, the simulations additionally provide valuable time-dependent real-space data of the surface morphology, some of whose details are hidden in the reciprocal-space scattering images that were used for the experimental analysis.

  12. PWM CONTROLLER'S MODELS FOR INVESTIGATION ACS IN SPICEFAMILY ECAD PROGRAMS

    Directory of Open Access Journals (Sweden)

    O. V. VASYLENKO

    2018-05-01

    Full Text Available Purpose. To improve simulation and design of Automatic Control Systems in the SPICE-compatible programs and to obtain separate economic and universal macromodels of PWM controller. Development of an PWM controller economical macromodel for the study of automatic control systems (ACS in computer-aided design (ECAD  programs, which does not generate algorithmic failures in comparison with the existing models of PWM. Findings. Analysis of SPICE-family applications’ mathematical basis allowed to classifying existing models of PWM-controllers, defining their suitability for ACS simulation. The criteria for the synthesis of new models have been defined. For the SPICE 3G algorithms, the Switch and Averaged models based on behavioral elements has been developed. Universal and economical PWM controller macromodel based on the simple algorithm for determining the output signal with minimum numbers of input parameters has been designed. For the Automated Measuring magnetic susceptibility System, the macromodel of quasi-PWM signal generator have been designed, which is used in the compensation subsystem. This model is different from the existing ones: it synthesizes the staircase output signal instead the pulse one, thus, there is direct control of the amplitude of the output signal, which is taken averaged. The adequacy of the models is confirmed as comparison of the simulation results during investigations of the model already existing in the SPICE program, as well as the results of experiments with real ACS. The modeling of the PWM controller was carried out on the basis of behavioral elements from the ECAD library, simulation (solution of algebra-differential equations systems with programming elements is based on SPICE algorithms. The object of the study was the simulation process of ACS with the pulse-width principle of adjusting the output value. The subject of the research are the models of PWM controllers. Originality. The new macromodel of PWM

  13. Multi-Optimisation Consensus Clustering

    Science.gov (United States)

    Li, Jian; Swift, Stephen; Liu, Xiaohui

    Ensemble Clustering has been developed to provide an alternative way of obtaining more stable and accurate clustering results. It aims to avoid the biases of individual clustering algorithms. However, it is still a challenge to develop an efficient and robust method for Ensemble Clustering. Based on an existing ensemble clustering method, Consensus Clustering (CC), this paper introduces an advanced Consensus Clustering algorithm called Multi-Optimisation Consensus Clustering (MOCC), which utilises an optimised Agreement Separation criterion and a Multi-Optimisation framework to improve the performance of CC. Fifteen different data sets are used for evaluating the performance of MOCC. The results reveal that MOCC can generate more accurate clustering results than the original CC algorithm.

  14. Photochemistry in rare gas clusters

    International Nuclear Information System (INIS)

    Moeller, T.; Haeften, K. von; Pietrowski, R. von

    1999-01-01

    In this contribution photochemical processes in pure rare gas clusters will be discussed. The relaxation dynamics of electronically excited He clusters is investigated with luminescence spectroscopy. After electronic excitation of He clusters many sharp lines are observed in the visible and infrared spectral range which can be attributed to He atoms and molecules desorbing from the cluster. It turns out that the desorption of electronically excited He atoms and molecules is an important decay channel. The findings for He clusters are compared with results for Ar clusters. While desorption of electronically excited He atoms is observed for all clusters containing up to several thousand atoms a corresponding process in Ar clusters is only observed for very small clusters (N<10). (orig.)

  15. Photochemistry in rare gas clusters

    Energy Technology Data Exchange (ETDEWEB)

    Moeller, T.; Haeften, K. von; Pietrowski, R. von [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany). Hamburger Synchrotronstrahlungslabor; Laarman, T. [Universitaet Hamburg, II. Institut fuer Experimentalphysik, Luruper Chaussee 149, D-22761 Hamburg (Germany)

    1999-12-01

    In this contribution photochemical processes in pure rare gas clusters will be discussed. The relaxation dynamics of electronically excited He clusters is investigated with luminescence spectroscopy. After electronic excitation of He clusters many sharp lines are observed in the visible and infrared spectral range which can be attributed to He atoms and molecules desorbing from the cluster. It turns out that the desorption of electronically excited He atoms and molecules is an important decay channel. The findings for He clusters are compared with results for Ar clusters. While desorption of electronically excited He atoms is observed for all clusters containing up to several thousand atoms a corresponding process in Ar clusters is only observed for very small clusters (N<10). (orig.)

  16. Globular clusters, old and young

    International Nuclear Information System (INIS)

    Samus', N.N.

    1984-01-01

    The problem of similarity of and difference in the globular and scattered star clusters is considered. Star clusters in astronomy are related either to globular or to scattered ones according to the structure of Hertzsprung-Russell diagram constructed for star clusters, but not according to the appearance. The qlobular clusters in the Galaxy are composed of giants and subgiants, which testifies to the old age of the globular clusters. The Globular clusters in the Magellanic clouds are classified into ''red'' ones - similar to the globular clusters of the Galaxy, and ''blue'' ones - similar to them in appearance but differing extremely by the star composition and so by the age. The old star clusters are suggested to be called globular ones, while another name (''populous'', for example) is suggested to be used for other clusters similar to globular ones only in appearance

  17. Dicty_cDB: FC-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

  18. Working with the American Community Survey in R a guide to using the acs package

    CERN Document Server

    Glenn, Ezra Haber

    2016-01-01

    This book serves as a hands-on guide to the "acs" R package for demographers, planners, and other researchers who work with American Community Survey (ACS) data. It gathers the most common problems associated with using ACS data and implements functions as a package in the R statistical programming language. The package defines a new "acs" class object (containing estimates, standard errors, and metadata for tables from the ACS) with methods to deal appropriately with common tasks (e.g., creating and combining subgroups or geographies, automatic fetching of data via the Census API, mathematical operations on estimates, tests of significance, plots of confidence intervals).

  19. A Missing Link in Galaxy Evolution: The Mysteries of Dissolving Star Clusters

    Science.gov (United States)

    Pellerin, Anne; Meyer, Martin; Harris, Jason; Calzetti, Daniela

    2007-05-01

    Star-forming events in starbursts and normal galaxies have a direct impact on the global stellar content of galaxies. These events create numerous compact clusters where stars are produced in great number. These stars eventually end up in the star field background where they are smoothly distributed. However, due to instrumental limitations such as spatial resolution and sensitivity, the processes involved during the transition phase from the compact clusters to the star field background as well as the impact of the environment (spiral waves, bars, starburst) on the lifetime of clusters are still poorly constrained observationally. I will present our latest results on the physical properties of dissolving clusters directly detected in HST/ACS archival images of the three nearby galaxies IC 2574, NGC 1313, and IC 10 (D detect and spatially resolve individual stars in nearby galaxies within a large field-of-view. For all ACS images obtained in three filters (F435W, F555W or F606W, and F814W), we performed PSF stellar photometry in crowded field. Color-magnitude diagrams (CMD) allow us to identify the most massive stars more likely to be part of dissolving clusters (A-type and earlier), and to isolate them from the star field background. We then adapt and use a clustering algorithm on the selected stars to find groups of stars to reveal and quantify the properties of all star clusters (compactness, size, age, mass). With this algorithm, even the less compact clusters are revealed while they are being destroyed. Our sample of three galaxies covers an interesting range in gravitational potential well and explores a variety of galaxy morphological types, which allows us to discuss the dissolving cluster properties as a function of the host galaxy characteristics. The properties of the star field background will also be discussed.

  20. Globular clusters and galaxy halos

    International Nuclear Information System (INIS)

    Van Den Bergh, S.

    1984-01-01

    Using semipartial correlation coefficients and bootstrap techniques, a study is made of the important features of globular clusters with respect to the total number of galaxy clusters and dependence of specific galaxy cluster on parent galaxy type, cluster radii, luminosity functions and cluster ellipticity. It is shown that the ellipticity of LMC clusters correlates significantly with cluster luminosity functions, but not with cluster age. The cluter luminosity value above which globulars are noticeably flattened may differ by a factor of about 100 from galaxy to galaxy. Both in the Galaxy and in M31 globulars with small core radii have a Gaussian distribution over luminosity, whereas clusters with large core radii do not. In the cluster systems surrounding the Galaxy, M31 and NGC 5128 the mean radii of globular clusters was found to increase with the distance from the nucleus. Central galaxies in rich clusters have much higher values for specific globular cluster frequency than do other cluster ellipticals, suggesting that such central galaxies must already have been different from normal ellipticals at the time they were formed