WorldWideScience

Sample records for acs fornax cluster

  1. The ACS Fornax Cluster Survey. VI. The Nuclei of Early-Type Galaxies in the Fornax Cluster

    CERN Document Server

    Turner, Monica L; Ferrarese, Laura; Jordan, Andres; Blakeslee, John P; Mei, Simona; Peng, Eric W; West, Michael J

    2012-01-01

    The Advanced Camera for Surveys (ACS) Fornax Cluster Survey is a Hubble Space Telescope program to image 43 early-type galaxies in the Fornax cluster, using the F475W and F850LP bandpasses of the ACS. We employ both 1D and 2D techniques to characterize the properties of the stellar nuclei in these galaxies, defined as the central "luminosity excesses" relative to a Sersic model fitted to the underlying host. We find 72+/-13% of our sample (31 galaxies) to be nucleated, with only three of the nuclei offset by more than 0.5" from their galaxy photocenter, and with the majority of nuclei having colors bluer than their hosts. The nuclei are observed to be larger, and brighter, than typical Fornax globular clusters, and to follow different structural scaling relations. A comparison of our results to those from the ACS Virgo Cluster Survey reveals striking similarities in the properties of the nuclei belonging to these different environments. We briefly review a variety of proposed formation models and conclude tha...

  2. The ACS Fornax Cluster Survey. XII. Diffuse Star Clusters in Early-type Galaxies

    CERN Document Server

    Liu, Yiqing; Lim, Sungsoon; Jordán, Andrés; Blakeslee, John; Côté, Patrick; Ferrarese, Laura; Pattarakijwanich, Petchara

    2016-01-01

    Diffuse star clusters (DSCs) are old and dynamically hot stellar systems that have lower surface brightness and more extended morphology than globular clusters (GCs). Using the images from HST/ACS Fornax Cluster Survey, we find that 12 out of 43 early-type galaxies (ETGs) in the Fornax cluster host significant numbers of DSCs. Together with literature data from the HST/ACS Virgo Cluster Survey, where 18 out of 100 ETGs were found to host DSCs, we systematically study the relationship of DSCs with GCs, and their host galaxy environment. Two DSC hosts are post-merger galaxies, with most of the other hosts either having low mass or showing clear disk components. We find that while the number ratio of DSCs to GCs is nearly constant in massive galaxies, the DSC-to-GC ratio becomes systematically higher in lower mass hosts. This suggests that DSCs may be more efficient at forming (or surviving) in low density environments. DSC hosts are not special either in their position in the cluster, or in the galactic color-m...

  3. The ACS Fornax Cluster Survey. XII. Diffuse Star Clusters in Early-type Galaxies

    Science.gov (United States)

    Liu, Yiqing; Peng, Eric W.; Lim, Sungsoon; Jordán, Andrés; Blakeslee, John; Côté, Patrick; Ferrarese, Laura; Pattarakijwanich, Petchara

    2016-10-01

    Diffuse star clusters (DSCs) are old and dynamically hot stellar systems that have lower surface brightness and more extended morphology than globular clusters (GCs). Using the images from Hubble Space Telescope (HST)/ACS Fornax Cluster Survey, we find that 12 out of 43 early-type galaxies (ETGs) in the Fornax Cluster host significant numbers of DSCs. Together with literature data from the HST/ACS Virgo Cluster Survey, where 18 out of 100 ETGs were found to host DSCs, we systematically study the relationship of DSCs with GCs and their host galaxy environment. Two DSC hosts are post-merger galaxies, with most of the other hosts either having low mass or showing clear disk components. We find that while the number ratio of DSCs to GCs is nearly constant in massive galaxies, the DSC-to-GC ratio becomes systematically higher in lower-mass hosts. This suggests that DSCs may be more efficient at forming (or surviving) in low-density environments. DSC hosts are not special either in their position in the cluster or in the galactic color–magnitude diagram. Why some disk and low-mass galaxies host DSCs while others do not is still a puzzle, however. The mean ages of DSC hosts and nonhosts are similar at similar masses, implying that formation efficiency rather than survival is the reason behind different DSC number fractions in ETGs.

  4. A Deep Look at the Fornax Cluster

    Science.gov (United States)

    Kohler, Susanna

    2016-04-01

    Traditionally, dense cluster centers are cannibalistic environments, with larger galaxies stripping stars from smaller interlopers in minor mergers and dynamical harassment. A recent survey of the Fornax cluster, one example of such an environment, reveals how this cluster may have been built.Clues in HalosContext for the southern constellation Fornax (the furnace). The Fornax cluster is marked with a red circle. [ESO, IAU and Sky Telescope]Deep surveys of dense cluster environments are necessary because the imprint of mass assembly is hidden in galactic halos, the faint outer regions of galaxies. Deep observations can reveal answers to questions about how the galaxies in these extreme environments formed and evolved for instance, did the majority of the galaxies stars form in situ, or were they accreted from interactions with other galaxies?The Fornax Deep Survey (FDS) is just such a campaign. FDS uses the European Southern Observatorys VLT Survey Telescope to obtain deep photometry of the entire 26 square degrees of the Fornax cluster, a spectacular galaxy cluster located 65 million light-years away.Central ObservationsThe FDS team plans to release the full results from the survey soon. For now, in an initial study led by Enrichetta Iodice (INAFs Astronomical Observatory of Capodimonte, Italy), the team presents their first findings from the two square degrees around NGC 1399, a supergiant elliptical galaxy in the cluster center.The two main results from this study are:The discovery of a faint stellar bridge between NGC 1399 and a nearby galaxy, NGC 1387.The characterization of NGC 1399s light profile, which shows that the galaxy consists of two main components separated by a strong break. The bright central galaxy is likely composed of stars that formed in situ, whereas the exponential outer component is a stellar halo composed of stars likely captured from accretion events.What do these points tell us about the history of the center of the Fornax cluster? These

  5. Intra Cluster Globular Clusters around NGC 1399 in Fornax?

    CERN Document Server

    Schuberth, Y; Bassino, L; Hilker, M

    2007-01-01

    We investigate whether the globular clusters (GCs) in the recently published sample of GCs in the Fornax cluster by Bergond and coworkers are indeed intra-cluster objects. We combine the catalogue of radial velocity measurements by Bergond et al. with our CTIO MOSAIC photometry in the Washington system and analyse the relation of metal-poor and metal-rich GCs with their host galaxies. The metal-rich GCs appear to be kinematically associated with their respective host galaxies. The vast majority of the metal-poor GCs found in between the galaxies of the Fornax cluster have velocities which are consistent with them being members of the very extended NGC 1399 GC system. We find that when the sample is restricted to the most accurate velocity measurements, the GC velocity dispersion profile can be described with a mass model derived for the NGC 1399 GC system within 80 kpc. We identify one ``vagrant'' GC whose radial velocity suggests that it is not bound to any galaxy unless its orbit has a very large apogalacti...

  6. The complex star cluster system of NGC 1316 (Fornax A)

    Science.gov (United States)

    Sesto, Leandro A.; Faifer, Favio R.; Forte, Juan C.

    2016-10-01

    This paper presents Gemini-gri' high-quality photometry for cluster candidates in the field of NGC 1316 (Fornax A) as part of a study that also includes GMOS spectroscopy. A preliminary discussion of the photometric data indicates the presence of four stellar cluster populations with distinctive features in terms of age, chemical abundance and spatial distribution. Two of them seem to be the usually old (metal poor and metal rich) populations typically found in elliptical galaxies. In turn, an intermediate-age (5 Gyr) globular cluster population is the dominant component of the sample (as reported by previous papers). We also find a younger cluster population with a tentative age of ≈ 1 Gyr.

  7. The complex star cluster system of NGC 1316 (Fornax A)

    CERN Document Server

    Sesto, Leandro A; Forte, Juan C

    2016-01-01

    This paper presents Gemini-$gri'$ high quality photometry for cluster candidates in the field of NGC 1316 (Fornax A) as part of a study that also includes GMOS spectroscopy. A preliminary discussion of the photometric data indicates the presence of four stellar cluster populations with distinctive features in terms of age, chemical abundance and spatial distribution. Two of them seem to be the usually old (metal poor and metal rich) populations typically found in elliptical galaxies. In turn, an intermediate-age (5 Gyr) globular cluster population is the dominant component of the sample (as reported by previous papers). We also find a younger cluster population with a tentative age of $\\approx$ 1 Gyr.

  8. Efficient star cluster formation in the core of a galaxy cluster: The dwarf irregular NGC 1427A in Fornax

    CERN Document Server

    Mora, Marcelo D; Puzia, Thomas H

    2014-01-01

    Gas-rich galaxies in dense environments such as galaxy clusters and massive groups are affected by a number of possible types of interactions with the cluster environment, which make their evolution radically different than that of field galaxies. The dIrr galaxy NGC 1427A, presently infalling towards the core of the Fornax galaxy cluster, offers a unique opportunity to study those processes in a level of detail not possible to achieve for galaxies at higher redshits. Using HST/ACS and auxiliary VLT/FORS ground-based observations, we study the properties of the most recent episodes of star formation in this gas-rich galaxy, the only one of its type near the core of the Fornax cluster. We study the structural and photometric properties of young star cluster complexes in NGC 1427A, identifying 12 bright such complexes with exceptionally blue colors. The comparison of our broadband near-UV/optical photometry with simple stellar population models yields ages below ~4x10^6 yr and stellar masses from a few thousand...

  9. Peculiar compact stellar systems in the Fornax cluster

    CERN Document Server

    Wittmann, Carolin; Pasquali, Anna; Hilker, Michael; Grebel, Eva K

    2016-01-01

    We search for hints to the origin and nature of compact stellar systems in the magnitude range of ultracompact dwarf galaxies in deep wide-field imaging data of the Fornax cluster core. We visually investigate a large sample of 355 spectroscopically confirmed cluster members with V-band equivalent magnitudes brighter than -10 mag for faint extended structures. Our data reveal peculiar compact stellar systems, which appear asymmetric or elongated from their outer light distribution. We characterize the structure of our objects by quantifying their core concentration, as well as their outer asymmetry and ellipticity. For the brighter objects of our sample we also investigate their spatial and phase-space distribution within the cluster. We argue that the distorted outer structure alone that is seen for some of our objects, is not sufficient to decide whether these systems have a star cluster or a galaxy origin. However, we find that objects with low core concentration and high asymmetry (or high ellipticity) ar...

  10. The mass distribution of the Fornax dSph: constraints from its globular cluster distribution

    Science.gov (United States)

    Cole, David R.; Dehnen, Walter; Read, Justin I.; Wilkinson, Mark I.

    2012-10-01

    Uniquely among the dwarf spheroidal (dSph) satellite galaxies of the Milky Way, Fornax hosts globular clusters. It remains a puzzle as to why dynamical friction has not yet dragged any of Fornax's five globular clusters to the centre, and also why there is no evidence that any similar star cluster has been in the past (for Fornax or any other tidally undisrupted dSph). We set up a suite of 2800 N-body simulations that sample the full range of globular cluster orbits and mass models consistent with all existing observational constraints for Fornax. In agreement with previous work, we find that if Fornax has a large dark matter core, then its globular clusters remain close to their currently observed locations for long times. Furthermore, we find previously unreported behaviour for clusters that start inside the core region. These are pushed out of the core and gain orbital energy, a process we call 'dynamical buoyancy'. Thus, a cored mass distribution in Fornax will naturally lead to a shell-like globular cluster distribution near the core radius, independent of the initial conditions. By contrast, cold dark matter-type cusped mass distributions lead to the rapid infall of at least one cluster within Δt = 1-2 Gyr, except when picking unlikely initial conditions for the cluster orbits (˜2 per cent probability), and almost all clusters within Δt = 10 Gyr. Alternatively, if Fornax has only a weakly cusped mass distribution, then dynamical friction is much reduced. While over Δt = 10 Gyr this still leads to the infall of one to four clusters from their present orbits, the infall of any cluster within Δt = 1-2 Gyr is much less likely (with probability 0-70 per cent, depending on Δt and the strength of the cusp). Such a solution to the timing problem requires (in addition to a shallow dark matter cusp) that in the past the globular clusters were somewhat further from Fornax than today; they most likely did not form within Fornax, but were accreted.

  11. VLT/UVES spectroscopy of individual stars in three globular clusters in the Fornax dwarf spheroidal galaxy

    NARCIS (Netherlands)

    Letarte, B; Hill, [No Value; Jablonka, P; Tolstoy, E; Francois, P; Meylan, G

    2006-01-01

    We present a high resolution ( R similar to 43 000) abundance analysis of a total of nine stars in three of the five globular clusters associated with the nearby Fornax dwarf spheroidal galaxy. These three clusters ( 1, 2 and 3) trace the oldest, most metal-poor stellar populations in Fornax. We det

  12. Globular cluster systems in low-luminosity early-type galaxies near the Fornax Cluster centre

    CERN Document Server

    Bassino, L P; Dirsch, B; Bassino, Lilia P.; Richtler, Tom; Dirsch, Boris

    2006-01-01

    We present a photometric study of the globular cluster systems of the Fornax cluster galaxies NGC 1374, NGC 1379, and NGC 1387. The data consists of images from the wide-field MOSAIC Imager of the CTIO 4-m telescope, obtained with Washington C and Kron-Cousins R filters. The images cover a field of 36 x 36 arcmin, corresponding to 200 x 200 kpc at the Fornax distance. Two of the galaxies, NGC 1374 and NGC 1379, are low-luminosity ellipticals while NGC 1387 is a low-luminosity lenticular. Their cluster systems are still embedded in the cluster system of NGC 1399. Therefore the use of a large field is crucial and some differences to previous work can be explained by this. The colour distributions of all globular cluster systems are bimodal. NGC 1387 presents a particularly distinct separation between red and blue clusters and an overproportionally large population of red clusters. The radial distribution is different for blue and red clusters, red clusters being more concentrated towards the respective galaxies...

  13. Nitrogen abundances and multiple stellar populations in the globular clusters of the Fornax dSph

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Søren S. [Department of Astrophysics/IMAPP, Radboud University, P.O. Box 9010, 6500 GL Nijmegen (Netherlands); Brodie, Jean P. [UCO/Lick Observatory, University of California, Santa Cruz, CA 95064 (United States); Grundahl, Frank [Stellar Astrophysics Centre, Department of Physics and Astronomy, Aarhus University, Ny Munkegade 120, DK-8000 Aarhus C (Denmark); Strader, Jay, E-mail: s.larsen@astro.ru.nl [Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States)

    2014-12-10

    We use measurements of nitrogen abundances in red giants to search for multiple stellar populations in the four most metal-poor globular clusters (GCs) in the Fornax dwarf spheroidal galaxy (Fornax 1, 2, 3, and 5). New imaging in the F343N filter, obtained with the Wide Field Camera 3 on the Hubble Space Telescope, is combined with archival F555W and F814W observations to determine the strength of the NH band near 3370 Å. After accounting for observational errors, the spread in the F343N-F555W colors of red giants in the Fornax GCs is similar to that in M15 and corresponds to an abundance range of Δ[N/Fe] ∼ 2 dex, as observed also in several Galactic GCs. The spread in F555W-F814W is, instead, fully accounted for by observational errors. The stars with the reddest F343N-F555W colors (indicative of N-enhanced composition) have more centrally concentrated radial distributions in all four clusters, although the difference is not highly statistically significant within any individual cluster. From double-Gaussian fits to the color distributions, we find roughly equal numbers of 'N-normal' and 'N-enhanced' stars (formally ∼40% N-normal stars in Fornax 1, 3, and 5 and ∼60% in Fornax 2). We conclude that GC formation, in particular, regarding the processes responsible for the origin of multiple stellar populations, appears to have operated similarly in the Milky Way and in the Fornax dSph. Combined with the high ratio of metal-poor GCs to field stars in the Fornax dSph, this places an important constraint on scenarios for the origin of multiple stellar populations in GCs.

  14. Cannibal Stars Cause Giant Explosions in Fornax Cluster Galaxy

    Science.gov (United States)

    2000-07-01

    been necessary to detect a few distant novae [3]. VLT observations of NGC 1316 in the Fornax Cluster ESO PR Photo 18a/00 ESO PR Photo 18a/00 [Preview - JPEG: 400 x 448 pix - 28k] [Normal - JPEG: 800 x 895 pix - 136k] [Full-Res - JPEG: 1941 x 2172 pix - 904k] Caption : Colour composite photo of the central area of NGC 1316 , a giant elliptical galaxy in the Fornax cluster of galaxies. Many dark dust clouds and lanes are visible. Some of the star-like objects in the field are globular clusters of stars that belong to the galaxy. It is based on CCD exposures, obtained with the 8.2-m VLT/ANTU telescope and the FORS-1 multi-mode instrument through B (blue), V (green-yellow) and I (here rendered as red) filters, respectively. The "pyramids" above and below the bright centre of the galaxy and the vertical lines at some of the brighter stars are caused by overexposure ("CCD bleeding"). The field measures 6.8 x 6.8 arcmin 2 , with 0.2 arcsec/pixel. The image quality of this composite is about 0.9 arcsec. North is up and East is left. NGC 1316 is a giant "dusty" galaxy ( PR Photo 18a/00 ), located in the Fornax cluster seen in the southern constellation of that name ("The Oven"). This galaxy is of special interest in connection with current attempts to establish an accurate distance scale in the Universe. In 1980 and 1981, NGC 1316 was the host of two supernovae of type Ia , a class of object that is widely used as a "cosmological standard candle" to determine the distance to very distant galaxies, cf. ESO PR 21/98. A precise measurement of the distance to NGC 1316 may therefore provide an independent calibration of the intrinsic brightness of these supernovae. The new observations were performed during 8 nights distributed over the period from January 9 to 19, 2000. They were made in service mode at the 8.2-m VLT/ANTU telescope with the FORS-1 multi-mode instrument, using a 2k x 2k CCD camera with 0.2 arcsec pixels and a field of 6.8 x 6.8 arcmin 2. The exposures lasted 20 min

  15. Optical identifications of IRAS point sources: the Fornax, Hydra I and Coma clusters

    International Nuclear Information System (INIS)

    We present optical identifications for 66 IRAS point sources in the region of the Fornax cluster of galaxies, 106 IRAS point sources in the region of the Hydra I cluster of galaxies (Abell 1060) and 59 IRAS point sources in the region of the Coma cluster of galaxies (Abell 1656). Eight other sources in Hydra I do not have optical counterparts and are very probably due to infrared cirrus. Twenty-three (35 per cent) of the Fornax sources are associated with stars and 43 (65 per cent) with galaxies; 48 (42 per cent) of the Hydra I sources are associated with stars and 58 (51 per cent) with galaxies; 18 (31 per cent) of the Coma sources are associated with stars and 41 (69 per cent) with galaxies. The stellar and infrared cirrus surface density is consistent with the galactic latitude of each field. (author)

  16. Globular clusters as tracers of the host galaxy mass distribution: the Fornax dSph test case

    OpenAIRE

    Arca-Sedda, Manuel; Capuzzo-Dolcetta, Roberto

    2016-01-01

    The Fornax dwarf spheroidal galaxy is the most massive satellites of the Milky Way, claimed to be embedded in a huge dark matter halo, and the only among the Milky Way satellites hosting five globular clusters. Interestingly, their estimated masses, ages and positions seem hardly compatible with the presence of a significant dark matter component, as expected in the $\\Lambda$ CDM scheme. Indeed, if Fornax would have a CDM halo with a standard density profile, all its globular clusters should ...

  17. Resolving the timing problem of the globular clusters orbiting the Fornax dwarf galaxy

    CERN Document Server

    Angus, Garry W

    2009-01-01

    We re-investigate the old problem of the survival of the five globular clusters orbiting the Fornax dwarf galaxy in both standard and modified Newtonian dynamics. For the first time in the history of the topic, we use accurate mass models for the Fornax dwarf, obtained through Jeans modelling of the recently published line of sight velocity dispersion data, and we are also not resigned to circular orbits for the globular clusters. Previously conceived problems stem from fixing the starting distances of the globulars to be less than half the tidal radius. We relax this constraint since there is absolutely no evidence for it and show that the dark matter paradigm, with either cusped or cored dark matter profiles, has no trouble sustaining the orbits of the two least massive globular clusters for a Hubble time almost regardless of their initial distance from Fornax. The three most massive globulars can remain in orbit as long as their starting distances are marginally outside the tidal radius. The outlook for mo...

  18. Globular clusters as tracers of the host galaxy mass distribution: the Fornax dSph test case

    CERN Document Server

    Arca-Sedda, Manuel

    2016-01-01

    The Fornax dwarf spheroidal galaxy is the most massive satellites of the Milky Way, claimed to be embedded in a huge dark matter halo, and the only among the Milky Way satellites hosting five globular clusters. Interestingly, their estimated masses, ages and positions seem hardly compatible with the presence of a significant dark matter component, as expected in the $\\Lambda$ CDM scheme. Indeed, if Fornax would have a CDM halo with a standard density profile, all its globular clusters should have sunk to the galactic centre many Gyr ago due to dynamical friction. Due to this, some authors proposed that the most massive clusters may have formed out of Fornax and later tidally captured. In this paper we investigate the past evolution of the Fornax GC system by using both a recently developed, semi-analytical treatment of dynamical friction and direct $N$-body simulations of the orbital evolution of the globular clusters within Fornax and of Fornax galaxy around the Milky Way. Our results suggest that an "in-sit...

  19. Globular Clusters at the Centre of the Fornax Cluster: Tracing Interactions Between Galaxies

    CERN Document Server

    Bassino, L P; Faifer, F R; Forte, J C; Dirsch, B; Geisler, D; Schuberth, Y

    2006-01-01

    We present the combined results of two investigations: a large-scale study of the globular cluster system (GCS) around NGC 1399, the central galaxy of the Fornax cluster, and a study of the GCSs around NGC 1374, NGC 1379 and NGC 1387, three low-luminosity early-type galaxies located close to the centre of the same cluster. In both cases, the data consist of images from the wide-field MOSAIC Imager of the CTIO 4-m telescope, obtained with Washington C and Kron-Cousins R filters, which provide good metallicity resolution. The colour distributions and radial projected densities of the GCSs are analyzed. We focus on the properties of the GCSs that trace possible interaction processes between the galaxies, such as tidal stripping of globular clusters. For the blue globular clusters, we find tails between NGC 1399 and neighbouring galaxies in the azimuthal projected distribution, and the three low-luminosity galaxies show low specific frequencies and a low proportion of blue GCs.

  20. Large-scale study of the NGC 1399 globular cluster system in Fornax

    CERN Document Server

    Bassino, L P; Forte, J C; Dirsch, B; Richtler, T; Geisler, D; Schuberth, Y

    2006-01-01

    We present a Washington C and Kron-Cousins R photometric study of the globular cluster system of NGC 1399, the central galaxy of the Fornax cluster. A large areal coverage of 1 square degree around NGC 1399 is achieved with three adjoining fields of the MOSAIC II Imager at the CTIO 4-m telescope. Working on such a large field, we can perform the first indicative determination of the total size of the NGC 1399 globular cluster system. The estimated angular extent, measured from the NGC 1399 centre and up to a limiting radius where the areal density of blue globular clusters falls to 30 per cent of the background level, is 45 +/- 5 arcmin, which corresponds to 220 - 275 kpc at the Fornax distance. The bimodal colour distribution of this globular cluster system, as well as the different radial distribution of blue and red clusters, up to these large distances from the parent galaxy, are confirmed. The azimuthal globular cluster distribution exhibits asymmetries that might be understood in terms of tidal strippin...

  1. Globular clusters as tracers of the host galaxy mass distribution: the Fornax dSph test case

    Science.gov (United States)

    Arca-Sedda, M.; Capuzzo-Dolcetta, R.

    2016-10-01

    The Fornax dwarf spheroidal galaxy is the most massive satellites of the Milky Way, claimed to be embedded in a huge dark matter halo, and the only among the Milky Way satellites hosting five globular clusters. Interestingly, their estimated masses, ages and positions seem hardly compatible with the presence of a significant dark matter component, as expected in the ΛCDM scheme. Indeed, if Fornax would have a CDM halo with a standard density profile, all its globular clusters should have sunk to the galactic centre many Gyr ago due to dynamical friction. Due to this, some authors proposed that the most massive clusters may have formed out of Fornax and later tidally captured. In this paper, we investigate the past evolution of the Fornax GC system by using both a recently developed, semi-analytical treatment of dynamical friction and direct N-body simulations of the orbital evolution of the globular clusters within Fornax and of Fornax galaxy around the Milky Way. Our results suggest that an `in situ' origin for all the clusters is likely if their observed positions are close to their spatial ones and their orbits are almost circular. Moreover, the Milky Way seems to accelerate the GC decay reducing the decay time of 15 per cent. Nevertheless, our results indicate that the GCs survival probability exceeds 50 per cent, even in the case of cuspy density profiles. We conclude that more detailed data are required to shed light on the Fornax dark matter content, to distinguish between a cuspy or a cored profile.

  2. First results from SAPAC: towards a 3D-picture of the Fornax cluster core

    CERN Document Server

    Jerjen, L P D H

    2006-01-01

    A sophisticated SBF analysis package has been developed, designed to measure distances of early-type galaxies by means of surface brightness fluctuations of unresolved stars. This suite of programs called SAPAC is made readily available to the astronomical community for extensive testing with the long-term goal to provide the necessary tools for systematic distance surveys of early-type galaxies using modern optical/NIR telescopes equipped with wide-field cameras. We discuss the technical and scientific concepts of SAPAC and demonstrate its capabilities by analysing deep B and R-band CCD images of 10 dwarf elliptical (dE) galaxy candidates in the Fornax cluster obtained with FORS1 at the VLT. All candidates are confirmed as cluster members. We then turn our attention to the innermost region of the Fornax cluster. A total of 29 early-type galaxies closer than three cluster core radii (2 degrees) from the central galaxy NGC1399 have radial velocities and SBF distances. Their Hubble diagram exhibits a pronounced...

  3. Constraints on mass loss and self-enrichment scenarios for the globular clusters of the Fornax dSph

    CERN Document Server

    Larsen, S S; Brodie, J P

    2012-01-01

    Recently, high-dispersion spectroscopy has demonstrated conclusively that four of the five globular clusters (GCs) in the Fornax dwarf spheroidal galaxy are very metal-poor with [Fe/H]<-2. The remaining cluster, Fornax 4, has [Fe/H]=-1.4. This is in stark contrast to the field star metallicity distribution which shows a broad peak around [Fe/H]=-1 with only a few percent of the stars having [Fe/H]<-2. If we only consider stars and clusters with [Fe/H]<-2 we thus find an extremely high GC specific frequency, SN=400, implying by far the highest ratio of GCs to field stars known anywhere. We estimate that about 1/5-1/4 of all stars in the Fornax dSph with [Fe/H]<-2 belong to the four most metal-poor GCs. These GCs could, therefore, at most have been a factor of 4-5 more massive initially. Yet, the Fornax GCs appear to share the same anomalous chemical abundance patterns known from Milky Way GCs, commonly attributed to the presence of multiple stellar generations within the clusters. The extreme ratio...

  4. The chemical composition of Ultracompact Dwarf Galaxies in the Virgo and Fornax Clusters

    CERN Document Server

    Francis, K J; Chilingarian, Igor V; Bolt, A M; Firth, P

    2012-01-01

    We present spectroscopic observations of ultra compact dwarf (UCD) galaxies in the Fornax and Virgo Clusters made to measure and compare their stellar populations. The spectra were obtained on the Gemini-North (Virgo) and Gemini-South (Fornax) Telescopes using the respective Gemini Multi-Object Spectrographs. We estimated the ages, metallicities and abundances of the objects from mea- surements of Lick line-strength indices in the spectra; we also estimated the ages and metallicities independently using a direct spectral fitting technique. Both methods re- vealed that the UCDs are old (mean age 10.8 \\pm 0.7 Gyr) and (generally) metal-rich (mean [Fe/H] = -0.8 \\pm 0.1). The alpha-element abundances of the objects measured from the Lick indices are super-Solar. We used these measurements to test the hypothesis that UCDs are formed by the tidal disruption of present-day nucleated dwarf elliptical galaxies. The data are not consistent with this hypothesis because both the ages and abundances are significantly high...

  5. Surface Brightness Profiles for a sample of LMC, SMC and Fornax galaxy Globular Clusters

    CERN Document Server

    Noyola, Eva

    2007-01-01

    We use Hubble Space Telescope archival images to measure central surface brightness profiles of globular clusters around satellite galaxies of the Milky Way. We report results for 21 clusters around the LMC, 5 around the SMC, and 4 around the Fornax dwarf galaxy. The profiles are obtained using a recently developed technique based on measuring integrated light, which is tested on an extensive simulated dataset. Our results show that for 70% of the sample, the central photometric points of our profiles are brighter than previous measurements using star counts with deviations as large as 2 mag/arcsec^2. About 40% of the objects have central profiles deviating from a flat central core, with central logarithmic slopes continuously distributed between -0.2 and -1.2. These results are compared with those found for a sample of Galactic clusters using the same method. We confirm the known correlation in which younger clusters tend to have smaller core radii, and we find that they also have brighter central surface br...

  6. The central region of the Fornax cluster; 3, Dwarf galaxies, globular clusters, and cD halo are there interrelations?

    CERN Document Server

    Hilker, M; Richtler, T

    1999-01-01

    In this paper we briefly review the properties of the dwarf galaxy population at the core of the Fornax cluster, as well as the properties of the extraordinary rich globular cluster system and the cD halo around the central galaxy NGC 1399. In turn, the question whether a scenario in which dwarf galaxies have been accreted and dissolved in the cluster center can explain the observed properties is addressed. The possibility of accretion of a certain number of dwarf galaxies, the stripping of their globular clusters and gas, and the formation of new globular clusters from stripped infalling gas are discussed. An increase in the specific frequency of the central globular cluster system is only possible, if the infalling gas from stripped dwarfs formed globulars very efficiently and/or accreted and stripped dwarf galaxies possessed a rich globular cluster system themselves. In conclusion, we argue that although the dwarf galaxy infall is a very attractive scenario to explain a number of properties in the system t...

  7. The central region of the Fornax cluster; 2, Spectroscopy and radial velocities of member and background galaxies

    CERN Document Server

    Hilker, M; Vieria, G; Kissler-Patig, M; Richtler, T

    1998-01-01

    Radial velocities of 94 galaxies brighter than about V_tot = 20 mag in the direction of the central Fornax cluster have been measured. Except for 8 Fornax members, all galaxies lie in the background. Among the 8 members, there are 5 nucleated dwarf ellipticals that are already listed in the FCC (Ferguson 1989, AJ 98, 367). Two of the 3 ``new'' members are very compact and have surface brightnesses comparable to globular clusters, however their luminosities are in the range of dwarf elliptical nuclei. The measured line indices (especially Mg2, H beta, and iron) of the brighter of the compact objects suggest a solar metallicity, whereas the fainter compact object as well as the dE,Ns have line indices that are similar to those of old metal-poor globular clusters (GCs). However, with these data it is not possible to clearly classify the compact objects either as very bright globular clusters, isolated nuclei of dE,Ns, or even compact ellipticals. A background galaxy cluster at z = 0.11 has been found just behind...

  8. Evidence for a chemical enrichment coupling of globular clusters and field stars in the Fornax dSph

    Science.gov (United States)

    Hendricks, Benjamin; Boeche, Corrado; Johnson, Christian I.; Frank, Matthias J.; Koch, Andreas; Mateo, Mario; Bailey, John I.

    2016-01-01

    The globular cluster H4, located in the center of the Fornax dwarf spheroidal galaxy, is crucial for understanding the formation and chemical evolution of star clusters in low-mass galactic environments. H4 is peculiar because the cluster is significantly more metal-rich than the galaxy's other clusters, is located near the galaxy center, and may also be the youngest cluster in the galaxy. In this study, we present detailed chemical abundances derived from high-resolution (R ~ 28 000) spectroscopy of an isolated H4 member star for comparison with a sample of 22 nearby Fornax field stars. We find the H4 member to be depleted in the alpha-elements Si, Ca, and Ti with [Si/Fe] = -0.35 ± 0.34, [Ca/Fe] = + 0.05 ± 0.08, and [Ti/Fe] = -0.27 ± 0.23, resulting in an average [α/Fe] = -0.19 ± 0.14. If this result is representative of the average cluster properties, H4 is the only known system with a low [α/Fe] ratio and a moderately low metallicity embedded in an intact birth environment. For the field stars we find a clear sequence, seen as an early depletion in [α/Fe] at low metallicities, in good agreement with previous measurements. H4 falls on top of the observed field star [α/Fe] sequence and clearly disagrees with the properties of Milky Way halo stars. We therefore conclude that within a galaxy, the chemical enrichment of globular clusters may be closely linked to the enrichment pattern of the field star population. The low [α/Fe] ratios of H4 and similar metallicity field stars in Fornax give evidence that slow chemical enrichment environments, such as dwarf galaxies, may be the original hosts of alpha-depleted clusters in the halos of the Milky Way and M31. This article includes data gathered with the 6.5 m Magellan Telescopes located at Las Campanas Observatory, Chile.

  9. The central region of the Fornax cluster; 2, A catalog and photometric properties of galaxies in selected CCD fields

    CERN Document Server

    Hilker, M; Richtler, T; Infante, L; Quintana, H

    1998-01-01

    We present a photometric catalog (based on V and I photometry) of galaxies in the central regions of the Fornax galaxy cluster. Our 11 CCD fields cover 0.17 degrees in total. The limiting surface brightness is around 24 mag arsec^-2, similar to that of Ferguson's (1989, AJ 98, 367) catalog, whereas our limiting total magnitude is around V = 22 mag, about two magnitudes fainter. It is the surface brightness limit, however, that prevents us from detecting the counterparts of the faintest Local Group dwarf spheroidals. The photometric properties of all objects are presented as a catalog. The properties and fit parameters of the surface brightness profiles for a sub-sample are presented as a second catalog (both catalogs are available in electronic form at the CDS). We can only add 4 new dwarf galaxies to Ferguson's catalog. However, we confirm that the dwarf galaxies in Fornax follow a similar surface brightness-magnitude relation as the Local Group dwarfs. They also follow the color (metallicity) - relation see...

  10. Search for Dark Matter Annihilation Signals from the Fornax Galaxy Cluster with H.E.S.S

    CERN Document Server

    Abramowski, A; Aharonian, F; Akhperjanian, A G; Anton, G; Balzer, A; Barnacka, A; de Almeida, U Barres; Becherini, Y; Becker, J; Behera, B; Bernlöhr, K; Birsin, E; Biteau, J; Bochow, A; Boisson, C; Bolmont, J; Bordas, P; Brucker, J; Brun, F; Brun, P; Bulik, T; Büsching, I; Carrigan, S; Casanova, S; Cerruti, M; Chadwick, P M; Charbonnier, A; Chaves, R C G; Cheesebrough, A; Clapson, A C; Coignet, G; Cologna, G; Conrad, J; Dalton, M; Daniel, M K; Davids, I D; Degrange, B; Deil, C; Dickinson, H J; Djannati-Ataï, A; Domainko, W; Drury, L O'C; Dubus, G; Dutson, K; Dyks, J; Dyrda, M; Egberts, K; Eger, P; Espigat, P; Fallon, L; Farnier, C; Fegan, S; Feinstein, F; Fernandes, M V; Fiasson, A; Fontaine, G; Förster, A; Füßling, M; Gallant, Y A; Gast, H; Gérard, L; Gerbig, D; Giebels, B; Glicenstein, J F; Glück, B; Goret, P; Göring, D; Häffner, S; Hague, J D; Hampf, D; Hauser, M; Heinz, S; Heinzelmann, G; Henri, G; Hermann, G; Hinton, J A; Hoffmann, A; Hofmann, W; Hofverberg, P; Holler, M; Horns, D; Jacholkowska, A; de Jager, O C; Jahn, C; Jamrozy, M; Jung, I; Kastendieck, M A; Katarzyński, K; Katz, U; Kaufmann, S; Keogh, D; Khangulyan, D; Khélifi, B; Klochkov, D; Kluźniak, W; Kneiske, T; Komin, Nu; Kosack, K; Kossakowski, R; Laffon, H; Lamanna, G; Lennarz, D; Lohse, T; Lopatin, A; Lu, C -C; Marandon, V; Marcowith, A; Masbou, J; Maurin, D; Maxted, N; Mayer, M; McComb, T J L; Medina, M C; Méhault, J; Moderski, R; Moulin, E; Naumann, C L; Naumann-Godo, M; de Naurois, M; Nedbal, D; Nekrassov, D; Nguyen, N; Nicholas, B; Niemiec, J; Nolan, S J; Ohm, S; Wilhelmi, E de Oña; Opitz, B; Ostrowski, M; Oya, I; Panter, M; Arribas, M Paz; Pedaletti1, G; Pelletier, G; Petrucci, P -O; Pita, S; Pühlhofer, G; Punch, M; Quirrenbach, A; Raue, M; Rayner, S M; Reimer, A; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Ripken, J; Rob, L; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Ruppel, J; Sahakian, V; Sanchez, D A; Santangelo, A; Schlickeiser, R; Schöck, F M; Schulz, A; Schwanke, U; Schwarzburg, S; Schwemmer, S; Sheidaei, F; Skilton, J L; Sol, H; Spengler, G; Stawarz, Ł; Steenkamp, R; Stegmann, C; Stinzing, F; Stycz, K; Sushch, I; Szostek, A; Tavernet, J -P; Terrier, R; Tluczykont, M; Valerius, K; van Eldik, C; Vasileiadis, G; Venter, C; Vialle, J P; Viana, A; Vincent, P; Völk, H J; Volpe, F; Vorobiov, S; Vorster, M; Wagner, S J; Ward, M; White, R; Wierzcholska, A; Zacharias, M; Zajczyk, A; Zdziarski, A A; Zech, A; Zechlin, H -S

    2012-01-01

    The Fornax galaxy cluster was observed with the High Energy Stereoscopic System (H.E.S.S.) for a total live time of 14.5 hours, searching for very-high-energy (VHE, E>100 GeV) gamma-rays from dark matter (DM) annihilation. No significant signal was found in searches for point-like and extended emissions. Using several models of the DM density distribution, upper limits on the DM velocity-weighted annihilation cross-section as a function of the DM particle mass are derived. Constraints are derived for different DM particle models, such as those arising from Kaluza-Klein and supersymmetric models. Various annihilation final states are considered. Possible enhancements of the DM annihilation gamma-ray flux, due to DM substructures of the DM host halo, or from the Sommerfeld effect, are studied. Additional gamma-ray contributions from internal bremsstrahlung and inverse Compton radiation are also discussed. For a DM particle mass of 1 TeV, the exclusion limits at 95% of confidence level reach values of ~ 10^-23...

  11. Searches for dark matter self-annihilation signals from dwarf spheroidal galaxies and the Fornax galaxy cluster with imaging air Cherenkov telescopes

    International Nuclear Information System (INIS)

    Many astronomical observations indicate that dark matter pervades the universe and dominates the formation and dynamics of cosmic structures. Weakly interacting massive particles (WIMPs) with masses in the GeV to TeV range form a popular class of dark matter candidates. WIMP self-annihilation may lead to the production of γ-rays in the very high energy regime above 100 GeV, which is observable with imaging air Cherenkov telescopes (IACTs). For this thesis, observations of dwarf spheroidal galaxies (dSph) and the Fornax galaxy cluster with the Cherenkov telescope systems H.E.S.S., MAGIC and VERITAS were used to search for γ-ray signals of dark matter annihilations. The work consists of two parts: First, a likelihood-based statistical technique was introduced to combine published results of dSph observations with the different IACTs. The technique also accounts for uncertainties on the ''J factors'', which quantify the dark matter content of the dwarf galaxies. Secondly, H.E.S.S. observations of the Fornax cluster were analyzed. In this case, a collection of dark matter halo models was used for the J factor computation. In addition, possible signal enhancements from halo substructures were considered. None of the searches yielded a significant γ-ray signal. Therefore, the results were used to place upper limits on the thermally averaged dark matter self-annihilation cross-section left angle σν right angle. Different models for the final state of the annihilation process were considered. The cross-section limits range from left angle σν right angle UL∝10-19 cm3s-1 to left angle σν right angle UL∝10-25 cm3s-1 for dark matter particles masses between 100 GeV and 100 TeV. Some of the diverse model uncertainties causing this wide range of left angle σν right angle UL values were analyzed.

  12. The supermassive black hole of Fornax A

    CERN Document Server

    Nowak, N; Thomas, J; Bender, R; Davies, R I; Gebhardt, K

    2008-01-01

    The radio galaxy Fornax A (NGC 1316) is a prominent merger remnant in the outskirts of the Fornax cluster. Its giant radio lobes suggest the presence of a powerful AGN and thus a central supermassive black hole (SMBH). We present high-resolution adaptive optics assisted integral-field data of Fornax A, taken with SINFONI at the Very Large Telescope in the K band. We use axisymmetric orbit models to determine the mass of the SMBH in the centre of Fornax A. The three-dimensional nature of our data provides the possibility to directly test the consistency of the data with axisymmetry by modelling each of the four quadrants separately. According to our dynamical models, consistent SMBH masses and dynamical Ks band mass-to-light ratios are obtained for all quadrants, with =1.3x10^8 M_\\odot (rms(M_BH)=0.4x10^8 Msun) and =0.68 (rms(M/L)=0.03), confirming the assumption of axisymmetry. For the folded and averaged data we find M_BH=(1.5+0.75-0.8)x10^8 Msun and M/L=(0.65+0.075-0.05) (3-sigma errors). Thus the black-hol...

  13. Ultra-Compact Dwarfs in the Coma Cluster

    OpenAIRE

    Chiboucas, Kristin; Tully, R. Brent; Marzke, ; Ronald O.; Phillipps, Steve; Price, James; Peng, Eric; Trentham, Neil; Carter, David; Hammer, Derek

    2011-01-01

    We have undertaken a spectroscopic search for ultra compact dwarf galaxies (UCDs) in the dense core of the dynamically evolved, massive Coma cluster as part of the HST/ACS Coma Cluster Treasury Survey. UCD candidates were initially chosen based on color, magnitude, degree of resolution within the ACS images, and the known properties of Fornax and Virgo UCDs. Follow-up spectroscopy with Keck/LRIS confirmed 27 candidates as members of the Coma Cluster, a success rate > 60% for targeted objects ...

  14. Chemical analysis of fornax dwarf spheroidal with VLT/flames

    NARCIS (Netherlands)

    Letarte, B.; Hill, V.; Tolstoy, E.; Emsellem, E; Wozniak, H; Massacrier, G; Gonzalez, JF; Devriendt, J; Champavert, N

    2007-01-01

    The Fornax dSpb is a nearby dwarf spheroidal galaxy with five globular clusters and a complex star formation history. It is one of the most massive dwarf spheroidal galaxies in the Local Group. Using the FLAMES/GlRAFFE spectrograph on the VLT, we have obtained high resolution (R similar to 20 000) s

  15. Distance scale and variable stars in Local Group Galaxies LMC and Fornax

    CERN Document Server

    Maio, M; Clementini, G; Greco, C; Gullieuszik, M; Held, E V; Poretti, E; Rizzi, L; Bragaglia, A; Carretta, E; Fabrizio, L D; Gratton, R; Taribello, E

    2003-01-01

    We briefly review our photometric and spectroscopic study of RR Lyrae variable stars in the bar of the Large Magellanic Cloud (LMC), that allowed us to reconcile the so-called "short" and "long" distance moduli of the LMC on the value mod_LMC=18.51 +/- 0.085 mag. Then we present preliminary results from the photometric study of a 33' x 34' area in the Fornax dwarf spheroidal galaxy containing the stellar clusters Fornax 3 (NGC 1049) and 6. We identified about 1000 candidate variables in this field of Fornax, and report the first detection and measure of about 60 RR Lyrae variable stars in the globular cluster Fornax 3.

  16. Modelado de la luz difusa en el cúmulo de Fornax

    Science.gov (United States)

    Cifuentes Cárdenas, A.; Cellone, S. A.; Forte, J. C.

    Studies of the globular cluster system of the elliptical galaxy NGC 1399, the central galaxy in the Fornax cluster, suggest that many globulars may be associated with the cluster of galaxies potential, and not being bound to any single galaxy. However, the galaxies are diffuse objects and without a defined edge; this raises a question: is there a true "intergalactic medium?". The goal of this work is to quantify the contribution to "intergalactic" surface brightness due to the outermost zones of each galaxy in the Fornax cluster and also quantify the surface density of globular clusters associated to this diffuse component.

  17. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    CERN Document Server

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M

    1997-01-01

    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  18. Unveiling a Rich System of Faint Dwarf Galaxies in the Next Generation Fornax Survey

    CERN Document Server

    Munoz, Roberto P; Puzia, Thomas H; Taylor, Matthew A; Ordenes-Briceno, Yasna; Alamo-Martinez, Karla; Ribbeck, Karen X; Angel, Simon; Capaccioli, Massimo; Cote, Patrick; Ferrarese, Laura; Galaz, Gaspar; Hempel, Maren; Hilker, Michael; Jordan, Andres; Lancon, Ariane; Mieske, Steffen; Paolillo, Maurizio; Richtler, Tom; Sanchez-Janssen, Ruben; Zhang, Hongxin

    2015-01-01

    We report the discovery of 158 previously undetected dwarf galaxies in the Fornax cluster central regions using a deep coadded $u, g$ and $i$-band image obtained with the DECam wide-field camera mounted on the 4-meter Blanco telescope at the Cerro Tololo Interamerican Observatory as part of the {\\it Next Generation Fornax Survey} (NGFS). The new dwarf galaxies have quasi-exponential light profiles, effective radii $0.1\\!\\!75\\%$ at luminosities brighter than $M_i\\!\\simeq\\!-15.0$ mag to $0\\%$ at luminosities fainter than $M_i\\!\\simeq\\!-10.0$ mag. The two-point correlation function analysis of the NGFS dwarf sample shows an excess on length scales below $\\sim\\!100$ kpc, pointing to the clustering of dwarf galaxies in the Fornax cluster core.

  19. The HST/ACS Coma Cluster Survey IV. Intergalactic Globular Clusters and the Massive Globular Cluster System at the Core of the Coma Galaxy Cluster

    OpenAIRE

    Peng, Eric W.; Ferguson, Henry C.; Goudfrooij, Paul; Hammer, Derek; Lucey, John R.; Marzke, ; Ronald O.; Puzia, Thomas H.; Carter, David; Balcells, Marc; Bridges, Terry; Chiboucas, Kristin; del Burgo, Carlos; Graham, Alister W.; Guzman, Rafael; Hudson, Michael J.

    2011-01-01

    Intracluster stellar populations are a natural result of tidal interactions in galaxy clusters. Measuring these populations is difficult, but important for understanding the assembly of the most massive galaxies. The Coma cluster is one of the nearest truly massive galaxy clusters, and is host to a correspondingly large system of globular clusters (GCs). We use imaging from the HST/ACS Coma Cluster Survey to present the first definitive detection of a large population of intracluster GCs (IGC...

  20. The ACS Survey of Galactic Globular Clusters. I. Overview and Clusters Without Previous HST Photometry

    CERN Document Server

    Sarajedini, A; Chaboyer, B; Dotter, A; Siegel, M; Anderson, J; Aparicio, A; King, I; Majewski, S; Marin-Franch, A; Piotto, G; Reid, I N; Rosenberg, A L; Sarajedini, Ata

    2006-01-01

    We present the first results of a large ACS Survey of Galactic globular clusters. This Hubble Space Telescope (HST) Treasury project is designed to obtain photometry with S/N > ~10 for main sequence stars with masses > ~0.2Msun in a sample of globulars using the Advanced Camera for Surveys (ACS) Wide Field Channel. Here we focus on clusters without previous HST imaging data. These include NGC 5466, 6779, 5053, 6144, Palomar 2, E 3, Lynga 7, Palomar 1, and NGC 6366. Our CMDs extend reliably from the horizontal branch to as much as seven magnitudes fainter than the main sequence turnoff and represent the deepest CMDs published to-date for these clusters. Using fiducial sequences for three standard clusters (M92, NGC 6752, and 47 Tuc) with well-known metallicities and distances, we perform main sequence fitting on the target clusters in order to obtain estimates of their distances and reddenings. These comparisons along with fitting the cluster main sequences to theoretical isochrones yield ages for the target c...

  1. Cluster emission in the radioactive decay of 223Ac

    CERN Document Server

    Steyn, G F; Faccio, D; Bonetti, R; Tretyakova, S P; Shishkin, S V; Ogloblin, A A; Pik-Pichak, G A; Vermeulen, C; van der Meulen, N P; van der Walt, T N; McGee, D

    2010-01-01

    The branching ratio of 223Ac decay by spontaneous 14C emission was measured and a search for 15N clusters was performed. After exposure of a hemispherical array of solid-state nuclear track detectors, 347 14C events were identified and no 15N events. B(14C) = λ(14C)/λ(α) = (3.2 ± 1.0) x 10-11 is consistent with a favoured ground state to ground state transition. As no nitrogen tracks were found, only an upper limit could be inferred for 15N emission, B(15N) = λ(15N)/λ(α) ≤ 2.2 x 10-13 (confidence limit 90%), consistent with an unfavoured transition. Intense 227Pa sources were produced for this study, using the reaction 232Th(p,6n)227Pa. This offered an opportunity to compare the measured source strength with predictions based on published excitation function data.

  2. The HST/ACS Coma Cluster Survey : II. Data Description and Source Catalogs

    NARCIS (Netherlands)

    Hammer, Derek; Kleijn, Gijs Verdoes; Hoyos, Carlos; den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Peletier, Reynier F.; Smith, Russell J.; Graham, Alister W.; Trentham, Neil; Peng, Eric; Puzia, Thomas H.; Lucey, John R.; Jogee, Shardha; Aguerri, Alfonso L.; Batcheldor, Dan; Bridges, Terry J.; Chiboucas, Kristin; Davies, Jonathan I.; del Burgo, Carlos; Erwin, Peter; Hornschemeier, Ann; Hudson, Michael J.; Huxor, Avon; Jenkins, Leigh; Karick, Arna; Khosroshahi, Habib; Kourkchi, Ehsan; Komiyama, Yutaka; Lotz, Jennifer; Marzke, Ronald O.; Marinova, Irina; Matkovic, Ana; Merritt, David; Miller, Bryan W.; Miller, Neal A.; Mobasher, Bahram; Mouhcine, Mustapha; Okamura, Sadanori; Percival, Sue; Phillipps, Steven; Poggianti, Bianca M.; Price, James; Sharples, Ray M.; Tully, R. Brent; Valentijn, Edwin

    2010-01-01

    The Coma cluster, Abell 1656, was the target of an HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially completed survey still covers ~50% of the core high-density region in

  3. The Chemical Enrichment History of the Fornax Dwarf Spheroidal Galaxy from the Infrared Calcium Triplet

    CERN Document Server

    Pont, F; Gallart, C; Hardy, E; Winnick, R A; Pont, Frederic; Zinn, Robert; Gallart, Carme; Hardy, Eduardo; Winnick, Rebeccah

    2004-01-01

    Near infrared spectra were obtained for 117 red giants in the Fornax dwarf spheroidal galaxy with the FORS1 spectrograph on the VLT, in order to study the metallicity distribution of the stars and to lift the age-metallicity degeneracy of the red giant branch (RGB) in the color-magnitude diagram (CMD). Metallicities are derived from the equivalent widths of the infrared Calcium triplet lines at 8498, 8542, and 8662 A, calibrated with data from globular clusters, the open cluster M67 and the LMC. For a substantial portion of the sample, the strength of the Calcium triplet is unexpectedly high, clearly indicating that the main stellar population of Fornax is significantly more metal-rich than could be inferred from the position of its RGB in the CMD. We show that the relative narrowness of the RGB in Fornax is caused by the superposition of stars of very different ages and metallicities. The metallicity distribution in Fornax is centered at [Fe/H]= -0.9, with a metal-poor tail extending to [Fe/H] ~= -2. While t...

  4. Ac hopping conduction at extreme disorder takes place on the percolating cluster

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, J. C.

    2008-01-01

    Simulations of the random barrier model show that ac currents at extreme disorder are carried almost entirely by the percolating cluster slightly above threshold; thus contributions from isolated low activation-energy clusters are negligible. The effective medium approximation in conjunction with...

  5. Fornax compact object survey FCOS: On the nature of Ultra Compact Dwarf galaxies

    CERN Document Server

    Mieske, S; Infante, L

    2004-01-01

    The results of the Fornax Compact Object Survey (FCOS) are presented. The FCOS aims at investigating the nature of the Ultra Compact Dwarf galaxies (UCDs) recently discovered in the center of the Fornax cluster (Drinkwater et al. 2000). 280 unresolved objects in the magnitude space covering UCDs and bright globular clusters (1820 mag) at 96% confidence. The mean velocity of the bright compact objects is consistent with that of the dwarf galaxy population in Fornax, but inconsistent with that of NGC 1399's globular cluster system at 93.5% confidence. The compact objects follow a colour magnitude relation with a slope very similar to that of normal dEs, but shifted about 0.2 mag redwards. The magnitude distribution of compact objects shows a fluent transition between UCDs and GCs with an overpopulation of 8 +/- 4 objects for V<20 mag with respect to the extrapolation of NGC 1399's GC luminosity function. The spatial distribution of bright compact objects is in comparison to the faint ones more extended at 88...

  6. THE HST/ACS COMA CLUSTER SURVEY. IV. INTERGALACTIC GLOBULAR CLUSTERS AND THE MASSIVE GLOBULAR CLUSTER SYSTEM AT THE CORE OF THE COMA GALAXY CLUSTER

    International Nuclear Information System (INIS)

    Intracluster stellar populations are a natural result of tidal interactions in galaxy clusters. Measuring these populations is difficult, but important for understanding the assembly of the most massive galaxies. The Coma cluster of galaxies is one of the nearest truly massive galaxy clusters and is host to a correspondingly large system of globular clusters (GCs). We use imaging from the HST/ACS Coma Cluster Survey to present the first definitive detection of a large population of intracluster GCs (IGCs) that fills the Coma cluster core and is not associated with individual galaxies. The GC surface density profile around the central massive elliptical galaxy, NGC 4874, is dominated at large radii by a population of IGCs that extend to the limit of our data (R +4000-5000 (systematic) IGCs out to this radius, and that they make up ∼70% of the central GC system, making this the largest GC system in the nearby universe. Even including the GC systems of other cluster galaxies, the IGCs still make up ∼30%-45% of the GCs in the cluster core. Observational limits from previous studies of the intracluster light (ICL) suggest that the IGC population has a high specific frequency. If the IGC population has a specific frequency similar to high-SN dwarf galaxies, then the ICL has a mean surface brightness of μV ∼ 27 mag arcsec-2 and a total stellar mass of roughly 1012 Msun within the cluster core. The ICL makes up approximately half of the stellar luminosity and one-third of the stellar mass of the central (NGC 4874+ICL) system. The color distribution of the IGC population is bimodal, with blue, metal-poor GCs outnumbering red, metal-rich GCs by a ratio of 4:1. The inner GCs associated with NGC 4874 also have a bimodal distribution in color, but with a redder metal-poor population. The fraction of red IGCs (20%), and the red color of those GCs, implies that IGCs can originate from the halos of relatively massive, L* galaxies, and not solely from the disruption of dwarf

  7. VizieR Online Data Catalog: HST/ACS Coma Cluster Survey. X. (den Brok+, 2014)

    NARCIS (Netherlands)

    den Brok, M.; Peletier, R. F.; Seth, A.; Balcells, M.; Dominguez, L.; Graham, A. W.; Carter, D.; Erwin, P.; Ferguson, H. C.; Goudfrooij, P.; Guzman, R.; Hoyos, C.; Jogee, S.; Lucey, J.; Phillipps, S.; Puzia, T.; Valentijn, E.; Kleijn, G. V.; Weinzirl, T.

    2014-01-01

    The Coma ACS Survey (Carter et al., 2008ApJS..176..424C) provides data in two passbands for 25 fields pointed at the core of the Coma cluster and at the outskirts. The exposure times in the two passbands, F814W and F475W (which are roughly equivalent to the IC and g band) were ~1400 and ~2600s. The

  8. The SLUGGS Survey: HST/ACS Mosaic Imaging of the NGC 3115 Globular Cluster System

    CERN Document Server

    Jennings, Zachary G; Romanowsky, Aaron J; Brodie, Jean P; Arnold, Jacob A; Lin, Dacheng; Irwin, Jimmy A; Sivakoff, Gregory R; Wong, Ka-Wah

    2014-01-01

    We present HST/ACS $g$ and $z$ photometry and half-light radii $R_{\\rm h}$ measurements of 360 globular cluster (GC) candidates around the nearby S0 galaxy NGC 3115. We also include Subaru/Suprime-Cam $g$, $r$, and $i$ photometry of 421 additional candidates. The well-established color bimodality of the GC system is obvious in the HST/ACS photometry. We find evidence for a "blue tilt" in the blue GCs, wherein the blue GCs get redder as luminosity increases, indicative of a mass-metallicity relationship. We find a color gradient in both the red and blue subpopulations, with each group of clusters becoming bluer at larger distances from NGC 3115. The gradient is of similar strength in both subpopulations, but is monotonic and more significant for the blue clusters. On average, the blue clusters have ~10% larger $R_{\\rm h}$ than the red clusters. This average difference is less than is typically observed for early-type galaxies but does match that measured in the literature for M104, suggesting that morphology a...

  9. The ACS survey of globular clusters. XIII. Photometric calibration in comparison with Stetson standards

    CERN Document Server

    Hempel, Maren; Anderson, Jay; Aparicio, Antonio; Bedin, Luigi R; Chaboyer, Brian; Majewski, Steven R; Marín-Franch, Antonio; Milone, Antonino; Paust, Nathaniel E Q; Piotto, Giampaolo; Reid, I Neill; Rosenberg, Alfred; Siegel, Michael

    2013-01-01

    In this study we compare the photometric data of 34 Milky Way globular clusters, observed within the ACS Treasury Program (PI: Ata Sarajedini) with the corresponding ground-based data, provided by the Photometric Standard Field Catalogs of Stetson (2000, 2005). We focus on the transformation between the HST/ACS F606W to V-band and F814W to I-band only. The goal is to assess the validity of the filter transformation equations by Sirianni et al.(2005) with respect to their dependence on metallicity, Horizontal Branch morphology, mass and integrated (V-I) colour of the various globular clusters. Such a dependence is expected due to the fact that the transformation equations are based on the observations of only one globular cluster, i.e., NGC 2419. Surprisingly, the correlation between offset and metallicity is found to be weak, with a low level significance. The correlation between offset and Horizontal Branch structure, as well as total cluster mass is still weaker. Based on the available data we do not find t...

  10. Fornax A's Western Radio Lobe Composition

    Science.gov (United States)

    Kong, Jason J.; Nulsen, P. E. J.; Kraft, R. P.

    2011-01-01

    We present an analysis of the western radio lobe of Fornax A based on an XMM-Newton observation. We find little evidence for the inverse-Compton scattering of the cosmic microwave background as reported previously. The spectra in the energy range of 0.5-5 keV are well fitted by a thermal plus power law model for every spectral region we extracted. With a fixed photon index of 1.68, the X-ray flux density at 1 keV from the power law fit was measured to be cool gas extends from the central galaxy in the direction of the radio lobe of Fornax A. Spectral fits give a temperature of kT=0.76 keV over the radio lobe and kT=0.32 keV for the cool filament. The thermal emission from the radio lobe region is best explained as emission from a thin shell of shocked gas swept up by the rapidly expanding lobe. This work is supported in part by the NSF REU and DOD ASSURE programs under NSF grant no. 0754568 and by the Smithsonian Institution.

  11. THE ACS SURVEY OF GLOBULAR CLUSTERS. XIII. PHOTOMETRIC CALIBRATION IN COMPARISON WITH STETSON STANDARDS

    Energy Technology Data Exchange (ETDEWEB)

    Hempel, Maren [Instituto de Astrofísica, Facultad de Fisica, Pontificia Universidad Católica de Chile, Vicuña Mackenna 4860, 7820436 Macul, Santiago (Chile); Sarajedini, Ata [Department of Astronomy, University of Florida, 211 Bryant Space Science Center, Gainesville, FL 32611 (United States); Anderson, Jay; Reid, I. Neill, E-mail: mhempel@astro.puc.cl, E-mail: ata@astro.ufl.edu, E-mail: jayander@stsci.edu, E-mail: inr@stsci.edu [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); and others

    2014-03-01

    In this study we compare the photometric data of 34 Milky Way globular clusters, observed within the Advanced Camera for Surveys (ACS) Treasury Program (PI: A. Sarajedini) with the corresponding ground-based data, provided by the Photometric Standard Field Catalogs of Stetson. We focus on the transformation between the Hubble Space Telescope/ACS F606W to V-band and F814W to I-band only. The goal is to assess the validity of the filter transformation equations by Sirianni et al. with respect to their dependence on metallicity, horizontal branch morphology, mass, and integrated (V – I) color of the various globular clusters. The transformation equations as recommended by Sirianni et al. are based on synthetic photometry, were mostly tested on NGC 2419, and may introduce additional uncertainties when applied to different stellar populations. Such a dependence is expected due to the fact that the transformation equations are based on the observations of only one globular cluster, i.e., NGC 2419. Surprisingly, the correlation between offset and metallicity is found to be weak, with a low level significance. The correlation between offset and horizontal branch structure, as well as total cluster mass is still weaker. Based on the available data we do not find the photometric offset to be linked to multiple stellar populations, e.g., as found in NGC 0288, NGC 1851, and NGC 5139. The results of this study show that there are small systematic offsets between the transformed ACS- and observed ground-based photometry, and that these are only weakly correlated, if at all, with various cluster parameters and their underlying stellar populations. As a result, investigators wishing to transform globular cluster photometry from the Sirianni et al. ground-based V, I system onto the Stetson system simply need to add –0.040 (±0.012) to the V magnitudes and –0.047 (±0.011) to the I magnitudes. This in turn means that the transformed ACS V – I colors match the ground

  12. Deep ACS Imaging in the Globular Cluster NGC 6397: The Cluster Color Magnitude Diagram and Luminosity Function

    CERN Document Server

    Richer, Harvey B; Hurley, Jarrod; Anderson, Jay; King, Ivan; Davis, Saul; Fahlman, Gregory G; Hansen, Brad M S; Kalirai, Jason; Paust, Nathaniel; Rich, R Michael; Shara, Michael M

    2007-01-01

    We present the CMD from deep HST imaging in the globular cluster NGC 6397. The ACS was used for 126 orbits to image a single field in two colors (F814W, F606W) 5 arcmin SE of the cluster center. The field observed overlaps that of archival WFPC2 data from 1994 and 1997 which were used to proper motion (PM) clean the data. Applying the PM corrections produces a remarkably clean CMD which reveals a number of features never seen before in a globular cluster CMD. In our field, the main sequence stars appeared to terminate close to the location in the CMD of the hydrogen-burning limit predicted by two independent sets of stellar evolution models. The faintest observed main sequence stars are about a magnitude fainter than the least luminous metal-poor field halo stars known, suggesting that the lowest luminosity halo stars still await discovery. At the bright end the data extend beyond the main sequence turnoff to well up the giant branch. A populous white dwarf cooling sequence is also seen in the cluster CMD. Th...

  13. Rotating stellar populations in the Fornax dSph galaxy

    CERN Document Server

    del Pino, Andrés; Hidalgo, Sebastian L; Lokas, Ewa L

    2016-01-01

    We present a novel analysis of the internal kinematics of the Fornax dwarf spheroidal galaxy. Our results are based on the largest sample of spectroscopic data for Fornax stars presently available ($> 2500$ stars), for which we have chemical and kinematic information. We introduce new software, Beacon, designed to detect chemo-kinematic patterns among stars of different stellar populations using their metallicity and velocity along the line of sight. Applying Beacon to Fornax we have detected non-negligible rotation signals around main optical axes of the galaxy, characteristic for a triaxial system partially supported by rotation. The dominant rotation pattern is relatively strong ($\\sim 12$ km s$^{-1}$), but the galaxy also shows additional weaker albeit complex rotation patterns. Using the information available from the star formation history of Fornax we have also derived the average age of the different chemo-kinematic components found by Beacon, which has allowed us to obtain its kinematic history. Our ...

  14. The HST/ACS Coma Cluster Survey : X. Nuclear star clusters in low-mass early-type galaxies: scaling relations

    NARCIS (Netherlands)

    Brok, Mark den; Peletier, Reynier F.; Seth, Anil; Balcells, Marc; Dominguez, Lilian; Graham, Alister W.; Carter, David; Erwin, Peter; Ferguson, Henry C.; Goudfrooij, Paul; Guzman, Rafael; Hoyos, Carlos; Jogee, Shardha; Lucey, John; Phillipps, Steven; Puzia, Thomas; Valentijn, Edwin; Verdoes Kleijn, Gijsbert; Weinzirl, Tim

    2014-01-01

    We present scaling relations between structural properties of nuclear star clusters and their host galaxies for a sample of early-type dwarf galaxies observed as part of the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) Coma Cluster Survey. We have analysed the light profiles of 200

  15. The HST/ACS Coma Cluster Survey - X. Nuclear star clusters in low-mass early-type galaxies : scaling relations

    NARCIS (Netherlands)

    den Brok, Mark; Peletier, Reynier F.; Seth, Anil; Balcells, Marc; Dominguez, Lilian; Graham, Alister W.; Carter, David; Erwin, Peter; Ferguson, Henry C.; Goudfrooij, Paul; Guzman, Rafael; Hoyos, Carlos; Jogee, Shardha; Lucey, John; Phillipps, Steven; Puzia, Thomas; Valentijn, Edwin; Kleijn, Gijs Verdoes; Weinzirl, Tim

    2014-01-01

    We present scaling relations between structural properties of nuclear star clusters and their host galaxies for a sample of early-type dwarf galaxies observed as part of the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) Coma Cluster Survey. We have analysed the light profiles of 200

  16. Extended Star Clusters in NGC 1023 from HST/ACS Mosaic Imaging

    CERN Document Server

    Forbes, Duncan; Spitler, Lee; Pota, Vincenzo

    2014-01-01

    Faint fuzzies are a relatively new class of star cluster, first found in the nearby S0 galaxy NGC 1023 by Larsen & Brodie using WFPC2 images from the Hubble Space Telescope (HST). Here we investigate the star cluster system of NGC 1023 using an eight pointing mosaic of ACS images from HST. We identify blue and red normal globular clusters (two of which are particularly luminous and dense) and two ultra compact dwarf objects (with effective radius ~10 pc). With our more complete spatial coverage, we also find 81 red and 27 blue faint fuzzies (FFs). We confirm the association of the red FFs with the disk of NGC 1023, consistent with them being long-lived open clusters. Half of the blue FFs appear to be associated with the dwarf satellite galaxy NGC 1023A (which was largely absent from the original HST/WFPC2 coverage), while the remainder are spatially coincident with the densest HI gas that surrounds NGC 1023. The blue FFs have colours that are consistent with young (few 100 Myr old) star clusters that form...

  17. THE HST/ACS COMA CLUSTER SURVEY. II. DATA DESCRIPTION AND SOURCE CATALOGS

    International Nuclear Information System (INIS)

    The Coma cluster, Abell 1656, was the target of an HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially completed survey still covers ∼50% of the core high-density region in Coma. Observations were performed for 25 fields that extend over a wide range of cluster-centric radii (∼1.75 Mpc or 10) with a total coverage area of 274 arcmin2. The majority of the fields are located near the core region of Coma (19/25 pointings) with six additional fields in the southwest region of the cluster. In this paper, we present reprocessed images and SEXTRACTOR source catalogs for our survey fields, including a detailed description of the methodology used for object detection and photometry, the subtraction of bright galaxies to measure faint underlying objects, and the use of simulations to assess the photometric accuracy and completeness of our catalogs. We also use simulations to perform aperture corrections for the SEXTRACTOR Kron magnitudes based only on the measured source flux and its half-light radius. We have performed photometry for ∼73,000 unique objects; approximately one-half of our detections are brighter than the 10σ point-source detection limit at F814W = 25.8 mag (AB). The slight majority of objects (60%) are unresolved or only marginally resolved by ACS. We estimate that Coma members are 5%-10% of all source detections, which consist of a large population of unresolved compact sources (primarily globular clusters but also ultra-compact dwarf galaxies) and a wide variety of extended galaxies from a cD galaxy to dwarf low surface brightness galaxies. The red sequence of Coma member galaxies has a color-magnitude relation with a constant slope and dispersion over 9 mag (-21 F814W < -13). The initial data release for the HST-ACS Coma Treasury program was made available to the public in 2008 August. The images and catalogs described in

  18. THE HST/ACS COMA CLUSTER SURVEY. VIII. BARRED DISK GALAXIES IN THE CORE OF THE COMA CLUSTER

    Energy Technology Data Exchange (ETDEWEB)

    Marinova, Irina; Jogee, Shardha; Weinzirl, Tim [Department of Astronomy, University of Texas at Austin, Austin, TX (United States); Erwin, Peter [Max-Planck-Insitut fuer extraterrestrische Physik, Giessenbachstrasse, 85748 Garching (Germany); Trentham, Neil [Institute of Astronomy, Madingley Road, Cambridge, CB3 0HA (United Kingdom); Ferguson, Henry C.; Goudfrooij, Paul [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Hammer, Derek [Department of Physics and Astronomy, Johns Hopkins, Baltimore, MD 21218 (United States); Den Brok, Mark; Peletier, Reynier F.; Kleijn, Gijs V. [Kapteyn Astronomical Institute, University of Groningen, Groningen (Netherlands); Graham, Alister W. [Centre for Astrophysics and Supercomputing, Swinburne University, Hawthorn (Australia); Carter, David; Mouhcine, Mustapha [Astrophysics Research Institute, Liverpool John Moores University, Birkenhead (United Kingdom); Balcells, Marc [Instituto de Astrofisica de Canarias, 38200 La Laguna, Tenerife (Spain); Guzman, Rafael; Hoyos, Carlos [Department of Astronomy, University of Florida, Gainesville, FL 32611 (United States); Mobasher, Bahram [Department of Physics and Astronomy, University of California, Riverside, CA 92521 (United States); Peng, Eric W., E-mail: marinova@astro.as.utexas.edu, E-mail: sj@astro.as.utexas.edu [Department of Astronomy, Peking University, Beijing 100871 (China)

    2012-02-20

    We use high-resolution ({approx}0.''1) F814W Advanced Camera for Surveys (ACS) images from the Hubble Space Telescope ACS Treasury survey of the Coma cluster at z {approx} 0.02 to study bars in massive disk galaxies (S0s), as well as low-mass dwarf galaxies in the core of the Coma cluster, the densest environment in the nearby universe. Our study helps to constrain the evolution of bars and disks in dense environments and provides a comparison point for studies in lower density environments and at higher redshifts. Our results are: (1) we characterize the fraction and properties of bars in a sample of 32 bright (M{sub V} {approx}< -18, M{sub *} > 10{sup 9.5} M{sub Sun }) S0 galaxies, which dominate the population of massive disk galaxies in the Coma core. We find that the measurement of a bar fraction among S0 galaxies must be handled with special care due to the difficulty in separating unbarred S0s from ellipticals, and the potential dilution of the bar signature by light from a relatively large, bright bulge. The results depend sensitively on the method used: the bar fraction for bright S0s in the Coma core is 50% {+-} 11%, 65% {+-} 11%, and 60% {+-} 11% based on three methods of bar detection, namely, strict ellipse fit criteria, relaxed ellipse fit criteria, and visual classification. (2) We compare the S0 bar fraction across different environments (the Coma core, A901/902, and Virgo) adopting the critical step of using matched samples and matched methods in order to ensure robust comparisons. We find that the bar fraction among bright S0 galaxies does not show a statistically significant variation (within the error bars of {+-}11%) across environments which span two orders of magnitude in galaxy number density (n {approx} 300-10,000 galaxies Mpc{sup -3}) and include rich and poor clusters, such as the core of Coma, the A901/902 cluster, and Virgo. We speculate that the bar fraction among S0s is not significantly enhanced in rich clusters compared to

  19. THE HST/ACS COMA CLUSTER SURVEY. VIII. BARRED DISK GALAXIES IN THE CORE OF THE COMA CLUSTER

    International Nuclear Information System (INIS)

    We use high-resolution (∼0.''1) F814W Advanced Camera for Surveys (ACS) images from the Hubble Space Telescope ACS Treasury survey of the Coma cluster at z ∼ 0.02 to study bars in massive disk galaxies (S0s), as well as low-mass dwarf galaxies in the core of the Coma cluster, the densest environment in the nearby universe. Our study helps to constrain the evolution of bars and disks in dense environments and provides a comparison point for studies in lower density environments and at higher redshifts. Our results are: (1) we characterize the fraction and properties of bars in a sample of 32 bright (MV ∼* > 109.5 M☉) S0 galaxies, which dominate the population of massive disk galaxies in the Coma core. We find that the measurement of a bar fraction among S0 galaxies must be handled with special care due to the difficulty in separating unbarred S0s from ellipticals, and the potential dilution of the bar signature by light from a relatively large, bright bulge. The results depend sensitively on the method used: the bar fraction for bright S0s in the Coma core is 50% ± 11%, 65% ± 11%, and 60% ± 11% based on three methods of bar detection, namely, strict ellipse fit criteria, relaxed ellipse fit criteria, and visual classification. (2) We compare the S0 bar fraction across different environments (the Coma core, A901/902, and Virgo) adopting the critical step of using matched samples and matched methods in order to ensure robust comparisons. We find that the bar fraction among bright S0 galaxies does not show a statistically significant variation (within the error bars of ±11%) across environments which span two orders of magnitude in galaxy number density (n ∼ 300-10,000 galaxies Mpc–3) and include rich and poor clusters, such as the core of Coma, the A901/902 cluster, and Virgo. We speculate that the bar fraction among S0s is not significantly enhanced in rich clusters compared to low-density environments for two reasons. First, S0s in rich clusters are

  20. The HST/ACS Coma Cluster Survey. VIII. Barred Disk Galaxies in the Core of the Coma Cluster

    CERN Document Server

    Marinova, Irina; Weinzirl, Tim; Erwin, Peter; Trentham, Neil; Ferguson, Henry C; Hammer, Derek; Brok, Mark den; Graham, Alister W; Carter, David; Balcells, Marc; Goudfrooij, Paul; Guzman, Rafael; Hoyos, Carlos; Mobasher, Bahram; Mouhcine, Mustapha; Peletier, Reynier F; Peng, Eric; Kleijn, Gijs Verdoes

    2012-01-01

    (ABRIDGED) We use high resolution (~0.1") F814W ACS images from the HST ACS Treasury survey of the Coma cluster at z~0.02 to study bars in massive disk galaxies (S0s), and in dwarf galaxies in the Coma core. Our study helps constrain the evolution of bars and disks in dense environments and provides a comparison point for studies in lower density environments and at higher redshifts. (1) We characterize the fraction and properties of bars in a sample of 32 bright (M_V 10^9.5 M_sun) S0 galaxies, which dominate the population of massive disk galaxies in the Coma core. Measuring the S0 bar fraction must be handled carefully, as the results depend on the method used: the bar fraction for bright S0s in the Coma core is 50%+/-11%, 65%+/-11%, and 60%+/-11% for three methods of bar detection: strict ellipse fit criteria, relaxed ellipse fit criteria, and visual classification. (2) We compare the S0 bar fraction across different environments (Coma core, A901/902, Virgo). We find that the bar fraction among bright S0 ...

  1. The structure and dynamics of the AC114 galaxy cluster revisited

    CERN Document Server

    Proust, Dominique; Saviane, Ivo; Ivanov, Valentin D; Bresolin, Fabio; Salzer, John J; Capelato, Hugo V

    2015-01-01

    We present a dynamical analysis of the galaxy cluster AC114 based on a catalogue of 524 velocities. Of these, 169 (32%) are newly obtained at ESO (Chile) with the VLT and the VIMOS spectrograph. Data on individual galaxies are presented and the accuracy of the measured velocities is discussed. Dynamical properties of the cluster are derived. We obtain an improved mean redshift value z= 0.31665 +/- 0.0008 and velocity dispersion \\sigma= 1893+73-82 \\kms. A large velocity dispersion within the core radius and the shape of the infall pattern suggests that this part of the cluster is in a radial phase of relaxation with a very elongated radial filament spanning 12000 \\kms. A radial foreground structure is detected within the central 0.5/h Mpc radius, recognizable as a redshift group at the same central redshift value. We analyze the color distribution for this archetype Butcher-Oemler galaxy cluster and identify the separate red and blue galaxy sequences. The latter subset contains 44% of confirmed members of the ...

  2. THE ACS VIRGO CLUSTER SURVEY. XVII. THE SPATIAL ALIGNMENT OF GLOBULAR CLUSTER SYSTEMS WITH EARLY-TYPE HOST GALAXIES

    Energy Technology Data Exchange (ETDEWEB)

    Wang Qiushi; Peng, Eric W. [Department of Astronomy, Peking University, Beijing 100871 (China); Blakeslee, John P.; Cote, Patrick; Ferrarese, Laura [Herzberg Institute of Astrophysics, National Research Council of Canada, 5071 West Saanich Road, Victoria, BC V9E 2E7 (Canada); Jordan, Andres [Departamento de Astronomia y Astrofisica, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile); Mei, Simona [University of Paris 7 Denis Diderot, F-75205 Paris Cedex 13 (France); West, Michael J., E-mail: peng@pku.edu.cn [Maria Mitchell Observatory, 4 Vestal Street, Nantucket, MA 02554 (United States)

    2013-06-01

    We study the azimuthal distribution of globular clusters (GCs) in early-type galaxies and compare them to their host galaxies using data from the ACS Virgo Cluster Survey. We find that in host galaxies with visible elongation ({epsilon} > 0.2) and intermediate to high luminosities (M{sub z} < -19), the GCs are preferentially aligned along the major axis of the stellar light. The red (metal-rich) GC subpopulations show strong alignment with the major axis of the host galaxy, which supports the notion that these GCs are associated with metal-rich field stars. The metal-rich GCs in lenticular galaxies show signs of being more strongly associated with disks rather than bulges. Surprisingly, we also find that the blue (metal-poor) GCs can also show the same correlation. If the metal-poor GCs are part of the early formation of the halo and built up through mergers, then our results support a picture where halo formation and merging occur anisotropically, and that the present-day major axis is an indicator of the preferred merging axis.

  3. The HST/ACS Coma Cluster Survey. II. Data Description and Source Catalogs

    Science.gov (United States)

    Hammer, Derek; Kleijn, Gijs Verdoes; Hoyos, Carlos; Den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Peletier, Reynier F.; Smith, Russell J.; Graham, Alister W.; Trentham, Neil; Peng, Eric; Puzia, Thomas H.; Lucey, John R.; Jogee, Shardha; Aguerri, Alfonso L.; Batcheldor, Dan; Bridges, Terry J.; Davies, Jonathan I.; Del Burgo, Carlos; Erwin, Peter; Hornschemeier, Ann; Hudson, Michael J.

    2010-01-01

    The Coma cluster, Abell 1656, was the target of a HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially-completed survey still covers approximately 50% of the core high density region in Coma. Observations were performed for twenty-five fields with a total coverage area of 274 aremin(sup 2), and extend over a wide range of cluster-centric radii (approximately 1.75 Mpe or 1 deg). The majority of the fields are located near the core region of Coma (19/25 pointings) with six additional fields in the south-west region of the cluster. In this paper we present SEXTRACTOR source catalogs generated from the processed images, including a detailed description of the methodology used for object detection and photometry, the subtraction of bright galaxies to measure faint underlying objects, and the use of simulations to assess the photometric accuracy and completeness of our catalogs. We also use simulations to perform aperture corrections for the SEXTRACTOR Kron magnitudes based only on the measured source flux and its half-light radius. We have performed photometry for 76,000 objects that consist of roughly equal numbers of extended galaxies and unresolved objects. Approximately two-thirds of all detections are brighter than F814W=26.5 mag (AB), which corresponds to the 10sigma, point-source detection limit. We estimate that Coma members are 5-10% of the source detections, including a large population of compact objects (primarily GCs, but also cEs and UCDs), and a wide variety of extended galaxies from cD galaxies to dwarf low surface brightness galaxies. The initial data release for the HST-ACS Coma Treasury program was made available to the public in August 2008. The images and catalogs described in this study relate to our second data release.

  4. The ACS Virgo Cluster Survey IV: Data Reduction Procedures for Surface Brightness Fluctuation Measurements with the Advanced Camera for Surveys

    CERN Document Server

    Mei, S; Tonry, J L; Jordan, A; Peng, E W; Côté, P; Ferrarese, L; Merritt, D; Milosavljevic, M; West, M J; Mei, Simona; Blakeslee, John P.; Tonry, John L.; Jordan, Andres; Peng, Eric W.; Cote, Patrick; Ferrarese, Laura; Merritt, David; Milosavljevic, Milos; West, Michael J.

    2005-01-01

    The Advanced Camera for Surveys (ACS) Virgo Cluster Survey is a large program to image 100 early-type Virgo galaxies using the F475W and F850LP bandpasses of the Wide Field Channel of the ACS instrument on the Hubble Space Telescope (HST). The scientific goals of this survey include an exploration of the three-dimensional structure of the Virgo Cluster and a critical examination of the usefulness of the globular cluster luminosity function as a distance indicator. Both of these issues require accurate distances for the full sample of 100 program galaxies. In this paper, we describe our data reduction procedures and examine the feasibility of accurate distance measurements using the method of surface brightness fluctuations (SBF) applied to the ACS Virgo Cluster Survey F850LP imaging. The ACS exhibits significant geometrical distortions due to its off-axis location in the HST focal plane; correcting for these distortions by resampling the pixel values onto an undistorted frame results in pixel correlations tha...

  5. ULTRA-COMPACT DWARFS IN THE COMA CLUSTER

    International Nuclear Information System (INIS)

    We have undertaken a spectroscopic search for ultra-compact dwarf galaxies (UCDs) in the dense core of the dynamically evolved, massive Coma cluster as part of the Hubble Space Telescope/Advanced Camera for Surveys (HST/ACS) Coma Cluster Treasury Survey. UCD candidates were initially chosen based on color, magnitude, degree of resolution within the ACS images, and the known properties of Fornax and Virgo UCDs. Follow-up spectroscopy with Keck/Low-Resolution Imaging Spectrometer confirmed 27 candidates as members of the Coma cluster, a success rate >60% for targeted objects brighter than MR = -12. Another 14 candidates may also prove to be Coma members, but low signal-to-noise spectra prevent definitive conclusions. An investigation of the properties and distribution of the Coma UCDs finds these objects to be very similar to UCDs discovered in other environments. The Coma UCDs tend to be clustered around giant galaxies in the cluster core and have colors/metallicity that correlate with the host galaxy. With properties and a distribution similar to that of the Coma cluster globular cluster population, we find strong support for a star cluster origin for the majority of the Coma UCDs. However, a few UCDs appear to have stellar population or structural properties which differentiate them from the old star cluster populations found in the Coma cluster, perhaps indicating that UCDs may form through multiple formation channels.

  6. The distance to NGC1316 (Fornax A): yet another curious case

    CERN Document Server

    Cantiello, Michele; Blakeslee, John P; Di Rico, Gianluca; Limatola, Luca; Brocato, Enzo; Della Valle, Massimo; Gilmozzi, Roberto

    2013-01-01

    The distance of NGC1316, the brightest galaxy in Fornax, is an interesting test for the cosmological distance scale. First, because Fornax is the 2nd largest cluster of galaxies at <~25 Mpc after Virgo and, in contrast to Virgo, has a small line-of-sight depth; and second, because NGC1316 is the galaxy with the largest number of detected SNeIa, giving the opportunity to test the consistency of SNeIa distances internally and against other indicators. We measure SBF mags in NGC1316 from ground and space-based imaging data, providing a homogeneous set of measurements over a wide wavelength interval. The SBF, coupled with empirical and theoretical calibrations, are used to estimate the distance to the galaxy. We present the first B-band SBF measurements of NGC1316 and use them together with the optical and near-IR SBF data to analyze the properties of field stars. Our distance modulus m-M=31.59 +-0.05(stat) +-0.14(sys), when placed in a consistent Cepheid distance scale, agrees with the results from other indi...

  7. Dust in the Radio Galaxy and Merger Remnant NGC 1316 (Fornax A)

    CERN Document Server

    Asabere, Bernard Duah; Winkler, Hartmut; Jarrett, Thomas; Leeuw, Lerothodi

    2014-01-01

    We present dust maps of NGC 1316 (Fornax A), a well-studied early-type galaxy located in the outskirts of the Fornax cluster. We used the Large APEX BOlometer CAmera (LABOCA), operating at 870 micron with an angular resolution of 19.5 arcseconds on the Atacama Pathfinder EXperiment (APEX) 12m submillimeter telescope in Chile and the Wide-field Infrared Survey Explorer (WISE). WISE observes in four mid-infrared bands centered at 3.4, 4.6, 12 and 22 micron with angular resolutions ranging from 6 to 12 arcseconds. The WISE and LABOCA maps reveal emission from dust in the central 2 arcminutes of NGC 1316. The disturbed optical morphology with many shells and loops, the complex distribution of molecular gas and our dust maps are evidences of past merger activity or gas accretion in the galaxy. Combining the LABOCA flux measurement with existing mid- and far-infrared measurements, we estimate the temperature of the cold (~20 K) and warm (~55 K) dust components in the galaxy. This study will be extended to other sou...

  8. The HST/ACS Coma Cluster Survey. X. Nuclear star clusters in low-mass early-type galaxies: scaling relations

    CERN Document Server

    Brok, Mark den; Seth, Anil; Balcells, Marc; Dominguez, Lilian; Graham, Alister W; Carter, David; Erwin, Peter; Ferguson, Henry C; Goudfrooij, Paul; Guzman, Rafael; Hoyos, Carlos; Jogee, Shardha; Lucey, John; Phillipps, Steven; Puzia, Thomas; Valentijn, Edwin; Kleijn, Gijs Verdoes; Weinzirl, Tim

    2014-01-01

    We present scaling relations between structural properties of nuclear star clusters and their host galaxies for a sample of early-type dwarf galaxies observed as part of the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) Coma Cluster Survey. We have analysed the light profiles of 200 early-type dwarf galaxies in the magnitude range $16.0 < m_{F814W} < 22.6 $ mag, corresponding to $-19.0 < M_{F814W} < -12.4 $ mag. Nuclear star clusters are detected in 80% of the galaxies, thus doubling the sample of HST-observed early-type dwarf galaxies with nuclear star clusters. \\changed{We confirm that the} nuclear star cluster detection fraction decreases strongly toward faint magnitudes. The luminosities of nuclear star clusters do not scale linearly with host galaxy luminosity. A linear fit yields L$_{nuc} \\sim $L$_{gal}^{0.57\\pm0.05}$. The nuclear star cluster-host galaxy luminosity scaling relation for low-mass early-type dwarf galaxies is consistent with formation by globular cluster accre...

  9. The Luminosity Functions of the Galaxy Cluster MS1054-0321 at z=0.83 based on ACS Photometry

    CERN Document Server

    Goto, T; Cross, N J G; Illingworth, G D; Tran, K; Magee, D; Franx, M; Benítez, N; Bouwens, R J; Demarco, R; Ford, H C; Homeier, N L; Martel, A R; Menanteau, F; Clampin, M; Hartig, G F; Ardila, D R; Bartko, F; Blakeslee, J P; Bradley, L D; Broadhurst, T J; Brown, R A; Burrows, C J; Cheng, E S; Feldman, P D; Golimowski, D A; Gronwall, C; Holden, B; Infante, L; Jee, M J; Krist, J E; Lesser, M P; Mei, S; Meurer, G R; Miley, G K; Motta, V; Overzier, R; Rosati, P; Sirianni, M; Sparks, W B; Tran, H D; Tsvetanov, Z I; White, R L; Zheng, W; Zirm, A W; Goto, Tomotsugu; Postman, Marc; Cross, Nicholas J.G.

    2004-01-01

    We present new measurements of the galaxy luminosity function (LF) and its dependence on local galaxy density, color, morphology, and clustocentric radius for the massive $z=0.83$ cluster MS1054-0321. Our analyses are based on imaging performed with the ACS onboard the HST in the F606W, F775W and F850LP passbands and extensive spectroscopic data obtained with the Keck LRIS. Our main results are based on a spectroscopically selected sample of 143 cluster members with morphological classifications derived from the ACS observations. Our three primary findings are (1) the faint-end slope of the LF is steepest in the bluest filter, (2) the LF in the inner part of the cluster (or highest density regions) has a flatter faint-end slope, and (3) the fraction of early-type galaxies is higher at the bright end of the LF, and gradually decreases toward fainter magnitudes. These characteristics are consistent with those in local galaxy clusters, indicating that, at least in massive clusters, the common characteristics of ...

  10. Ultra-Compact Dwarfs in the Coma Cluster

    CERN Document Server

    Chiboucas, Kristin; Marzke, Ronald O; Phillipps, Steve; Price, James; Peng, Eric; Trentham, Neil; Carter, David; Hammer, Derek

    2011-01-01

    We have undertaken a spectroscopic search for ultra compact dwarf galaxies (UCDs) in the dense core of the dynamically evolved, massive Coma cluster as part of the HST/ACS Coma Cluster Treasury Survey. UCD candidates were initially chosen based on color, magnitude, degree of resolution within the ACS images, and the known properties of Fornax and Virgo UCDs. Follow-up spectroscopy with Keck/LRIS confirmed 27 candidates as members of the Coma Cluster, a success rate > 60% for targeted objects brighter than M_R = -12. Another 14 candidates may also prove to be Coma members, but low signal-to-noise spectra prevent definitive conclusions. An investigation of the properties and distribution of the Coma UCDs finds these objects to be very similar to UCDs discovered in other environments. The Coma UCDs tend to be clustered around giant galaxies in the cluster core and have colors/metallicity that correlate with the host galaxy. With properties and a distribution similar to that of the Coma cluster globular cluster p...

  11. Multi-wavelength observations of a rich galaxy cluster at z ~ 1: the HST/ACS colour-magnitude diagram

    CERN Document Server

    Santos, Joana S; Gobat, Raphael; Lidman, Chris; Dawson, Kyle; Perlmutter, Saul; Boehringer, Hans; Balestra, Italo; Mullis, Chris R; Fassbender, Rene; Kohnert, Jan; Lamer, Georg; Rettura, Alessandro; Rite, Charles; Schwope, Axel

    2009-01-01

    XMMU J1229+0151 is a rich galaxy cluster with redshift z=0.975, that was serendipitously detected in X-rays within the scope of the XMM-Newton Distant Cluster Project. HST/ACS observations in the i775 and z850 passbands, as well as VLT/FORS2 spectroscopy were further obtained, in addition to follow-up Near-Infrared (NIR) imaging in J- and Ks-bands with NTT/SOFI. We investigate the photometric, structural and spectral properties of the early-type galaxies in the high-redshift cluster XMMU J1229+0151. Source detection and aperture photometry are performed in the optical and NIR imaging. Galaxy morphology is inspected visually and by means of Sersic profile fitting to the 21 spectroscopically confirmed cluster members in the ACS field of view. The i775-z850 colour-magnitude relation (CMR) is derived with a method based on galaxy magnitudes obtained by fitting the surface brightness of the galaxies with Sersic models. The i775-z850 CMR of the spectroscopic members shows a very tight red-sequence with a zero point...

  12. Dark Matter Cores in the Fornax and Sculptor Dwarf Galaxies

    DEFF Research Database (Denmark)

    C. Amorisco, Nicola; Zavala Franco, Jesus; J. L. de Boer, Thomas

    2014-01-01

    We combine the detailed Star Formation Histories of the Fornax and Sculptor dwarf Spheroidals with the mass assembly history of their dark matter halo progenitors to estimate if the energy deposited by Supernova type II (SNeII) is sufficient to create a substantial dark matter core. Assuming...... the efficiency of energy injection of the SNeII into dark matter particles is \\epsilon=0.05, we find that a single early episode, z...

  13. A Chemical Evolution Model for the Fornax Dwarf Spheroidal Galaxy

    Directory of Open Access Journals (Sweden)

    Yuan Zhen

    2016-01-01

    Full Text Available Fornax is the brightest Milky Way (MW dwarf spheroidal galaxy and its star formation history (SFH has been derived from observations. We estimate the time evolution of its gas mass and net inflow and outflow rates from the SFH usinga simple star formation law that relates the star formation rate to the gas mass. We present a chemical evolution model on a 2D mass grid with supernovae (SNe as sources of metal enrichment. We find that a key parameter controlling the enrichment is the mass Mx of the gas to mix with the ejecta from each SN. The choice of Mx depends on the evolution of SN remnants and on the global gas dynamics. It differs between the two types of SNe involved and between the periods before and after Fornax became an MW satellite at time t = tsat. Our results indicate that due to the global gas outflow at t > tsat, part of the ejecta from each SN may directly escape from Fornax. Sample results from our model are presented and compared with data.

  14. The effect of tides on the Fornax dwarf spheroidal galaxy

    CERN Document Server

    Battaglia, Giuseppina; Nipoti, Carlo

    2015-01-01

    Estimates of the mass distribution and dark-matter (DM) content of dwarf spheroidal galaxies (dSphs) are usually derived under the assumption that the effect of the tidal field of the host galaxy is negligible over the radial extent probed by kinematic data-sets. We assess the implications of this assumption in the specific case of the Fornax dSph by means of N-body simulations of a satellite orbiting around the Milky Way. We consider observationally-motivated orbits and we tailor the initial distributions of the satellite's stars and DM to match, at the end of the simulations, the observed structure and kinematics of Fornax. In all our simulations the present-day observable properties of Fornax are not significantly influenced by tidal effects. The DM component is altered by the interaction with the Galactic field (up to 20% of the DM mass within 1.6 kpc is lost), but the structure and kinematics of the stellar component are only mildly affected even in the more eccentric orbit (more than 99% of the stellar ...

  15. A Chemical Evolution Model for the Fornax Dwarf Spheroidal Galaxy

    CERN Document Server

    Yuan, Zhen; Jing, Y P

    2015-01-01

    Fornax is the brightest Milky Way (MW) dwarf spheroidal galaxy and its star formation history (SFH) has been derived from observations. We estimate the time evolution of its gas mass and net inflow and outflow rates from the SFH using a simple star formation law that relates the star formation rate to the gas mass. We present a chemical evolution model on a 2D mass grid with supernovae (SNe) as sources of metal enrichment. We find that a key parameter controlling the enrichment is the mass M_x of the gas to mix with the ejecta from each SN. The choice of M_x depends on the evolution of SN remnants and on the global gas dynamics. It differs between the two types of SNe involved and between the periods before and after Fornax became an MW satellite at time t = t_sat . Our results indicate that due to the global gas outflow at t > t_sat , part of the ejecta from each SN may directly escape from Fornax. Sample results from our model are presented and compared with data.

  16. The Fornax Deep Survey with VST. I. The extended and diffuse stellar halo of NGC~1399 out to 192 kpc

    CERN Document Server

    Iodice, E; Grado, A; Limatola, L; Spavone, M; Napolitano, N R; Paolillo, M; Peletier, R F; Cantiello, M; Lisker, T; Wittmann, C; Venhola, A; Hilker, M; D'Abrusco, R; Pota, V; Schipani, P

    2016-01-01

    [Abrigded] We have started a new deep, multi-imaging survey of the Fornax cluster, dubbed Fornax Deep Survey (FDS), at the VLT Survey Telescope. In this paper we present the deep photometry inside two square degrees around the bright galaxy NGC1399 in the core of the cluster. We found a very extended and diffuse envelope surrounding the luminous galaxy NGC1399: we map the surface brightness out to 33 arcmin (~ 192 kpc) from the galaxy center and down to about 31 mag/arcsec^2 in the g band. The deep photometry allows us to detect a faint stellar bridge in the intracluster region between NGC1399 and NGC1387. By analyzing the integrated colors of this feature, we argue that it could be due to the ongoing interaction between the two galaxies, where the outer envelope of NGC1387 on its east side is stripped away. By fitting the light profile, we found that it exists a physical break radius in the total light distribution at R=10 arcmin (~58 kpc) that sets the transition region between the bright central galaxy and...

  17. Suzaku Detection of Thermal X-Ray Emission Associated with the Western Radio Lobe of Fornax A

    CERN Document Server

    Seta, Hiromi; Inoue, Susumu

    2013-01-01

    We present the results of X-ray mapping observations of the western radio lobe of the Fornax A galaxy, using the X-ray Imaging Spectrometer (XIS) onboard the Suzaku satellite with a total exposure time of 327 ks. The purpose of this study is to investigate the nature and spatial extent of the diffuse thermal emission around the lobe by exploiting the low and stable background of the XIS. The diffuse thermal emission had been consistently reported in all previous studies of this region, but its physical nature and relation to the radio lobe had not been examined in detail. Using the data set covering the entire western lobe and the central galaxy NGC 1316, as well as comparison sets in the vicinity, we find convincingly the presence of thermal plasma emission with a temperature of ~1 keV in excess of conceivable background and contaminating emission (cosmic X-ray background, Galactic halo, intra-cluster gas of Fornax, interstellar gas of NGC 1316, and the ensemble of point-like sources). Its surface brightness...

  18. Discovery of White Dwarfs in the Globular Clusters M13 and M22 Using HST ACS Photometric Data

    Science.gov (United States)

    Cho, Dong-Hwan; Yoon, Tae Seog; Lee, Sang-Gak; Sung, Hyun-Il

    2015-12-01

    A search for hot and bright white dwarfs (WDs) in the Milky Way globular clusters M13 (NGC 6205) and M22 (NGC 6656) is carried out using the deep and homogeneous VI photometric catalog of Anderson et al. and and Sarajedini et al., based on data taken with the ACS/WFC aboard the Hubble Space Telescope (HST). V versus V-I color-magnitude diagrams (CMDs) of M13 and M22 are constructed and numerous spurious detections are rejected according to their photometric quality parameters qfit(V) and qfit(I). In the case of M13, further radial restriction is applied to reject central stars with higher photometric errors due to central crowding. From each resultant V versus V-I CMD, sixteen and thirteen WD candidates are identified in M13 and M22, respectively. They are identified as stellar objects in the accompanying ACS/WFC images and are found to be randomly distributed across the central regions of M13 and M22. Their positions in the CMDs are in the bright part of the DA WD cooling sequences indicating that they are true WDs. In order to confirm their nature, follow-up spectroscopic observations are needed.

  19. Deep ACS Imaging in the Globular Cluster NGC6397: Dynamical Models

    CERN Document Server

    Hurley, Jarrod R; Richer, Harvey B; King, Ivan R; Davis, D Saul; Kalirai, Jason S; Hansen, Brad M S; Dotter, Aaron; Anderson, Jay; Fahlman, Gregory G; Rich, R Michael

    2008-01-01

    We present N-body models to complement deep imaging of the metal-poor core-collapsed cluster NGC6397 obtained with the Hubble Space Telescope. All simulations include stellar and binary evolution in-step with the stellar dynamics and account for the tidal field of the Galaxy. We focus on the results of a simulation that began with 100000 objects (stars and binaries), 5% primordial binaries and Population II metallicity. After 16 Gyr of evolution the model cluster has about 20% of the stars remaining and has reached core-collapse. We compare the color-magnitude diagrams of the model at this age for the central region and an outer region corresponding to the observed field of NGC6397 (about 2-3 half-light radii from the cluster centre). This demonstrates that the white dwarf population in the outer region has suffered little modification from dynamical processes - contamination of the luminosity function by binaries and white dwarfs with non-standard evolution histories is minimal and should not significantly a...

  20. The Distance to NGC 1316 (Fornax A) from Observations of Four Type Ia Supernovae

    Science.gov (United States)

    Stritzinger, Maximilian; Burns, Christopher R.; Phillips, Mark M.; Folatelli, Gastón; Krisciunas, Kevin; Kattner, ShiAnne; Persson, Sven E.; Boldt, Luis; Campillay, Abdo; Contreras, Carlos; Krzeminski, Wojtek; Morrell, Nidia; Salgado, Francisco; Freedman, Wendy L.; Hamuy, Mario; Madore, Barry F.; Roth, Miguel; Suntzeff, Nicholas B.

    2010-12-01

    The giant elliptical galaxy NGC 1316 (Fornax A) is a well-studied member of the Fornax Cluster and a prolific producer of Type Ia supernovae (SNe Ia), having hosted four observed events since 1980. Here, we present detailed optical- and near-infrared light curves of the spectroscopically normal SN 2006dd. These data are used, along with previously published photometry of the normal SN 1980N and SN 1981D, and the fast-declining, low-luminosity SN 2006mr, to compute independent estimates of the host reddening for each SN, and the distance to NGC 1316. From the three normal SNe, we find a distance of 17.8 ± 0.3 (random) ± 0.3 (systematic) Mpc for Ho = 72. Distance moduli derived from the "EBV" and Tripp methods give the values that are mutually consistent with 4%-8%. Moreover, the weighted means of the distance moduli for these three SNe for three methods agree to within 3%. This consistency is encouraging and supports the premise that Type Ia SNe are reliable distance indicators at the 5% precision level or better. On the other hand, the two methods used to estimate the distance of the fast-declining SN 2006mr both yield a distance to NGC 1316 which is 25%-30% larger. This disparity casts doubt on the suitability of fast-declining events for estimating extragalactic distances. Modest-to-negligible host galaxy reddening values are derived for all four SNe. Nevertheless, two of them (SN 2006dd and SN 2006mr) show strong Na I D interstellar lines in the host galaxy system. The strength of this absorption is completely inconsistent with the small reddening values derived from the SN light curves if the gas in NGC 1316 is typical of that found in the interstellar medium of the Milky Way. In addition, the equivalent width of the Na lines in SN 2006dd appears to have weakened significantly some 100-150 days after explosion. This paper includes data gathered with the 6.5 m Magellan telescope at Las Campanas Observatory, Chile.

  1. Dark matter inner slope and concentration in galaxies: from the Fornax dwarf to M87

    CERN Document Server

    Mamon, G A; Romanowsky, A J; Wojtak, R

    2014-01-01

    We apply two new state-of-the-art methods that model the distribution of observed tracers in projected phase space to lift the mass / velocity anisotropy (VA) degeneracy and deduce constraints on the mass profiles of galaxies, as well as their VA. We first show how a distribution function based method applied to the satellite kinematics of otherwise isolated SDSS galaxies shows convincing observational evidence of age matching: red galaxies have more concentrated dark matter (DM) halos than blue galaxies of the same stellar or halo mass. Then, applying the MAMPOSSt technique to M87 (traced by its red and blue globular clusters) we find that very cuspy DM is favored, unless we release priors on DM concentration or stellar mass (leading to unconstrained slope). For the Fornax dwarf spheroidal (traced by its metal-rich and metal-poor stars), the inner DM slope is unconstrained, with weak evidence for a core if the stellar mass is fixed. This highlights how priors are crucial for DM modeling. Finally, we find tha...

  2. Galaxy Clusters with Chandra

    CERN Document Server

    Forman, W; Markevitch, M L; Vikhlinin, A A; Churazov, E

    2002-01-01

    We discuss Chandra results related to 1) cluster mergers and cold fronts and 2) interactions between relativistic plasma and hot cluster atmospheres. We describe the properties of cold fronts using NGC1404 in the Fornax cluster and A3667 as examples. We discuss multiple surface brightness discontinuities in the cooling flow cluster ZW3146. We review the supersonic merger underway in CL0657. Finally, we summarize the interaction between plasma bubbles produced by AGN and hot gas using M87 and NGC507 as examples.

  3. Mass assembly history and infall time of the Fornax Dwarf Spheroidal Galaxy

    CERN Document Server

    Wang, Mei-Yu; Lovell, Mark R; Frenk, Carlos S; Zentner, Andrew R

    2015-01-01

    We use cosmological simulations to identify dark matter subhalo host candidates of the Fornax dwarf spheroidal galaxy using the stellar kinematic properties of Fornax. We consider cold dark matter (CDM), warm dark matter (WDM), and decaying dark matter (DDM) simulations for our models of structure formation. The subhalo candidates in CDM typically have smaller mass and higher concentrations at z = 0 than the corresponding candidates in WDM and DDM. We examine the formation histories of the ~ 100 Fornax candidate subhalos identified in CDM simulations and, using approximate luminosity-mass relationships for subhalos, we find two of these subhalos that are consistent with both the Fornax luminosity and kinematics. These two subhalos have a peak mass over ten times larger than their z = 0 mass. We suggest that in CDM the dark matter halo hosting Fornax must have been severely stripped of mass and that it had an infall time into the Milky Way of ~ 9 Gyr ago. In WDM, we find that candidate subhalos consistent with...

  4. Atomic and molecular gas in the merger galaxy NGC 1316 (Fornax A) and its environment

    NARCIS (Netherlands)

    Horellou, C; Black, JH; van Gorkom, JH; Combes, F; van der Hulst, JM; Charmandaris, [No Value

    2001-01-01

    We present and interpret observations of atomic and molecular gas toward the southern elliptical galaxy NGC 1316 (Fornax A), a strong double-lobe radio source with a disturbed optical morphology that includes numerous shells and loops. The (CO)-C-12(1-0), (CO)-C-12(2-1), and Hi observations were mad

  5. Model comparison of the dark matter profiles of Fornax, Sculptor, Carina and Sextans

    NARCIS (Netherlands)

    Breddels, Maarten A.; Helmi, Amina

    2013-01-01

    Aims. We compare dark matter profile models of four dwarf spheroidal galaxies satellites of the MilkyWay using Bayesian evidence. Methods. We use orbit based dynamical models to fit the 2nd and 4th moments of the line of sight velocity distributions of the Fornax, Sculptor, Carina and Sextans dwarf

  6. An Empirical Model for Halo Evolution and Global Gas Dynamics of the Fornax Dwarf Spheroidal Galaxy

    CERN Document Server

    Yuan, Zhen; Jing, Y P

    2015-01-01

    We present an empirical model for the halo evolution and global gas dynamics of Fornax, the brightest Milky Way (MW) dwarf spheroidal galaxy (dSph). Assuming a global star formation rate psi(t)=lambda_*[M_g(t)/M_sun]^alpha consistent with observations of star formation in nearby galaxies and using the data on Fornax's psi(t), we derive the evolution of the total mass M_g(t) for cold gas in Fornax's star-forming disk and the rate Delta F(t) of net gas flow to or from the disk. We identify the onset of the transition in Delta F(t) from a net inflow to a net outflow as the time t_sat at which the Fornax halo became an MW satellite and estimate the evolution of its total mass M_h(t) at t

  7. The HST/ACS Coma Cluster Survey : III. Structural parameters of galaxies using single Sersic fits star

    NARCIS (Netherlands)

    Hoyos, Carlos; den Brok, Mark; Verdoes Kleijn, Gijs; Carter, David; Balcells, Marc; Guzmán, Rafael; Peletier, Reynier; Ferguson, Henry C.; Goudfrooij, Paul; Graham, Alister W.; Hammer, Derek; Karick, Arna M.; Lucey, John R.; Matković, Ana; Merritt, David; Mouhcine, Mustapha; Valentijn, Edwin

    2011-01-01

    We present a catalogue of structural parameters for 8814 galaxies in the 25 fields of the Hubble Space Telescope/ACS Coma Treasury Survey. Parameters from Sersic fits to the two-dimensional surface brightness distributions are given for all galaxies from our published Coma photometric catalogue with

  8. The DART Imaging And CaT Survey of the Fornax Dwarf Spheroidal Galaxy

    Energy Technology Data Exchange (ETDEWEB)

    Battaglia, Giuseppina; Tolstoy, E.; Helmi, A.; /Kapteyn Astron. Inst., Groningen; Irwin, M.J.; /Cambridge U., Inst. of Astron.; Letarte, B.; /Kapteyn Astron. Inst.,; Jablonka, P.; /LASTRO Observ.; Hill, V.; /Meudon Observ.; Venn, K.A.; /Victoria U.; Shetrone, M.D.; /Texas U., McDonald Observ.; Arimoto, N.; /Tokyo, Astron. Observ.; Primas,; /European Southern Observ.; Kaufer, A.; /European Southern Obs., Chile; Francois, P.; /Meudon Observ.; Szeifert, T.; /European Southern Obs., Chile; Abel, T.; /KIPAC, Menlo Park; Sadakane, K.; /Osaka Kyoiku U.

    2006-08-28

    As part of the DART project we have used the ESO/2.2m Wide Field Imager in conjunction with the VLT/FLAMES* GIRAFFE spectrograph to study the detailed properties of the resolved stellar population of the Fornax dwarf spheroidal galaxy out to and beyond its tidal radius. Fornax dSph has had a complicated evolution and contains significant numbers of young, intermediate age and old stars. We investigate the relation between these different components by studying their photometric, kinematic and abundance distributions. We re-derived the structural parameters of the Fornax dwarf spheroidal using our wide field imaging covering the galaxy out to its tidal radius, and analyzed the spatial distribution of the Fornax stars of different ages as selected from Colour-Magnitude Diagram analysis. We have obtained accurate velocities and metallicities from spectra in the Ca II triplet wavelength region for 562 Red Giant Branch stars which have velocities consistent with membership in Fornax dwarf spheroidal. We have found evidence for the presence of at least three distinct stellar components: a young population (few 100 Myr old) concentrated in the center of the galaxy, visible as a Main Sequence in the Colour-Magnitude Diagram; an intermediate age population (2-8 Gyr old); and an ancient population (> 10Gyr), which are distinguishable from each other kinematically, from the metallicity distribution and in the spatial distribution of stars found in the Colour-Magnitude Diagram. From our spectroscopic analysis we find that the ''metal rich'' stars ([Fe/H] > -1.3) show a less extended and more concentrated spatial distribution, and display a colder kinematics than the ''metal poor'' stars ([Fe/H] < -1.3). There is tentative evidence that the ancient stellar population in the center of Fornax does not exhibit equilibrium kinematics. This could be a sign of a relatively recent accretion of external material, such as the merger of another

  9. Two Populations of Old Star Clusters in the Spiral Galaxy M101 Based on HST/ACS Observations

    CERN Document Server

    Simanton, Lesley A; Whitmore, Bradley C

    2015-01-01

    We present a new photometric catalog of 326 candidate globular clusters (GCs) in the nearby spiral galaxy M101, selected from B, V, and I Hubble Space Telescope Advanced Camera for Surveys images. The luminosity function (LF) of these clusters has an unusually large number of faint sources compared with GCLFs in many other spiral galaxies. Accordingly, we separate and compare the properties of "bright" (M_V -6.5; one magnitude fainter than the expected GC peak) clusters within our sample. The LF of the bright clusters is well fit by a peaked distribution similar to those observed in the Milky Way (MW) and other galaxies. These bright clusters also have similar size (r_{eff}) and spatial distributions as MW GCs. The LF of the faint clusters, on the other hand, is well described by a power law, dN(L_V)/dL_V proportional to L_V^alpha with alpha = -2.6 plus or minus 0.3, similar to those observed for young and intermediate-age cluster systems in star forming galaxies. We find that the faint clusters have larger ...

  10. No identifiable Hb1Ac or lifestyle change after a comprehensive diabetes programme including motivational interviewing: A cluster randomised trial

    NARCIS (Netherlands)

    Jansink, R.M.E.; Braspenning, J.C.C.; Keizer, E.; Weijden, T. van der; Elwyn, G.; Grol, R.P.T.M.

    2013-01-01

    Abstract Objective. To study the effectiveness of a comprehensive diabetes programme in general practice that integrates patient-centred lifestyle counselling into structured diabetes care. Design and setting. Cluster randomised trial in general practices. Intervention. Nurse-led structured diabetes

  11. Distribución en gran escala de los cúmulos globulares en Fornax

    Science.gov (United States)

    Ostrov, P. G.

    Para analizar los cúmulos globulares azules y rojos de NGC 1399 asociados con NGC 1399 en particular, o si los cúmulos azules representaban un sistema asociado con el cúmulo de Fornax en general, se obtuvieron imágenes CCD de gran formato con el telescopio de 4m del CTIO, en las bandas C y T1. Se describe el método empleado y lo encontrado.

  12. Investigation of the Puzzling Abundance Pattern in the Stars of the Fornax Dwarf Spheroidal Galaxy

    CERN Document Server

    Li, Hongjie; Zhang, Bo

    2013-01-01

    Many works have found unusual characteristics of elemental abundances in nearby dwarf galaxies. This implies that there is a key factor of galactic evolution that is different from that of the Milky Way (MW). The chemical abundances of the stars in the Fornax dwarf spheroidal galaxy (Fornax dSph) provide excellent information for setting constraints on the models of the galactic chemical evolution. In this work, adopting the five-component approach, we fit the abundances of the Fornax dSph stars, including $\\alpha$ elements, iron group elements and neutron-capture elements. For most sample stars, the relative contributions from the various processes to the elemental abundances are not usually in the MW proportions. We find that the contributions from massive stars to the primary $\\alpha$ elements and iron group elements increase monotonously with increasing [Fe/H]. This means that the effect of the galactic wind is not strong enough to halt star formation and the contributions from massive stars to $\\alpha$ e...

  13. Near-infrared spectroscopy of AGB star candidates in Fornax, Sculptor and NGC 6822

    CERN Document Server

    Groenewegen, M A T; Marescaux, M

    2009-01-01

    Context: The Asymptotic Giant Branch (AGB) phase is characterised by substantial mass loss that is accompanied by the formation of dust. In extreme cases this will make the star no longer visible in the optical. For a better understanding of AGB evolution it is important to identify and characterise these very red AGB stars. Aims: The first aim of this article is to improve the census of red AGB stars in three Local Group galaxies, based on near-IR spectroscopic observations of new candidates with red 2MASS (J-K) colours. The opportunity is taken to compare the near-IR spectra with those of Milky Way stars. Methods: We used ISAAC on the ESO VLT to take J and H-band spectra of 36 targets in Fornax, Sculptor and NGC 6822. Results: Twelve new C-stars are found in Fornax, and one is confirmed in Sculptor. All C-stars have (J-K) > 1.6, and are brighter than -3.55 in bolometric magnitude. Ten new oxygen-rich late-type giant stars are identified in Fornax, but none is extremely red or very luminous. Five luminous O-...

  14. The HST/ACS Coma Cluster Survey - VII. Structure and Assembly of Massive Galaxies in the Center of the Coma Cluster

    CERN Document Server

    Weinzirl, Tim; Neistein, Eyal; Khochfar, Sadegh; Kormendy, John; Marinova, Irina; Hoyos, Carlos; Balcells, Marc; Brok, Mark den; Hammer, Derek; Peletier, Reynier F; Kleijn, Gijs Verdoes; Carter, David; Goudfrooij, Paul; Mobasher, Bahram; Trentham, Neil; Erwin, Peter; Puzia, Thomas

    2013-01-01

    We constrain the assembly history of galaxies in the central 0.6 Mpc of the rich Coma cluster at z~0.02 based on the structure of 69 massive (M*>1e9 M_sun) galaxies using images from the HST Treasury Survey of Coma. Our findings are: (1) We make no a priori assumptions on the shape of the profile for outer and central structures, which can include disk-dominated components, bars, and classical bulges/ellipticals. After excluding the 2 cDs, we find that most (56%) of the galactic stellar mass resides in classical bulges/Es while (44%) resides in cold disk-dominated structures. This suggests that most of the stellar mass in Coma galaxies may have been assembled and shaped through the redistribution of stars during major mergers, and possibly minor mergers, but that gas-rich dissipative processes that build disk-dominated structures remain important even in the center of a rich cluster like Coma. (2) We see strong evidence of a morphology-density relation. In the central 0.6 Mpc of the Coma cluster, there are 2 ...

  15. Clustering

    Directory of Open Access Journals (Sweden)

    Jinfei Liu

    2013-04-01

    Full Text Available DBSCAN is a well-known density-based clustering algorithm which offers advantages for finding clusters of arbitrary shapes compared to partitioning and hierarchical clustering methods. However, there are few papers studying the DBSCAN algorithm under the privacy preserving distributed data mining model, in which the data is distributed between two or more parties, and the parties cooperate to obtain the clustering results without revealing the data at the individual parties. In this paper, we address the problem of two-party privacy preserving DBSCAN clustering. We first propose two protocols for privacy preserving DBSCAN clustering over horizontally and vertically partitioned data respectively and then extend them to arbitrarily partitioned data. We also provide performance analysis and privacy proof of our solution..

  16. The metal-poor knee in the Fornax dwarf spheroidal galaxy

    Energy Technology Data Exchange (ETDEWEB)

    Hendricks, Benjamin; Koch, Andreas [Zentrum für Astronomie der Universität Heidelberg, Landessternwarte, Königstuhl 12, D-69117, Heidelberg (Germany); Lanfranchi, Gustavo A. [Núcleo de Astrofísica Teórica, Universidade Cruzeiro do Sul, R. Galvão Bueno 868, Liberdade, 01506-000, São Paulo, SP (Brazil); Boeche, Corrado [Zentrum für Astronomie der Universität Heidelberg, Astronomisches Rechen-Institut, Mönchhofstr. 12-14, D-69120, Heidelberg (Germany); Walker, Matthew [McWilliams Center for Cosmology, Carnegie Mellon University, 5000 Forbes Ave., Pittsburgh, PA 15213 (United States); Johnson, Christian I. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, MS-15, Cambridge, MA 02138 (United States); Peñarrubia, Jorge [Institute for Astronomy, University of Edinburgh, Royal Observatory, Blackford Hill, Edinburgh EH9 3HJ (United Kingdom); Gilmore, Gerard, E-mail: ben.hendricks@lsw.uni-heidelberg.de [Institute of Astronomy, Cambridge University, Madingley Rd, Cambridge CB3 OHA (United Kingdom)

    2014-04-20

    We present α-element abundances of Mg, Si, and Ti for a large sample of field stars in two outer fields of the Fornax dwarf spheroidal (dSph) galaxy, obtained with Very Large Telescope/GIRAFFE (R ∼ 16, 000). Due to the large fraction of metal-poor (MP) stars in our sample, we are able to follow the α-element evolution from [Fe/H] ≈ –2.5 continuously to [Fe/H] ≈ –0.7. For the first time we are able to resolve the turnover from the Type II supernovae (SNe) dominated, α-enhanced plateau down to subsolar [α/Fe] values, due to the onset of SNe Ia, and thus to trace the chemical enrichment efficiency of the galaxy. Our data support the general concept of an α-enhanced plateau at early epochs, followed by a well-defined 'knee' caused by the onset of SNe Ia, and finally a second plateau with sub-solar [α/Fe] values. We find the position of this knee to be at [Fe/H] ≈ –1.9 and therefore significantly more MP than expected from comparison with other dSphs and standard evolutionary models. Surprisingly, this value is rather comparable to the knee in Sculptor, a dSph ∼10 times less luminous than Fornax. Using chemical evolution models, we find that the position of the knee and the subsequent plateau at the sub-solar level can hardly be explained unless the galaxy experienced several discrete star formation (SF) events with a drastic variation in SF efficiency, while a uniform SF can be ruled out. One possible evolutionary scenario is that Fornax experienced one or several major accretion events from gas-rich systems in the past, so that its current stellar mass is not indicative of the chemical evolution environment at ancient times. If Fornax is the product of several smaller buildings blocks, this may also have implications for the understanding of the formation process of dSphs in general.

  17. Near-infrared observations of the Fornax dwarf galaxy. I. The red giant branch

    CERN Document Server

    Gullieuszik, M; Rizzi, L; Saviane, I; Momany, Y; Ortolani, S

    2007-01-01

    We present a study of the evolved stellar populations in the dwarf spheroidal galaxy Fornax based on JHK imaging photometry. The observations cover an 18.5x18.5 arcmin central area with a mosaic of NTT/SOFI images. Our data sample all the red giant branch for the whole area. Deeeper observations reaching the red clump of helium-burning stars have also been obtained for a 4.5 x 4.5 arcmin region. Near-infrared photometry led to measurements of the distance to Fornax based on the K-band location of the RGB tip and the red clump. Once corrected for the mean age of the stellar populations in the galaxy, the derived distance modulus is 20.74 corresponding to a distance of 141 Kpc, in good agreement with estimates from optical data. By taking age effects into account, we have derived a distribution function of global metallicity [M/H] from optical-infrared colors of individual stars. Our photometric Metallicity Distribution Function covers the range -2.0<[M/H]<-0.6, with a main peak at [M/H]~-0.9 and a long t...

  18. Dwarf galaxies in the Antlia Cluster: First results

    CERN Document Server

    Castelli, A V S; Cellone, S A; Richtler, T; Dirsch, B; Infante, L; Aruta, C; Gómez, M

    2006-01-01

    We present the first results of a project aimed to study the galaxy population of the Antlia cluster, the third nearest galaxy cluster after Virgo and Fornax. The observations for the Antlia project consist of Washington wide-field images taken with the MOSAIC camera mounted at the prime focus of the CTIO 4-m Blanco telescope. Our preliminary results correspond to the identification and classification of dwarf galaxies in the central cluster region, extending the list of Ferguson & Sandage (1990). The final aim of our project is to study the luminosity function, morphology and structural parameters of dwarf galaxies in the Antlia cluster with a more complete sample.

  19. Prospects of detecting gamma-ray emission from galaxy clusters: cosmic rays and dark matter annihilations

    CERN Document Server

    Pinzke, Anders; Bergstrom, Lars

    2011-01-01

    We study the possibility for detecting gamma-ray emission in galaxy clusters. We consider 1) cosmic ray (CR) induced pion decay which is thought to dominate the astrophysical signal from clusters, 2) different representative benchmark models of supersymmetric dark matter (DM), and 3) leptophilic models of DM annihilation that include a Sommerfeld enhancement (SFE). To model DM annihilation, we consider hadronization of annihilating neutralinos, internal bremsstrahlung, and inverse Compton emission from the cosmic microwave background as well as from a realistic spatial and spectral distribution of dust and stellar light. We predict the Virgo and Fornax clusters to be the brightest DM sources and find a particularly low CR induced background for Fornax. For a minimum substructure mass given by the DM free-streaming scale, we find a substructure boost factor of more than 1000. Since the annihilation flux of substructures is mostly contributed by the regions around the virial radius, the resulting surface bright...

  20. The metal-poor Knee in the Fornax Dwarf Spheroidal Galaxy

    CERN Document Server

    Hendricks, Benjamin; Lanfranchi, Gustavo A; Boeche, Corrado; Walker, Matthew; Johnson, Christian I; Penarrubia, Jorge; Gilmore, Gerard

    2014-01-01

    We present alpha-element abundances of Mg, Si, and Ti for a large sample of field stars in two outer fields of the Fornax dwarf spheroidal galaxy (dSph), obtained with VLT/GIRAFFE (R~16,000). Due to the large fraction of metal-poor stars in our sample, we are able to follow the alpha-element evolution from [Fe/H]=-2.5 continuously to [Fe/H]=-0.7 dex. For the first time we are able to resolve the turnover from the Type II supernovae (SNe) dominated, alpha-enhanced plateau down to subsolar [alpha/Fe] values due to the onset of SNe Ia, and thus to trace the chemical enrichment efficiency of the galaxy. Our data support the general concept of an alpha-enhanced plateau at early epochs, followed by a well-defined "knee", caused by the onset of SNe Ia, and finally a second plateau with sub-solar [alpha/Fe] values. We find the position of this knee to be at [Fe/H]=-1.9 and therefore significantly more metal-poor than expected from comparison with other dSphs and standard evolutionary models. Surprisingly, this value ...

  1. Hard X-Ray Spectrum from West Lobe of Radio Galaxy Fornax A Observed with Suzaku

    CERN Document Server

    Tashiro, Makoto S; Seta, Hiromi; Matsuta, Keiko; Yaji, Yuichi

    2009-01-01

    An observation of the West lobe of radio galaxy Fornax A (NGC 1316) with Suzaku is reported. Since Feigelson et al. (1995) and Kaneda et al. (1995) discovered the cosmic microwave background boosted inverse-Comptonized (IC) X-rays from the radio lobe, the magnetic field and electron energy density in the lobes have been estimated under the assumption that a single component of the relativistic electrons generates both the IC X-rays and the synchrotron radio emission. However, electrons generating the observed IC X-rays in the 1 -- 10 keV band do not possess sufficient energy to radiate the observed synchrotron radio emission under the estimated magnetic field of a few micro-G. On the basis of observations made with Suzaku, we show in the present paper that a 0.7 -- 20 keV spectrum is well described by a single power-law model with an energy index of 0.68 and a flux density of 0.12+/-0.01 nJy at 1 keV from the West lobe. The derived multiwavelength spectrum strongly suggests that a single electron energy distr...

  2. Model comparison of the dark matter profiles of Fornax, Sculptor, Carina and Sextans

    CERN Document Server

    Breddels, M A

    2013-01-01

    We use orbit based dynamical models to fit the 2nd and 4th moments of the line of sight velocity distributions of the Fornax, Sculptor, Carina and Sextans dwarf spheroidal galaxies. Our goal is to compare dark matter profile models of these four systems using Bayesian evidence. We consider NFW, Einasto and several cored profiles for their dark halos and present the probability distribution functions of the model parameters. When considering each system separately, we find there is no preference for one of these specific parametric density profiles. However, the combined evidence shows that it is unlikely that all galaxies are embedded in the same type of cored profiles of the form \\rho_{DM} \\propto 1/(1 + r^2)^{\\beta/2}, where \\beta = 3, 4. For each galaxy, we also obtain an almost model independent, and therefore accurate, measurement of the logarithmic slope of the dark matter density distribution at a radius ~ r_{-3}, i.e. where the logarithmic slope of the stellar density profile is -3. This slope ranges ...

  3. High-quality Spectrophotometry of the Planetary Nebula in the Fornax dSph

    CERN Document Server

    Kniazev, A Yu; Pustilnik, S A; Pramsky, A G

    2007-01-01

    We present results of NTT spectroscopy of the one known planetary nebula (PN) in the dwarf spheroidal galaxy Fornax, a gas-deficient Local Group galaxy that stopped its star formation activity a few hundred million years ago. We detected the [OIII] 4363 line with a signal-to-noise ratio of ~22. For the first time we detected the weak [SII] 6717,6731 lines (I(6717+6731) ~0.01 I(Hbeta)), determined the electron number density (Ne(SII) = 750 cm^-3), and calculated O, N, Ne, Ar, S, Cl, Fe, He and C abundances. The abundance analysis presented here is based on the direct calculation of the electron temperature Te and yields an oxygen abundance of 12+log(O/H) = 8.28+/-0.02. The analysis of the O, Ne, Ar and S abundances shows that the original ISM oxygen abundance was 0.27+/-0.10 dex lower and that third-dredge-up self-pollution in oxygen took place. The blue spectrum shows weak Wolf-Rayet features, and the progenitor star is classified as a weak emission-line star. Four of the five PNe in dwarf spheroidal galaxies...

  4. Globular clusters as tracers of the halo assembly of nearby central cluster galaxies

    CERN Document Server

    Hilker, Michael

    2015-01-01

    The properties of globular cluster systems (GCSs) in the core of the nearby galaxy clusters Fornax and Hydra I are presented. In the Fornax cluster we have gathered the largest radial velocity sample of a GCS system so far, which enables us to identify photometric and kinematic sub-populations around the central galaxy NGC 1399. Moreover, ages, metallicities and [alpha/Fe] abundances of a sub-sample of 60 bright globular clusters (GCs) with high S/N spectroscopy show a multi-modal distribution in the correlation space of these three parameters, confirming heterogeneous stellar populations in the halo of NGC 1399. In the Hydra I cluster very blue GCs were identified. They are not uniformly distributed around the central galaxies. 3-color photometry including the U-band reveals that some of them are of intermediate age. Their location coincides with a group of dwarf galaxies under disruption. This is evidence of a structurally young stellar halo 'still in formation', which is also supported by kinematic measure...

  5. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  6. VLT AND ACS OBSERVATIONS OF RDCS J1252.9-2927: DYNAMICAL STRUCTURE AND GALAXY POPULATIONS IN A MASSIVE CLUSTER AT Z=1.237*

    Energy Technology Data Exchange (ETDEWEB)

    Demarco, R; Rosati, P; Lidman, C; Girardi, M; Nonino, M; Rettura, A; Strazzullo, V; der Wel, A v; Ford, H C; Mainieri, V; Holden, B P; Stanford, S A; Blakeslee, J P; Gobat, R; Postman, M; Tozzi, P; Overzier, R A; Zirm, A W; Benitez, N; Homeier, N L; Illingworth, G D; Infante, L; Jee, M J; Mei, S; Menanteau, F; Motta, V; Zheng, W; Clampin, M; Hartig, G

    2007-03-23

    We present results from an extensive spectroscopic survey, carried out with FORS on the ESO Very Large Telescope, and from an extensive multi-wavelength imaging data set from the Advanced Camera for Surveys and ground based facilities of the cluster of galaxies RDCS J1252.9-2927. We have spectroscopically confirmed 38 cluster members in the redshift range 1.22 < z < 1.25. The distribution in velocity of these spectroscopic members yields a cluster median redshift of z = 1.237 and a rest-frame velocity dispersion of 747{sub -84}{sup +74} km s{sup -1}. Star-forming members are observed to mainly populate the outskirts of the cluster while passive galaxies dominate the central cluster region. Using the 38 confirmed redshifts, we were able to resolve, for the first time at z > 1, kinematic structure. The velocity distribution, which is not Gaussian at the 95% confidence level, is consistent with two groups that are also responsible for the projected elongation of the cluster in the East-West direction. The groups are composed of 26 and 12 galaxies and have velocity dispersions of 486{sub -85}{sup +47} km s{sup -1} and 426{sub -105}{sup +57} km s{sup -1}, respectively. The elongation is also seen in the intracluster gas (from X-ray observations) and the dark matter distribution (from a weak lensing analysis). This leads us to conclude that RDCS J1252.9-2927 has not yet reached a final virial state. We extend the analysis of the color-magnitude diagram of spectroscopic members to more than 1 Mpc from the cluster center. The scatter and slope of non-[OII]-emitting cluster members in the near-IR red sequence is similar to that seen in clusters at lower redshift. Furthermore, none of the galaxies with luminosities greater than {approx} K*{sub s} + 1.5 show any [OII] emission feature, indicating that these more luminous, redder galaxies have stopped forming stars earlier than the fainter, bluer galaxies. Our observations provide detailed dynamical and spectrophotometric

  7. DARK MATTER CORES IN THE FORNAX AND SCULPTOR DWARF GALAXIES: JOINING HALO ASSEMBLY AND DETAILED STAR FORMATION HISTORIES

    International Nuclear Information System (INIS)

    We combine the detailed star formation histories of the Fornax and Sculptor dwarf spheroidals with the mass assembly history of their dark matter (DM) halo progenitors to estimate if the energy deposited by Type II supernovae (SNe II) is sufficient to create a substantial DM core. Assuming the efficiency of energy injection of the SNe II into DM particles is εgc = 0.05, we find that a single early episode, z ≳ z infall, that combines the energy of all SNe II due to explode over 0.5 Gyr is sufficient to create a core of several hundred parsecs in both Sculptor and Fornax. Therefore, our results suggest that it is energetically plausible to form cores in cold dark matter (CDM) halos via early episodic gas outflows triggered by SNe II. Furthermore, based on CDM merger rates and phase-space density considerations, we argue that the probability of a subsequent complete regeneration of the cusp is small for a substantial fraction of dwarf-size halos

  8. The Globular Cluster System of the Coma cD Galaxy NGC 4874 from Hubble Space Telescope ACS and WFC3/IR Imaging

    Science.gov (United States)

    Cho, Hyejeon; Blakeslee, John P.; Chies-Santos, Ana L.; Jee, M. James; Jensen, Joseph B.; Peng, Eric W.; Lee, Young-Wook

    2016-05-01

    We present new Hubble Space Telescope (HST) optical and near-infrared (NIR) photometry of the rich globular cluster (GC) system NGC 4874, the cD galaxy in the core of the Coma cluster (Abell 1656). NGC 4874 was observed with the HST Advanced Camera for Surveys in the F475W (g 475) and F814W (I 814) passbands and with the Wide Field Camera 3 IR Channel in F160W (H 160). The GCs in this field exhibit a bimodal optical color distribution with more than half of the GCs falling on the red side at g 475-I 814 > 1. Bimodality is also present, though less conspicuously, in the optical-NIR I 814-H 160 color. Consistent with past work, we find evidence for nonlinearity in the g 475-I 814 versus I 814-H 160 color-color relation. Our results thus underscore the need for understanding the detailed form of the color-metallicity relations in interpreting observational data on GC bimodality. We also find a very strong color-magnitude trend, or “blue tilt,” for the blue component of the optical color distribution of the NGC 4874 GC system. A similarly strong trend is present for the overall mean I 814-H 160 color as a function of magnitude; for M 814 law and becomes much weaker at lower masses. As in other similar systems, the spatial distribution of the blue GCs is more extended than that of the red GCs, partly because of blue GCs associated with surrounding cluster galaxies. In addition, the center of the GC system is displaced by 4 ± 1 kpc toward the southwest from the luminosity center of NGC 4874, in the direction of NGC 4872. Finally, we remark on a dwarf elliptical galaxy with a noticeably asymmetrical GC distribution. Interestingly, this dwarf has a velocity of nearly -3000 km s-1 with respect to NGC 4874; we suggest it is on its first infall into the cluster core and is undergoing stripping of its GC system by the cluster potential. Based on observations with the NASA/ESA Hubble Space Telescope, obtained from the Space Telescope Science Institute (STScI), which is

  9. The Globular Cluster System of the Coma cD Galaxy NGC 4874 from Hubble Space Telescope ACS and WFC3/IR Imaging

    CERN Document Server

    Cho, Hyejeon; Chies-Santos, Ana L; Jee, M James; Jensen, Joseph B; Peng, Eric W; Lee, Young-Wook

    2016-01-01

    We present new HST optical and near-infrared (NIR) photometry of the rich globular cluster (GC) system of NGC 4874, the cD galaxy in the core of the Coma cluster (Abell 1656). NGC 4874 was observed with the HST Advanced Camera for Surveys in the F475W (g) and F814W (I) passbands and the Wide Field Camera 3 IR Channel in F160W (H). The GCs in this field exhibit a bimodal optical color distribution with more than half of the GCs falling on the red side at g-I > 1. Bimodality is also present, though less conspicuously, in the optical-NIR I-H color. Consistent with past work, we find evidence for nonlinearity in the g-I versus I-H color-color relation. Our results thus underscore the need for understanding the detailed form of the color-metallicity relations in interpreting observational data on GC bimodality. We also find a very strong color-magnitude trend, or "blue tilt," for the blue component of the optical color distribution of the NGC 4874 GC system. A similarly strong trend is present for the overall mean...

  10. Lack of nuclear clusters in dwarf sferoidal galaxies: implications for massive black holes formation and the cusp/core problem

    CERN Document Server

    Arca-Sedda, Manuel

    2016-01-01

    One of the leading scenarios for the formation of nuclear star clusters in galaxies is related to the orbital decay of globular clusters (GCs) and their subsequent merging, though alternative theories are currently debated. The availability of high-quality data for GCs structural and orbital parameters allow to test different nuclear star cluster formation scenarios. The Fornax dwarf spheroidal (dSph) galaxy is the heaviest satellite of the Milky Way and it is the only known dwarf spheroidal hosting 5 GCs, whereas there are no clear signatures for the presence of a central massive black hole. For this reason, it represents a suited place to study the orbital decay process in dwarf galaxies. In this paper we model the future evolution of the Fornax GCs simulating them and the host galaxy by means of direct $N$-body simulations. Our simulations take in account also the gravitational field generated by the Milky Way. We found that if the Fornax galaxy is embedded in a standard Cold Dark Matter Halo, the nuclear ...

  11. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  12. Fermi Large Area Telescope Detection of Extended Gamma-Ray Emission from the Radio Galaxy Fornax A

    CERN Document Server

    ,

    2016-01-01

    We report the Fermi Large Area Telescope detection of extended gamma-ray emission from the lobes of the radio galaxy Fornax A using 6.1 years of Pass 8 data. After Centaurus A, this is now the second example of an extended gamma-ray source attributed to a radio galaxy. Both an extended flat disk morphology and a morphology following the extended radio lobes were preferred over a point-source description, and the core contribution was constrained to be 100 MeV gamma-ray emission established, we model the source broadband emission considering currently available total lobe radio and millimeter flux measurements, as well as X-ray detections attributed to inverse Compton (IC) emission off the cosmic microwave background (CMB). Unlike the Centaurus A case, we find that a leptonic model involving IC scattering of CMB and extragalactic background light (EBL) photons underpredicts the gamma-ray fluxes by factors of about ~ 2 - 3, depending on the EBL model adopted. An additional gamma-ray spectral component is thus ...

  13. Mid-infrared dust in two nearby radio galaxies, NGC 1316 (Fornax A) and NGC 612 (PKS 0131-36)

    CERN Document Server

    Asabere, B Duah; Jarrett, T; Winkler, H

    2016-01-01

    Most radio galaxies are hosted by giant gas-poor ellipticals, but some contain significant amounts of dust, which is likely to be of external origin. In order to characterize the mid-IR properties of two of the most nearby and brightest merger-remnant radio galaxies of the Southern hemisphere, NGC 1316 (Fornax A) and NGC 612 (PKS 0131-36), we used observations with the Wide-field Infrared Survey Explorer (WISE) at wavelengths of 3.4, 4.6, 12 and 22 micron and Spitzer mid-infrared spectra. By applying a resolution-enhancement technique, new WISE images were produced at angular resolutions ranging from 2.6" to 5.5". Global measurements were performed in the four WISE bands, and stellar masses and star-formation rates were estimated using published scaling relations. Two methods were used to uncover the distribution of dust, one relying on two-dimensional fits to the 3.4 micron images to model the starlight, and the other one using a simple scaling and subtraction of the 3.4 micron images to estimate the stellar...

  14. Wide-Field Hubble Space Telescope Observations of the Globular Cluster System in NGC 1399*

    Science.gov (United States)

    Puzia, Thomas H.; Paolillo, Maurizio; Goudfrooij, Paul; Maccarone, Thomas J.; Fabbiano, Giuseppina; Angelini, Lorella

    2014-01-01

    We present a comprehensive high spatial resolution imaging study of globular clusters (GCs) in NGC 1399, thecentral giant elliptical cD galaxy in the Fornax galaxy cluster, conducted with the Advanced Camera for Surveys(ACS) aboard theHubble Space Telescope(HST).Using a novel technique to construct drizzled point-spreadfunction libraries for HSTACS data, we accurately determine the fidelity of GC structural parameter measurementsfrom detailed artificial star cluster experiments and show the superior robustness of the GC half-light radius,rh,compared with other GC structural parameters, such as King core and tidal radius. The measurement ofrhfor themajor fraction of the NGC 1399 GC system reveals a trend of increasingrhversus galactocentric distance,Rgal,out to about 10 kpc and a flat relation beyond. This trend is very similar for blue and red GCs, which are found tohave a mean size ratio ofrh,redrh,blue0.820.11 at all galactocentric radii from the core regions of the galaxyout to40 kpc. This suggests that the size difference between blue and red GCs is due to internal mechanismsrelated to the evolution of their constituent stellar populations. Modeling the mass density profile of NGC 1399shows that additional external dynamical mechanisms are required to limit the GC size in the galaxy halo regionstorh2 pc. We suggest that this may be realized by an exotic GC orbit distribution function, an extended darkmatter halo, andor tidal stress induced by the increased stochasticity in the dwarf halo substructure at largergalactocentric distances. We compare our results with the GCrhdistribution functions in various galaxies and findthat the fraction of extended GCs withrh5 pc is systematically larger in late-type galaxies compared with GCsystems in early-type galaxies. This is likely due to the dynamically more violent evolution of early-type galaxies.We match our GCrhmeasurements with radial velocity data from the literature and split the resulting sample at

  15. The binuclear nickel center in the A-cluster of acetyl-CoA synthase (ACS) and two biomimetic dinickel complexes studied by X-ray absorption and emission spectroscopy

    Science.gov (United States)

    Schrapers, P.; Mebs, S.; Ilina, Y.; Warner, D. S.; Wörmann, C.; Schuth, N.; Kositzki, R.; Dau, H.; Limberg, C.; Dobbek, H.; Haumann, M.

    2016-05-01

    Acetyl-CoA synthase (ACS) is involved in the bacterial carbon oxide conversion pathway. The binuclear nickel sites in ACS enzyme and two biomimetic synthetic compounds containing a Ni(II)Ni(II) unit (1 and 2) were compared using XAS/XES. EXAFS analysis of ACS proteins revealed similar Ni-N/O/S bond lengths and Ni-Ni/Fe distances as in the crystal structure in oxidized ACS, but elongated Ni-ligand bonds in reduced ACS, suggesting more reduced nickel species. The XANES spectra of ACS and the dinickel complexes showed overall similar shapes, but less resolved pre-edge and edge features in ACS, attributed to more distorted square-planar nickel sites in particular in reduced ACS. DFT calculation of pre-edge absorption and Kβ2,5 emission features reproduced the experimental spectra of the synthetic complexes, was sensitive even to the small geometry differences in 1 and 2, and indicated low-spin Ni(II) sites. Comparison of nickel sites in proteins and biomimetic compounds is valuable for deducing structural and electronic differences in response to ligation and redox changes.

  16. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  17. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  18. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  19. Chandra Observations of the Components of Clusters, Groups, and Galaxies and their Interactions

    CERN Document Server

    Forman, W; Markevitch, M L; Vikhlinin, A A; Churazov, E

    2001-01-01

    We discuss two themes from Chandra observations of galaxies, groups, and clusters. First, we review the merging process as seen through the high angular resolution of Chandra. We present examples of sharp, edge-like surface brightness structures ``cold fronts'', the boundaries of the remaining cores of merger components and the Chandra observations of CL0657, the first clear example of a strong cluster merger shock. In addition to reviewing already published work, we present observations of the cold front around the elliptical galaxy NGC1404 which is infalling into the Fornax cluster and we discuss multiple ``edges'' in ZW3146. Second, we review the effects of relativistic, radio-emitting plasmas or ``bubbles'', inflated by active galactic nuclei, on the hot X-ray emitting gaseous atmospheres in galaxies and clusters. We review published work and also discuss the unusual X-ray structures surrounding the galaxies NGC4636 and NGC507.

  20. AC power supply systems

    International Nuclear Information System (INIS)

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  1. Massive Star Clusters in Dwarf Galaxies

    CERN Document Server

    Larsen, Soeren S

    2015-01-01

    Dwarf galaxies can have very high globular cluster specific frequencies, and the GCs are in general significantly more metal-poor than the bulk of the field stars. In some dwarfs, such as Fornax, WLM, and IKN, the fraction of metal-poor stars that belong to GCs can be as high as 20%-25%, an order of magnitude higher than the 1%-2% typical of GCs in halos of larger galaxies. Given that chemical abundance anomalies appear to be present also in GCs in dwarf galaxies, this implies severe difficulties for self-enrichment scenarios that require GCs to have lost a large fraction of their initial masses. More generally, the number of metal-poor field stars in these galaxies is today less than what would originally have been present in the form of low-mass clusters if the initial cluster mass function was a power-law extending down to low masses. This may imply that the initial GC mass function in these dwarf galaxies was significantly more top-heavy than typically observed in present-day star forming environments.

  2. Binary populations in Milky Way satellite galaxies: Constraints from multi-epoch data in the Carina, Fornax, Sculptor, and Sextans dwarf spheroidal galaxies

    Energy Technology Data Exchange (ETDEWEB)

    Minor, Quinn E. [Department of Science, Borough of Manhattan Community College, City University of New York, New York, NY 10007 (United States); Department of Astrophysics, American Museum of Natural History, New York, NY 10024 (United States)

    2013-12-20

    We introduce a likelihood analysis of multi-epoch stellar line-of-sight velocities to constrain the binary fractions and binary period distributions of dwarf spheroidal galaxies. This method is applied to multi-epoch data from the Magellan/MMFS survey of the Carina, Fornax, Sculptor, and Sextans dSph galaxies, after applying a model for the measurement errors that accounts for binary orbital motion. We find that the Fornax, Sculptor, and Sextans dSphs are consistent with having binary populations similar to that of Milky Way field binaries to within 68% confidence limits, whereas the Carina dSph is remarkably deficient in binaries with periods less than ∼10 yr. If Carina is assumed to have a period distribution identical to that of the Milky Way field, its best-fit binary fraction is 0.14{sub −0.05}{sup +0.28}, and is constrained to be less than 0.5 at the 90% confidence level; thus it is unlikely to host a binary population identical to that of the Milky Way field. By contrast, the best-fit binary fraction of the combined sample of all four galaxies is 0.46{sub −0.09}{sup +0.13}, consistent with that of Milky Way field binaries. More generally, we infer probability distributions in binary fraction, mean orbital period, and dispersion of periods for each galaxy in the sample. Looking ahead to future surveys, we show that the allowed parameter space of binary fraction and period distribution parameters in dSphs will be narrowed significantly by a large multi-epoch survey. However, there is a degeneracy between the parameters that is unlikely to be broken unless the measurement error is of order ∼0.1 km s{sup –1} or smaller, presently attainable only by a high-resolution spectrograph.

  3. Mid-infrared dust in two nearby radio galaxies, NGC 1316 (Fornax A) and NGC 612 (PKS 0131-36)

    Science.gov (United States)

    Duah Asabere, B.; Horellou, C.; Jarrett, T. H.; Winkler, H.

    2016-07-01

    Context. Most radio galaxies are hosted by giant gas-poor ellipticals, but some contain significant amounts of dust, which is likely to be of external origin. Aims: In order to characterize the mid-IR properties of two of the most nearby and brightest merger-remnant radio galaxies of the Southern hemisphere, NGC 1316 (Fornax A) and NGC 612 (PKS 0131-36), we used observations with the Wide-field Infrared Survey Explorer (WISE) at wavelengths of 3.4, 4.6, 12 and 22 μm and Spitzer mid-infrared spectra. Methods: By applying a resolution-enhancement technique, new WISE images were produced at angular resolutions ranging from 2.̋6 to 5.̋5. Global measurements were performed in the four WISE bands, and stellar masses and star-formation rates were estimated using published scaling relations. Two methods were used to uncover the distribution of dust, one relying on two-dimensional fits to the 3.4 μm images to model the starlight, and the other one using a simple scaling and subtraction of the 3.4 μm images to estimate the stellar continuum contribution to the emission in the 12 and 22 μm bands. Results: The two galaxies differ markedly in their mid-IR properties. The 3.4 μm brightness distribution can be well represented by the superposition of two Sérsic models in NGC 1316 and by a Sérsic model and an exponential disk in NGC 612. The WISE colors of NGC 1316 are typical of those of early-type galaxies; those of NGC 612 are in the range found for star-forming galaxies. From the 22 μm luminosity, we infer a star-formation rate of ~0.7 M⊙ yr-1 in NGC 1316 and ~7 M⊙ yr-1 in NGC 612. Spitzer spectroscopy shows that the 7.7-to-11.3 μm PAH line ratio is significantly lower in NGC 1316 than in NGC 612. The WISE images reveal resolved emission from dust in the central 1'-2' of the galaxies. In NGC 1316, the extra-nuclear emission coincides with two dusty regions NW and SE of the nucleus seen in extinction in optical images and where molecular gas is known to reside

  4. AC1 Wing

    Directory of Open Access Journals (Sweden)

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  5. AC1 Wing

    OpenAIRE

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  6. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  7. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  8. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  9. Hermetisk AC-Krets

    OpenAIRE

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  10. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  11. Featured Image: A Galaxy Plunges Into a Cluster Core

    Science.gov (United States)

    Kohler, Susanna

    2015-10-01

    The galaxy that takes up most of the frame in this stunning image (click for the full view!) is NGC 1427A. This is a dwarf irregular galaxy (unlike the fortuitously-located background spiral galaxy in the lower right corner of the image), and its currently in the process of plunging into the center of the Fornax galaxy cluster. Marcelo Mora (Pontifical Catholic University of Chile) and collaborators have analyzed observations of this galaxy made by both the Very Large Telescope in Chile and the Hubble Advanced Camera for Surveys, which produced the image shown here as a color composite in three channels. The team worked to characterize the clusters of star formation within NGC 1427A identifiable in the image as bright knots within the galaxy and determine how the interactions of this galaxy with its cluster environment affect the star formation within it. For more information and the original image, see the paper below.Citation:Marcelo D. Mora et al 2015 AJ 150 93. doi:10.1088/0004-6256/150/3/93

  12. The globular cluster system of NGC1316. III. Kinematic complexity

    CERN Document Server

    Richtler, Tom; Kumar, Brijesh; Bassino, Lilia P; Gomez, Matias; Dirsch, Boris

    2014-01-01

    The merger remnant NGC 1316 (Fornax A) is one of the most important objects regarding the investigation of merger-related processes. We use kinematical data of globular clusters (GCs) and the diffuse stellar light to investigate the global structure of NGC 1316 and to constrain the dark matter content. We perform multi-object-spectroscopy with VLT/FORS2 and MXU. Out of 562 slits, we extract radial velocities for 177 GCs. Moreover, we measure radial velocities of the integrated galaxy light, using slits with a sufficiently bright "sky". To these data, we add 20 cluster velocities from Goudfrooij et al. (2001). In an appendix, we identify new morphological features of NGC 1316 and its companion galaxy NGC 1317. The GC sample based on radial velocities confirms the colour peaks already found in our photometric study. The bright clusters, which probably have their origin in a 2 Gyr-old starburst and younger star formation events, avoid the systemic velocity. A Gaussian velocity distribution is found only for clus...

  13. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  14. Hybrid AC-DC offshore wind power plant topology: optimal design

    OpenAIRE

    Prada Gil, Mikel de; Igualada González, Lucía; Corchero García, Cristina; Gomis Bellmunt, Oriol; Sumper, Andreas

    2015-01-01

    The aim of this paper is to present a hybrid AC-DC offshore wind power plant (OWPP) topology and to optimize its design in order to minimize the OWPP's total cost. This hybrid concept is based on clustering wind turbines and connecting each group to an AC/DC power converter installed on a collector platform which is located between the AC wind turbine array and the HVDC offshore platform. Thereby, individual power converters of each wind turbine are not required, since such AC/DC converters c...

  15. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  16. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  17. Ac Hybrid Charge Controller

    Directory of Open Access Journals (Sweden)

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  18. UCDs in the Coma Cluster

    CERN Document Server

    Chiboucas, Kristin; Marzke, Ronald O; Phillipps, Steven; Price, James; Peng, Eric W; Trentham, Neil; Carter, David; Hammer, Derek

    2010-01-01

    As part of the HST/ACS Coma Cluster Treasury Survey, we have undertaken a Keck/LRIS spectroscopic campaign to determine membership for faint dwarf galaxies. In the process, we discovered a population of Ultra Compact Dwarf galaxies (UCDs) in the core region of the Coma cluster. At the distance of Coma, UCDs are expected to have angular sizes 0.01 < R_e < 0.2 arcsec. With ACS imaging, we can resolve all but the smallest ones with careful fitting. Candidate UCDs were chosen based on magnitude, color, and degree of resolution. We spectroscopically confirm 27 objects as bona fide UCD members of the Coma cluster, a 60% success rate for objects targeted with M_R < -12. We attribute the high success rate in part to the high resolution of HST data and to an apparent large population of UCDs in Coma. We find that the UCDs tend to be strongly clustered around giant galaxies, at least in the core region of the cluster, and have a distribution and colors that are similar to globular clusters. These findings sugg...

  19. Weighted Clustering

    DEFF Research Database (Denmark)

    Ackerman, Margareta; Ben-David, Shai; Branzei, Simina;

    2012-01-01

    We investigate a natural generalization of the classical clustering problem, considering clustering tasks in which different instances may have different weights.We conduct the first extensive theoretical analysis on the influence of weighted data on standard clustering algorithms in both the...... partitional and hierarchical settings, characterizing the conditions under which algorithms react to weights. Extending a recent framework for clustering algorithm selection, we propose intuitive properties that would allow users to choose between clustering algorithms in the weighted setting and classify...

  20. Globular cluster clustering and tidal features around ultra compact dwarf galaxies in the halo of NGC1399

    CERN Document Server

    Voggel, Karina; Richtler, Tom

    2015-01-01

    We present a novel approach to constrain the formation channels of Ultra-Compact Dwarf Galaxies (UCDs). This inhomogeneous class of objects of remnants of tidally stripped dwarf elliptical galaxies and high mass globular clusters. We use three methods to unravel their nature: 1) we analysed their surface brightness profiles, 2) we carried out a direct search for tidal features around UCDs and 3) we compared the spatial distribution of GCs and UCDs in the halo of their host galaxy. Based on FORS2 observations, we have studied the detailed structural composition of a large sample of 97 UCDs in the halo of NGC1399, the central galaxy of the Fornax cluster, by analysing theirsurface brightness profiles. We derived the structural parameters of 13 extended UCDs modelling them with a single Sersic function and decomposing them into composite King and Sersic profiles. We find evidence for faint stellar envelopes at mu=~26 mag\\arcsec^-2 surrounding the UCDs up to an extension of 90pc in radius. We also show new eviden...

  1. The globular cluster system of NGC 1399 V. dynamics of the cluster system out to 80 kpc

    CERN Document Server

    Schuberth, Y; Hilker, M; Dirsch, B; Bassino, L P; Romanowsky, A J; Infante, L

    2009-01-01

    (Abridged) We use the largest set of globular cluster velocities obtained so far of any elliptical galaxy to revise and extend the previous investigations of the dynamics of NGC 1399, the central dominant galaxy of the nearby Fornax cluster of galaxies. Our sample now comprises velocities for almost 700 GCs with projected galactocentric radii between 6 and 100 kpc. In addition, we use velocities published by Bergond et al. (2007). We study the kinematics of the metal-poor and metal-rich subpopulations and perform spherical Jeans modelling. The most important results are: The metal-rich (red) GCs resemble the stellar field population of NGC 1399 in the region of overlap. Both subpopulations are kinematically distinct and do not show a smooth transition. It is not possible to find a common dark halo which reproduces simultaneously the properties of both subpopulations. Some velocities of blue GCs are only to be explained by orbits with very large apogalactic distances, thus indicating a contamination with GCs w...

  2. Operation Method for AC Motor Control during Power Interruption in Direct AC/AC Converter System

    Science.gov (United States)

    Shizu, Keiichiro; Azuma, Satoshi

    Direct AC/AC converters have been studied due to their potential use in power converters with no DC-link capacitor, which can contribute to the miniaturization of power converters. However, the absence of a DC-link capacitor makes it difficult to control the AC motor during power interruption. First, this paper proposes a system that realizes AC motor control during power interruption by utilizing a clamp capacitor. In general, direct AC/AC converters have a clamp circuit consisting of a rectifier diode(s) and a clamp capacitor in order to avoid over-voltages. In the proposed system, there is an additional semiconductor switch reverse-parallel to the rectifier diode(s), and the clamp capacitor voltage can be utilized for AC motor control by turning on the additional switch. Second, this paper discusses an operation method for AC motor control and clamp capacitor voltage control during power interruption. In the proposed method “DC-link voltage control”, the kinetic energy in the AC motor is transformed into electrical energy and stored in the clamp capacitor; the clamp capacitor is therefore charged and the capacitor voltage is controlled to remain constant at an instruction value. Third, this paper discusses a switching operation during power interruption. A dead-time is introduced between the operation of turning off all switches on the rectifier side and the operation of turning on the additional switch, which prevents the occurrence of a short circuit between the interrupted power source and the clamp capacitor. Finally, experimental results are presented. During power interruptions, an output current was continuously obtained and the clamp capacitor voltage was maintained to be equal to the instruction value of the capacitor voltage. These results indicate that both AC motor control and capacitor voltage control were successfully achieved by using the proposed system.

  3. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Energy Technology Data Exchange (ETDEWEB)

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  4. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  5. Isotopic clusters

    International Nuclear Information System (INIS)

    Spectra of isotopically mixed clusters (dimers of SF6) are calculated as well as transition frequencies. The result leads to speculations about the suitability of the laser-cluster fragmentation process for isotope separation. (Auth.)

  6. Meaningful Clusters

    Energy Technology Data Exchange (ETDEWEB)

    Sanfilippo, Antonio P.; Calapristi, Augustin J.; Crow, Vernon L.; Hetzler, Elizabeth G.; Turner, Alan E.

    2004-05-26

    We present an approach to the disambiguation of cluster labels that capitalizes on the notion of semantic similarity to assign WordNet senses to cluster labels. The approach provides interesting insights on how document clustering can provide the basis for developing a novel approach to word sense disambiguation.

  7. Data Clustering

    Science.gov (United States)

    Wagstaff, Kiri L.

    2012-03-01

    On obtaining a new data set, the researcher is immediately faced with the challenge of obtaining a high-level understanding from the observations. What does a typical item look like? What are the dominant trends? How many distinct groups are included in the data set, and how is each one characterized? Which observable values are common, and which rarely occur? Which items stand out as anomalies or outliers from the rest of the data? This challenge is exacerbated by the steady growth in data set size [11] as new instruments push into new frontiers of parameter space, via improvements in temporal, spatial, and spectral resolution, or by the desire to "fuse" observations from different modalities and instruments into a larger-picture understanding of the same underlying phenomenon. Data clustering algorithms provide a variety of solutions for this task. They can generate summaries, locate outliers, compress data, identify dense or sparse regions of feature space, and build data models. It is useful to note up front that "clusters" in this context refer to groups of items within some descriptive feature space, not (necessarily) to "galaxy clusters" which are dense regions in physical space. The goal of this chapter is to survey a variety of data clustering methods, with an eye toward their applicability to astronomical data analysis. In addition to improving the individual researcher’s understanding of a given data set, clustering has led directly to scientific advances, such as the discovery of new subclasses of stars [14] and gamma-ray bursts (GRBs) [38]. All clustering algorithms seek to identify groups within a data set that reflect some observed, quantifiable structure. Clustering is traditionally an unsupervised approach to data analysis, in the sense that it operates without any direct guidance about which items should be assigned to which clusters. There has been a recent trend in the clustering literature toward supporting semisupervised or constrained

  8. Catching Dissolving Clusters: a New Approach

    CERN Document Server

    Pellerin, A; Harris, J; Calzetti, D; Pellerin, Anne; Meyer, Martin; Harris, Jason; Calzetti, Daniela

    2006-01-01

    Traditional studies of stellar clusters in external galaxies use surface photometry and therefore focus on systems that are still bright and compact enough to be separated from the stellar background. Consequently, the latter stages of unbound cluster evolution are still poorly understood. This dramatically constrains our knowledge of the dissolution processes of stellar clusters in various physical environments. We present the first results of a new approach to directly detect and quantify the characteristics of evolved stellar clusters. Using the exceptional spatial resolution and sensitivity of HST/ACS images to resolve the stellar content nearby galaxies, we construct colour-magnitude diagrams for the observed fields. This enable us to separate the younger population likely present in young clusters from the older stellar content of the star field background. We utilize a clustering algorithm to assign each star to a group based on its local spatial density. This novel approach makes use of algorithms typ...

  9. Cluster Chemistry

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    @@ Cansisting of eight scientists from the State Key Laboratory of Physical Chemistry of Solid Surfaces and Xiamen University, this creative research group is devoted to the research of cluster chemistry and creation of nanomaterials.After three-year hard work, the group scored a series of encouraging progresses in synthesis of clusters with special structures, including novel fullerenes, fullerene-like metal cluster compounds as well as other related nanomaterials, and their properties study.

  10. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  11. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  12. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  13. Carbon in Red Giants in Globular Clusters and Dwarf Spheroidal Galaxies

    CERN Document Server

    Kirby, Evan N; Zhang, Andrew J; Deng, Michelle; Cohen, Judith G; Guhathakurta, Puragra; Shetrone, Matthew D; Lee, Young Sun; Rizzi, Luca

    2015-01-01

    We present carbon abundances of red giants in Milky Way globular clusters and dwarf spheroidal galaxies (dSphs). Our sample includes measurements of carbon abundances for 154 giants in the clusters NGC 2419, M68, and M15 and 398 giants in the dSphs Sculptor, Fornax, Ursa Minor, and Draco. This sample doubles the number of dSph stars with measurements of [C/Fe]. The [C/Fe] ratio in the clusters decreases with increasing luminosity above log(L/L_sun) ~= 1.6, which can be explained by deep mixing in evolved giants. The same decrease is observed in dSphs, but the initial [C/Fe] of the dSph giants is not uniform. Stars in dSphs at lower metallicities have larger [C/Fe] ratios. We hypothesize that [C/Fe] (corrected to the initial carbon abundance) declines with increasing [Fe/H] due to the metallicity dependence of the carbon yield of asymptotic giant branch stars and due to the increasing importance of Type Ia supernovae at higher metallicities. We also identified 11 very carbon-rich giants (8 previously known) in...

  14. SSTI Clark ACS Technology Demonstrations

    OpenAIRE

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  15. Apuntes de Acústica

    OpenAIRE

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  16. Energy saving in ac generators

    Science.gov (United States)

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  17. Fuzzy Clustering

    DEFF Research Database (Denmark)

    Berks, G.; Keyserlingk, Diedrich Graf von; Jantzen, Jan;

    2000-01-01

    -mean clustering is an easy and well improved tool, which has been applied in many medical fields. We used c-mean fuzzy clustering after feature extraction from an aphasia database. Factor analysis was applied on a correlation matrix of 26 symptoms of language disorders and led to five factors. The factors...

  18. Estimating the abundance of clustered animal population by using adaptive cluster sampling and negative binomial distribution

    Science.gov (United States)

    Bo, Yizhou; Shifa, Naima

    2013-09-01

    An estimator for finding the abundance of a rare, clustered and mobile population has been introduced. This model is based on adaptive cluster sampling (ACS) to identify the location of the population and negative binomial distribution to estimate the total in each site. To identify the location of the population we consider both sampling with replacement (WR) and sampling without replacement (WOR). Some mathematical properties of the model are also developed.

  19. Molecular cluster theory of chemical bonding in actinide oxide

    International Nuclear Information System (INIS)

    The electronic structure of actinide monoxides AcO and dioxides AcO2, where Ac = Th, U, Np, Pu, Am, Cm and Bk has been studied by molecular cluster methods based on the first-principles one-electron local density theory. Molecular orbitals for nearest neighbor clusters AcO10-6 and AcO12-8 representative of monoxide and dioxide lattices were obtained using non-relativistic spin-restricted and spin-polarized Hartree-Fock-Slater models for the entire series. Fully relativistic Dirac-Slater calculations were performed for ThO, UO and NpO in order to explore magnitude of spin-orbit splittings and level shifts in valence structure. Self-consistent iterations were carried out for NpO, in which the NpO6 cluster was embedded in the molecular field of the solid. Finally, a ''moment polarized'' model which combines both spin-polarization and relativistic effects in a consistent fashion was applied to the NpO system. Covalent mixing of oxygen 2p and Ac 5f orbitals was found to increase rapidly across the actinide series; metal s,p,d covalency was found to be nearly constant. Mulliken atomic population analysis of cluster eigenvectors shows that free-ion crystal field models are unreliable, except for the light actinides. X-ray photoelectron line shapes have been calculated and are found to compare rather well with experimental data on the dioxides

  20. Spectroscopy of globular clusters in the low-luminosity spiral galaxy NGC 45

    NARCIS (Netherlands)

    Mora, M.D.; Larsen, S.S.; Kissler-Patig, M.

    2008-01-01

    Context. Extragalactic globular clusters have been studied in elliptical galaxies and in a few luminous spiral galaxies, but little is known about globular clusters in low-luminosity spirals. Aims. Past observations with the ACS have shown that NGC 45 hosts a large population of globular clusters (1

  1. The Hubble Space Telescope advanced camera for surveys coma cluster survey. I. Survey objectives and design

    NARCIS (Netherlands)

    Carter, David; Goudfrooij, Paul; Mobasher, Bahram; Ferguson, Henry C.; Puzia, Thomas H.; Aguerri, Alfonso L.; Balcells, Marc; Batcheldor, Dan; Bridges, Terry J.; Davies, Jonathan I.; Erwin, Peter; Graham, Alister W.; Guzmán, Rafael; Hammer, Derek; Hornschemeier, Ann; Hoyos, Carlos; Hudson, Michael J.; Huxor, Avon; Jogee, Shardha; Komiyama, Yutaka; Lotz, Jennifer; Lucey, John R.; Marzke, Ronald O.; Merritt, David; Miller, Bryan W.; Miller, Neal A.; Mouhcine, Mustapha; Okamura, Sadanori; Peletier, Reynier F.; Phillipps, Steven; Poggianti, Bianca M.; Sharples, Ray M.; Smith, Russell J.; Trentham, Neil; Tully, R. Brent; Valentijn, Edwin; Verdoes Kleijn, Gijs

    2008-01-01

    We describe the HST ACS Coma Cluster Treasury survey, a deep two-passband imaging survey of one of the nearest rich clusters of galaxies, the Coma Cluster (Abell 1656). The survey was designed to cover an area of 740 arcmin2 in regions of different density of both galaxies and intergalactic medium w

  2. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  3. Deriving physical parameters of unresolved star clusters III. Application to M31 PHAT clusters

    CERN Document Server

    de Meulenaer, Philippe; Mineikis, Tadas; Vansevičius, Vladas

    2015-01-01

    This study is the third of a series that investigates the degeneracy and stochasticity problems present in the determination of physical parameters such as age, mass, extinction, and metallicity of partially resolved or unresolved star cluster populations situated in external galaxies when using broad-band photometry. This work tests the derivation of parameters of artificial star clusters using models with fixed and free metallicity for the WFC3+ACS photometric system. Then the method is applied to derive parameters of a sample of 203 star clusters in the Andromeda galaxy observed with the HST. Following Papers I \\& II, the star cluster parameters are derived using a large grid of stochastic models that are compared to the observed cluster broad-band integrated WFC3+ACS magnitudes. We derive the age, mass, and extinction of the sample of M31 star clusters with one fixed metallicity in agreement with previous studies. Using artificial tests we demonstrate the ability of the WFC3+ACS photometric system to ...

  4. Weighted Clustering

    CERN Document Server

    Ackerman, Margareta; Branzei, Simina; Loker, David

    2011-01-01

    In this paper we investigate clustering in the weighted setting, in which every data point is assigned a real valued weight. We conduct a theoretical analysis on the influence of weighted data on standard clustering algorithms in each of the partitional and hierarchical settings, characterising the precise conditions under which such algorithms react to weights, and classifying clustering methods into three broad categories: weight-responsive, weight-considering, and weight-robust. Our analysis raises several interesting questions and can be directly mapped to the classical unweighted setting.

  5. Cluster analysis

    CERN Document Server

    Everitt, Brian S; Leese, Morven; Stahl, Daniel

    2011-01-01

    Cluster analysis comprises a range of methods for classifying multivariate data into subgroups. By organizing multivariate data into such subgroups, clustering can help reveal the characteristics of any structure or patterns present. These techniques have proven useful in a wide range of areas such as medicine, psychology, market research and bioinformatics.This fifth edition of the highly successful Cluster Analysis includes coverage of the latest developments in the field and a new chapter dealing with finite mixture models for structured data.Real life examples are used throughout to demons

  6. Cluster editing

    DEFF Research Database (Denmark)

    Böcker, S.; Baumbach, Jan

    2013-01-01

    The Cluster Editing problem asks to transform a graph into a disjoint union of cliques using a minimum number of edge modifications. Although the problem has been proven NP-complete several times, it has nevertheless attracted much research both from the theoretical and the applied side. The...... algorithms for biological problems. © 2013 Springer-Verlag....... problem has been the inspiration for numerous algorithms in bioinformatics, aiming at clustering entities such as genes, proteins, phenotypes, or patients. In this paper, we review exact and heuristic methods that have been proposed for the Cluster Editing problem, and also applications of these...

  7. Genome Sequence of the Mycorrhiza Helper Bacterium Streptomyces sp. Strain AcH 505.

    Science.gov (United States)

    Tarkka, M T; Feldhahn, L; Buscot, F; Wubet, T

    2015-04-02

    A draft genome sequence of Streptomyces sp. strain AcH 505 is presented here. The genome encodes 22 secondary metabolite gene clusters and a large arsenal of secreted proteins, and their comparative and functional analyses will help to advance our knowledge of symbiotic interactions and fungal and plant biomass degradation.

  8. Distribution of star formation rates during the rapid assembly of NGC 1399 as deduced from its globular cluster system

    CERN Document Server

    Schulz, C; Kroupa, P; Pflamm-Altenburg, J

    2016-01-01

    Ultra-compact dwarf galaxies (UCDs) share many properties with globular clusters (GCs) and are found in similar environments. A large sample of UCDs and GCs around NGC 1399, the central giant elliptical of the Fornax galaxy cluster, is used to infer their formation history and also that of NGC 1399. We assumed that all GCs and UCDs in our sample are star clusters (SCs) and used them as tracers of past star formation activities. After correcting our GC/UCD sample for mass loss, we interpreted their overall mass function to be a superposition of SC populations that formed coevally during different times. The SC masses of each population were distributed according to the embedded cluster mass function (ECMF), a pure power law with the slope $-\\beta$ and a stellar upper mass limit, $M_{\\mathrm{max}}$, which depended on the star formation rate (SFR). We decomposed the observed GC/UCD mass function into individual SC populations and converted $M_{\\mathrm{max}}$ of each SC population to an SFR. The overall distribut...

  9. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  10. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  11. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  12. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  13. The complex nature of the nuclear star cluster in FCC 277

    CERN Document Server

    Lyubenova, Mariya; Cote, Patrick; Kuntschner, Harald; van de Ven, Glenn; Ferrarese, Laura; Jordan, Andres; Infante, Leopoldo

    2013-01-01

    Recent observations have shown that compact nuclear star clusters (NSCs) are present in up to 80% of galaxies. However, detailed studies of their dynamical and chemical properties are confined mainly to spiral galaxy hosts, where they are more easily observed. In this paper we present our study of the NSC in FCC 277, a nucleated elliptical galaxy in the Fornax cluster. We use a combination of adaptive optics assisted near-infrared integral field spectroscopy, Hubble Space Telescope imaging, and literature long slit data. We show that while the NSC does not appear to rotate within our detection limit of ~6 km/s, rotation is detected at larger radii, where the isophotes appear to be disky, suggesting the presence of a nuclear disk. We also observe a distinct central velocity dispersion drop that is indicative of a dynamically cold rotating sub-system. Following the results of orbit-based dynamical modelling, co-rotating as well as counter-rotating stellar orbits are simultaneously needed to reproduce the observ...

  14. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  15. Cluster headache

    Science.gov (United States)

    Doctors do not know exactly what causes cluster headaches. They seem to be related to the body's sudden release of histamine (chemical in the body released during an allergic response) or serotonin (chemical made by nerve cells). A problem in a small area at ...

  16. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  17. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  18. Globular Cluster Systems in Brightest Cluster Galaxies. II: NGC 6166

    CERN Document Server

    Harris, William E; Whitmore, Bradley C; Gnedin, Oleg Y; Geisler, Douglas; Rothberg, Barry

    2015-01-01

    We present new deep photometry of the globular cluster system (GCS) around NGC 6166, the central supergiant galaxy in Abell 2199. HST data from the ACS and WFC3 cameras in F475W, F814W are used to determine the spatial distribution of the GCS, its metallicity distribution function (MDF), and the dependence of the MDF on galactocentric radius and on GC luminosity. The MDF is extremely broad, with the classic red and blue subpopulations heavily overlapped, but a double-Gaussian model can still formally match the MDF closely. The spatial distribution follows a Sersic-like profile detectably to a projected radius of at least $R_{gc} = 250$ kpc. To that radius, the total number of clusters in the system is N_{GC} = 39000 +- 2000, the global specific frequency is S_N = 11.2 +- 0.6, and 57\\% of the total are blue, metal-poor clusters. The GCS may fade smoothly into the Intra-Cluster Medium of A2199; we see no clear transition from the core of the galaxy to the cD halo or the ICM. The radial distribution, projected e...

  19. ac electroosmosis in rectangular microchannels.

    Science.gov (United States)

    Campisi, Michele; Accoto, Dino; Dario, Paolo

    2005-11-22

    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  20. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  1. Bayesian Analysis of Two Stellar Populations in Galactic Globular Clusters III: Analysis of 30 Clusters

    CERN Document Server

    Wagner-Kaiser, R; Sarajedini, A; von Hippel, T; van Dyk, D A; Robinson, E; Stein, N; Jefferys, W H

    2016-01-01

    We use Cycle 21 Hubble Space Telescope (HST) observations and HST archival ACS Treasury observations of 30 Galactic Globular Clusters to characterize two distinct stellar populations. A sophisticated Bayesian technique is employed to simultaneously sample the joint posterior distribution of age, distance, and extinction for each cluster, as well as unique helium values for two populations within each cluster and the relative proportion of those populations. We find the helium differences among the two populations in the clusters fall in the range of ~0.04 to 0.11. Because adequate models varying in CNO are not presently available, we view these spreads as upper limits and present them with statistical rather than observational uncertainties. Evidence supports previous studies suggesting an increase in helium content concurrent with increasing mass of the cluster and also find that the proportion of the first population of stars increases with mass as well. Our results are examined in the context of proposed g...

  2. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  3. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  4. Short term dynamic aperture with AC dipoles

    CERN Document Server

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department

    2015-01-01

    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  5. Regional Innovation Clusters

    Data.gov (United States)

    Small Business Administration — The Regional Innovation Clusters serve a diverse group of sectors and geographies. Three of the initial pilot clusters, termed Advanced Defense Technology clusters,...

  6. Cluster forcing

    DEFF Research Database (Denmark)

    Christensen, Thomas Budde

    The cluster theory attributed to Michael Porter has significantly influenced industrial policies in countries across Europe and North America since the beginning of the 1990s. Institutions such as the EU, OECD and the World Bank and governments in countries such as the UK, France, The Netherlands......, Portugal and New Zealand have adopted the concept. Public sector interventions that aim to support cluster development in industries most often focus upon economic policy goals such as enhanced employment and improved productivity, but rarely emphasise broader societal policy goals relating to e...... a difference in terms of enhancing regional development but the paper also concludes that the interventions tend to follow the development path of the established industry and thus tend to neglect long term sustainable development issues while failing to escape the traditional confines of regional industrial...

  7. Clustering experiments

    CERN Document Server

    Wang, Zhengwei; Tan, Ken; Di, Zengru; Roehner, Bertrand M

    2011-01-01

    It is well known that bees cluster together in cold weather, in the process of swarming (when the ``old'' queen leaves with part of the colony) or absconding (when the queen leaves with all the colony) and in defense against intruders such as wasps or hornets. In this paper we describe a fairly different clustering process which occurs at any temperature and independently of any special stimulus or circumstance. As a matter of fact, this process is about four times faster at 28 degree Celsius than at 15 degrees. Because of its simplicity and low level of ``noise'' we think that this phenomenon can provide a means for exploring the strength of inter-individual attraction between bees or other living organisms. For instance, and at first sight fairly surprisingly, our observations showed that this attraction does also exist between bees belonging to different colonies. As this study is aimed at providing a comparative perspective, we also describe a similar clustering experiment for red fire ants.

  8. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette;

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  9. Dark Matter Searches with Cherenkov Telescopes: Nearby Dwarf Galaxies or Local Galaxy Clusters?

    International Nuclear Information System (INIS)

    In this paper, we compare dwarf galaxies and galaxy clusters in order to elucidate which object class is the best target for gamma-ray DM searches with imaging atmospheric Cherenkov telescopes (IACTs). We have built a mixed dwarfs+clusters sample containing some of the most promising nearby dwarf galaxies (Draco, Ursa Minor, Wilman 1 and Segue 1) and local galaxy clusters (Perseus, Coma, Ophiuchus, Virgo, Fornax, NGC 5813 and NGC 5846), and then compute their DM annihilation flux profiles by making use of the latest modeling of their DM density profiles. We also include in our calculations the effect of DM substructure. Willman 1 appears as the best candidate in the sample. However, its mass modeling is still rather uncertain, so probably other candidates with less uncertainties and quite similar fluxes, namely Ursa Minor and Segue 1, might be better options. As for galaxy clusters, Virgo represents the one with the highest flux. However, its large spatial extension can be a serious handicap for IACT observations and posterior data analysis. Yet, other local galaxy cluster candidates with more moderate emission regions, such as Perseus, may represent good alternatives. After comparing dwarfs and clusters, we found that the former exhibit annihilation flux profiles that, at the center, are roughly one order of magnitude higher than those of clusters, although galaxy clusters can yield similar, or even higher, integrated fluxes for the whole object once substructure is taken into account. Even when any of these objects are strictly point-like according to the properties of their annihilation signals, we conclude that dwarf galaxies are best suited for observational strategies based on the search of point-like sources, while galaxy clusters represent best targets for analyses that can deal with rather extended emissions. Finally, we study the detection prospects for present and future IACTs in the framework of the constrained minimal supersymmetric standard model. We

  10. Dark matter searches with Cherenkov telescopes: nearby dwarf galaxies or local galaxy clusters?

    International Nuclear Information System (INIS)

    In this paper, we compare dwarf galaxies and galaxy clusters in order to elucidate which object class is the best target for gamma-ray DM searches with imaging atmospheric Cherenkov telescopes (IACTs). We have built a mixed dwarfs+clusters sample containing some of the most promising nearby dwarf galaxies (Draco, Ursa Minor, Wilman 1 and Segue 1) and local galaxy clusters (Perseus, Coma, Ophiuchus, Virgo, Fornax, NGC 5813 and NGC 5846), and then compute their DM annihilation flux profiles by making use of the latest modeling of their DM density profiles. We also include in our calculations the effect of DM substructure. Willman 1 appears as the best candidate in the sample. However, its mass modeling is still rather uncertain, so probably other candidates with less uncertainties and quite similar fluxes, namely Ursa Minor and Segue 1, might be better options. As for galaxy clusters, Virgo represents the one with the highest flux. However, its large spatial extension can be a serious handicap for IACT observations and posterior data analysis. Yet, other local galaxy cluster candidates with more moderate emission regions, such as Perseus, may represent good alternatives. After comparing dwarfs and clusters, we found that the former exhibit annihilation flux profiles that, at the center, are roughly one order of magnitude higher than those of clusters, although galaxy clusters can yield similar, or even higher, integrated fluxes for the whole object once substructure is taken into account. Even when any of these objects are strictly point-like according to the properties of their annihilation signals, we conclude that dwarf galaxies are best suited for observational strategies based on the search of point-like sources, while galaxy clusters represent best targets for analyses that can deal with rather extended emissions. Finally, we study the detection prospects for present and future IACTs in the framework of the constrained minimal supersymmetric standard model. We

  11. Dark Matter Searches with Cherenkov Telescopes: Nearby Dwarf Galaxies or Local Galaxy Clusters?

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez-Conde, Miguel A.; /KIPAC, Menlo Park /SLAC /IAC, La Laguna /Laguna U., Tenerife; Cannoni, Mirco; /Huelva U.; Zandanel, Fabio; /IAA, Granada; Gomez, Mario E.; /Huelva U.; Prada, Francisco; /IAA, Granada

    2012-06-06

    In this paper, we compare dwarf galaxies and galaxy clusters in order to elucidate which object class is the best target for gamma-ray DM searches with imaging atmospheric Cherenkov telescopes (IACTs). We have built a mixed dwarfs+clusters sample containing some of the most promising nearby dwarf galaxies (Draco, Ursa Minor, Wilman 1 and Segue 1) and local galaxy clusters (Perseus, Coma, Ophiuchus, Virgo, Fornax, NGC 5813 and NGC 5846), and then compute their DM annihilation flux profiles by making use of the latest modeling of their DM density profiles. We also include in our calculations the effect of DM substructure. Willman 1 appears as the best candidate in the sample. However, its mass modeling is still rather uncertain, so probably other candidates with less uncertainties and quite similar fluxes, namely Ursa Minor and Segue 1, might be better options. As for galaxy clusters, Virgo represents the one with the highest flux. However, its large spatial extension can be a serious handicap for IACT observations and posterior data analysis. Yet, other local galaxy cluster candidates with more moderate emission regions, such as Perseus, may represent good alternatives. After comparing dwarfs and clusters, we found that the former exhibit annihilation flux profiles that, at the center, are roughly one order of magnitude higher than those of clusters, although galaxy clusters can yield similar, or even higher, integrated fluxes for the whole object once substructure is taken into account. Even when any of these objects are strictly point-like according to the properties of their annihilation signals, we conclude that dwarf galaxies are best suited for observational strategies based on the search of point-like sources, while galaxy clusters represent best targets for analyses that can deal with rather extended emissions. Finally, we study the detection prospects for present and future IACTs in the framework of the constrained minimal supersymmetric standard model. We

  12. Globular Cluster Formation in the Virgo Cluster

    CERN Document Server

    Moran, C Corbett; Lake, G

    2014-01-01

    Metal poor globular clusters (MPGCs) are a unique probe of the early universe, in particular the reionization era. Systems of globular clusters in galaxy clusters are particularly interesting as it is in the progenitors of galaxy clusters that the earliest reionizing sources first formed. Although the exact physical origin of globular clusters is still debated, it is generally admitted that globular clusters form in early, rare dark matter peaks (Moore et al. 2006; Boley et al. 2009). We provide a fully numerical analysis of the Virgo cluster globular cluster system by identifying the present day globular cluster system with exactly such early, rare dark matter peaks. A popular hypothesis is that that the observed truncation of blue metal poor globular cluster formation is due to reionization (Spitler et al. 2012; Boley et al. 2009; Brodie & Strader 2006); adopting this view, constraining the formation epoch of MPGCs provides a complementary constraint on the epoch of reionization. By analyzing both the l...

  13. Spectroelectrochemical and cyclic voltamperometry of trigonal cluster of ruthenium acetate with pirazine in aqueous solution

    International Nuclear Information System (INIS)

    The electrochemical and spectroelectrochemical behavior of the trinuclear μ - oxo - cluster [Ru3O (Ac)6 (pirazine)3] in aqueous solution is reported. The reductive potential of the clusters and energy from transfer of charge metal-ligand are analysed. (M.J.C.)

  14. Chemical composition and constraints on mass loss for globular clusters in dwarf galaxies: WLM and IKN

    CERN Document Server

    Larsen, S S; Forbes, D A; Strader, J

    2014-01-01

    We determine the metallicities for globular clusters (GCs) in the WLM and IKN dwarf galaxies, using VLT/UVES and Keck/ESI spectroscopy. For the WLM GC we also measure detailed abundance ratios for a number of light, alpha, Fe-peak and n-capture elements. We find low metallicities of [Fe/H]=-2.0 and -2.1 for the WLM GC and the GC IKN-5, respectively. We estimate that 17%-31% of the metal-poor stars in WLM belong to the GC, and IKN-5 may even contain a similar number of metal-poor stars as the whole of the IKN dwarf itself. These high ratios of metal-poor GCs to field stars are in tension with GC formation scenarios that require GCs to have lost a very large fraction of their initial mass. The GCs in the WLM and IKN dwarf galaxies resemble those in the Fornax dSph by being significantly more metal-poor than a typical halo GC in the Milky Way and other large galaxies. They are also substantially more metal-poor than the bulk of the field stars in their parent galaxies. The overall abundance patterns in the WLM G...

  15. Titanium-oxo cluster with 9-anthracenecarboxylate antennae: a fluorescent and photocurrent transfer material.

    Science.gov (United States)

    Wu, Yin-Yin; Lu, Xiao-Wen; Qi, Miao; Su, Hu-Chao; Zhao, Xiao-Wei; Zhu, Qin-Yu; Dai, Jie

    2014-07-21

    Attention has been paid to titanium-oxo clusters (TOCs) modified with functional molecules, because they can be considered as model systems for dye-sensitized titanium oxides in terms of their information in structures and electron transfer. We select 9-anthracenecarboxylate (9-AC) as a photoactive ligand and prepare two model compounds, [Ti6O6(O(i)Pr)6(9-AC)6] (1) and [Ti6O4(O(i)Pr)6(cat)4(9-AC)2] (2) (where cat = catecholate). Structures of the TOCs and the dye-TOC linkage are characterized by single-crystal analysis. Solvent-induced fluorescence change is observed for the cluster solution, and the fluorescence can be turned off by irradiating and on by oxygen bubbling. Photoinduced Ti(III) is responsible for the fluorescence extinction. The photocurrent conversion property of the clusters is examined by use of a three-electrode cell with cluster-coated indium tin oxide (ITO) electrodes. The results indicate that 9-AC is an effective photosensitizer and cluster 1 shows higher photocurrent intensity for its multiantenna structure in comparison with that of 2. Density of states for cluster 1 is calculated, in which the discrete energy bands of Ti6O24 include a number of new energy levels for the contribution of 9-AC molecules.

  16. Characterization of AcMNPV with a deletion of ac69 gene

    Directory of Open Access Journals (Sweden)

    Jianhao Ke

    2011-07-01

    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  17. BioCluster:Tool for Identification and Clustering of Enterobacteriaceae Based on Biochemical Data

    Institute of Scientific and Technical Information of China (English)

    Ahmed Abdullah; S.M.Sabbir Alam; Munawar Sultana; M.Anwar Hossain

    2015-01-01

    Presumptive identification of different Enterobacteriaceae species is routinely achieved based on biochemical properties. Traditional practice includes manual comparison of each biochem-ical property of the unknown sample with known reference samples and inference of its identity based on the maximum similarity pattern with the known samples. This process is labor-intensive, time-consuming, error-prone, and subjective. Therefore, automation of sorting and sim-ilarity in calculation would be advantageous. Here we present a MATLAB-based graphical user interface (GUI) tool named BioCluster. This tool was designed for automated clustering and iden-tification of Enterobacteriaceae based on biochemical test results. In this tool, we used two types of algorithms, i.e., traditional hierarchical clustering (HC) and the Improved Hierarchical Clustering (IHC), a modified algorithm that was developed specifically for the clustering and identification of Enterobacteriaceae species. IHC takes into account the variability in result of 1–47 biochemical tests within this Enterobacteriaceae family. This tool also provides different options to optimize the clus-tering in a user-friendly way. Using computer-generated synthetic data and some real data, we have demonstrated that BioCluster has high accuracy in clustering and identifying enterobacterial species based on biochemical test data. This tool can be freely downloaded at http://microbialgen.du.ac.bd/biocluster/.

  18. Memory Convergence and Optimization with Fuzzy PSO and ACS

    Directory of Open Access Journals (Sweden)

    Subhash C. Pandey

    2008-01-01

    Full Text Available Associative neural memories are models of biological phenomena that allow for the storage of pattern associations and the retrieval of the desired output pattern upon presentation of a possibly noisy or incomplete version of an input pattern. In this study, we introduce fuzzy swarm particle optimization technique for convergence of associative neural memories based on fuzzy set theory. A Fuzzy Particle Swarm Optimization (FPSO consists of clustering of swarm's particle by applying fuzzy c-mean algorithm to attain the neighborhood best. We present a singular value decomposition method for the selection of efficient rule from a given rule base required to attain the global best. Finally, we illustrate the proposed method by virtue of some examples. Further, ant colony system ACS algorithm is used to study the Symmetric Traveling Salesman Problem TSP. The optimum parameters for this algorithm have to found by trial and error. The ACS parameters working in a designed subset of TSP instances has also been optimized by virtue of Particle Swarm Optimization PSO.

  19. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  20. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.;

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  1. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  2. Cluster Decline and Resilience

    DEFF Research Database (Denmark)

    Østergaard, Christian Richter; Park, Eun Kyung

    Most studies on regional clusters focus on identifying factors and processes that make clusters grow. However, sometimes technologies and market conditions suddenly shift, and clusters decline. This paper analyses the process of decline of the wireless communication cluster in Denmark, 1963...... in new resources to the cluster but being quick to withdraw in times of crisis....

  3. Applying Machine Learning to Star Cluster Classification

    Science.gov (United States)

    Fedorenko, Kristina; Grasha, Kathryn; Calzetti, Daniela; Mahadevan, Sridhar

    2016-01-01

    Catalogs describing populations of star clusters are essential in investigating a range of important issues, from star formation to galaxy evolution. Star cluster catalogs are typically created in a two-step process: in the first step, a catalog of sources is automatically produced; in the second step, each of the extracted sources is visually inspected by 3-to-5 human classifiers and assigned a category. Classification by humans is labor-intensive and time consuming, thus it creates a bottleneck, and substantially slows down progress in star cluster research.We seek to automate the process of labeling star clusters (the second step) through applying supervised machine learning techniques. This will provide a fast, objective, and reproducible classification. Our data is HST (WFC3 and ACS) images of galaxies in the distance range of 3.5-12 Mpc, with a few thousand star clusters already classified by humans as a part of the LEGUS (Legacy ExtraGalactic UV Survey) project. The classification is based on 4 labels (Class 1 - symmetric, compact cluster; Class 2 - concentrated object with some degree of asymmetry; Class 3 - multiple peak system, diffuse; and Class 4 - spurious detection). We start by looking at basic machine learning methods such as decision trees. We then proceed to evaluate performance of more advanced techniques, focusing on convolutional neural networks and other Deep Learning methods. We analyze the results, and suggest several directions for further improvement.

  4. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    OpenAIRE

    Marian GAICEANU; Emil ROSU

    2003-01-01

    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  5. Star Clusters in Pseudo-Bulges of Spiral Galaxies

    CERN Document Server

    Di Nino, Daiana; Stiavelli, Massimo; Carollo, C Marcella; Scarlata, Claudia; Wyse, Rosemary F G

    2009-01-01

    We present a study of the properties of the star-cluster systems around pseudo-bulges of late-type spiral galaxies using a sample of 11 galaxies with distances from 17 to 37 Mpc. Star clusters are identified from multiband HST ACS and WFPC2 imaging data by combining detections in 3 bands (F435W and F814W with ACS and F606W with WFPC2). The photometric data are then compared to population synthesis models to infer the masses and ages of the star clusters. Photometric errors and completeness are estimated by means of artificial source Monte Carlo simulations. Dust extinction is estimated by considering F160W NICMOS observations of the central regions of the galaxies, augmenting our wavelength coverage. In all galaxies we identify star clusters with a wide range of ages, from young (age 100-250 Myr), more massive, red clusters. Some of the latter might likely evolve into objects similar to the Milky Way's globular clusters. We compute the specific frequencies for the older clusters with respect to the galaxy an...

  6. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  7. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  8. 21 CFR 888.1240 - AC-powered dynamometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  9. 21 CFR 886.1630 - AC-powered photostimulator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  10. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... COMMISSION ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission (``Commission...''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b)(2) of the..., owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  11. Partitional clustering algorithms

    CERN Document Server

    2015-01-01

    This book summarizes the state-of-the-art in partitional clustering. Clustering, the unsupervised classification of patterns into groups, is one of the most important tasks in exploratory data analysis. Primary goals of clustering include gaining insight into, classifying, and compressing data. Clustering has a long and rich history that spans a variety of scientific disciplines including anthropology, biology, medicine, psychology, statistics, mathematics, engineering, and computer science. As a result, numerous clustering algorithms have been proposed since the early 1950s. Among these algorithms, partitional (nonhierarchical) ones have found many applications, especially in engineering and computer science. This book provides coverage of consensus clustering, constrained clustering, large scale and/or high dimensional clustering, cluster validity, cluster visualization, and applications of clustering. Examines clustering as it applies to large and/or high-dimensional data sets commonly encountered in reali...

  12. Modernization typologies industrial clusters

    Directory of Open Access Journals (Sweden)

    Karapetian, Eduard

    2011-11-01

    Full Text Available Generalized theoretical approach to the criteria of industrial clusters. On this basis, a detailed typology of industrial cluster structures, which takes into account the peculiarities of the functioning of clusters in the domestic economy.

  13. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  14. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  15. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  16. Cyclotron and linac production of Ac-225.

    Science.gov (United States)

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  17. Factorial PD-Clustering

    CERN Document Server

    Tortora, Cristina; Summa, Mireille Gettler

    2011-01-01

    Factorial clustering methods have been developed in recent years thanks to the improving of computational power. These methods perform a linear transformation of data and a clustering on transformed data optimizing a common criterion. Factorial PD-clustering is based on Probabilistic Distance clustering (PD-clustering). PD-clustering is an iterative, distribution free, probabilistic, clustering method. Factorial PD-clustering make a linear transformation of original variables into a reduced number of orthogonal ones using a common criterion with PD-Clustering. It is demonstrated that Tucker 3 decomposition allows to obtain this transformation. Factorial PD-clustering makes alternatively a Tucker 3 decomposition and a PD-clustering on transformed data until convergence. This method could significantly improve the algorithm performance and allows to work with large dataset, to improve the stability and the robustness of the method.

  18. Possibilistic Exponential Fuzzy Clustering

    Institute of Scientific and Technical Information of China (English)

    Kiatichai Treerattanapitak; Chuleerat Jaruskulchai

    2013-01-01

    Generally,abnormal points (noise and outliers) cause cluster analysis to produce low accuracy especially in fuzzy clustering.These data not only stay in clusters but also deviate the centroids from their true positions.Traditional fuzzy clustering like Fuzzy C-Means (FCM) always assigns data to all clusters which is not reasonable in some circumstances.By reformulating objective function in exponential equation,the algorithm aggressively selects data into the clusters.However noisy data and outliers cannot be properly handled by clustering process therefore they are forced to be included in a cluster because of a general probabilistic constraint that the sum of the membership degrees across all clusters is one.In order to improve this weakness,possibilistic approach relaxes this condition to improve membership assignment.Nevertheless,possibilistic clustering algorithms generally suffer from coincident clusters because their membership equations ignore the distance to other clusters.Although there are some possibilistic clustering approaches that do not generate coincident clusters,most of them require the right combination of multiple parameters for the algorithms to work.In this paper,we theoretically study Possibilistic Exponential Fuzzy Clustering (PXFCM) that integrates possibilistic approach with exponential fuzzy clustering.PXFCM has only one parameter and not only partitions the data but also filters noisy data or detects them as outliers.The comprehensive experiments show that PXFCM produces high accuracy in both clustering results and outlier detection without generating coincident problems.

  19. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    Institute of Scientific and Technical Information of China (English)

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  20. Inception of Acetic Acid/Water Cluster Growth in Molecular Beams.

    Science.gov (United States)

    Bende, Attila; Perretta, Giuseppe; Sementa, Paolo; Di Palma, Tonia M

    2015-10-01

    The influence of carboxylic acids on water nucleation in the gas phase has been explored in the supersonic expansion of water vapour mixed with acetic acid (AcA) at various concentrations. The sodium-doping method has been used to detect clusters produced in supersonic expansions by using UV photoionisation. The mass spectra obtained at lower acid concentrations show well-detected Na(+) -AcA(H2O)n and Na(+)-AcA2 (H2O)n clusters up to 200 Da and, in the best cooling expansions, emerging Na(+)-AcAm (H2O)n signals at higher masses and unresolved signals that extend beyond m/e values >1000 Da. These signals, which increase with increasing acid content in water vapour, are an indication that the cluster growth taking place arises from mixed water-acid clusters. Theoretical calculations show that small acid-water clusters are stable and their formation is even thermodynamically favoured with respect to pure water clusters, especially at lower temperatures. These findings suggest that acetic acid may play a significant role as a pre-nucleation embryo in the formation of aerosols in wet environments. PMID:26296812

  1. Management of cluster headache

    DEFF Research Database (Denmark)

    Tfelt-Hansen, Peer C; Jensen, Rigmor H

    2012-01-01

    and agitation. Patients may have up to eight attacks per day. Episodic cluster headache (ECH) occurs in clusters of weeks to months duration, whereas chronic cluster headache (CCH) attacks occur for more than 1 year without remissions. Management of cluster headache is divided into acute attack treatment...

  2. Structures of Mn clusters

    Indian Academy of Sciences (India)

    Tina M Briere; Marcel H F Sluiter; Vijay Kumar; Yoshiyuki Kawazoe

    2003-01-01

    The geometries of several Mn clusters in the size range Mn13–Mn23 are studied via the generalized gradient approximation to density functional theory. For the 13- and 19-atom clusters, the icosahedral structures are found to be most stable, while for the 15-atom cluster, the bcc structure is more favoured. The clusters show ferrimagnetic spin configurations.

  3. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede;

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  4. The ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  5. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  6. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles

    Directory of Open Access Journals (Sweden)

    Tainá CC Monte

    2014-12-01

    Full Text Available Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. : ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1, but the same was not observed for ac8 (1.2:1. The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male and distance from the anus to the rear end (female compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  7. Graded cluster algebras

    OpenAIRE

    Grabowski, Jan

    2015-01-01

    In the cluster algebra literature, the notion of a graded cluster algebra has been implicit since the origin of the subject. In this work, we wish to bring this aspect of cluster algebra theory to the foreground and promote its study. We transfer a definition of Gekhtman, Shapiro and Vainshtein to the algebraic setting, yielding the notion of a multi-graded cluster algebra. We then study gradings for finite type cluster algebras without coefficients, giving a full classification. Translating ...

  8. Two Populations of Young Massive Star Clusters in Arp 220

    CERN Document Server

    Wilson, C D; Longden, R; Scoville, N Z; Wilson, Christine D.; Harris, William E.; Longden, Rebecca

    2006-01-01

    We present new optical observations of young massive star clusters in Arp 220, the nearest ultraluminous infrared galaxy, taken in UBVI with the Hubble Space Telescope ACS/HRC camera. We find a total of 206 probable clusters whose spatial distribution is centrally concentrated toward the nucleus of Arp 220. We use model star cluster tracks to determine ages, luminosities, and masses for 14 clusters with complete UBVI indices or previously published near-infrared data. We estimate rough masses for 24 additional clusters with I < 24 mag from BVI indices alone. The clusters with useful ages fall into two distinct groups: a ``young'' population (< 10 Myr) and an intermediate-age population (~300 Myr). There are many clusters with masses clearly above 10^6 Msun and possibly even above 10^7 Msun in the most extreme instances. These masses are high enough that the clusters being formed in the Arp 220 starburst can be considered as genuine young globular clusters. In addition, this study allows us to extend the...

  9. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    Directory of Open Access Journals (Sweden)

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  10. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  11. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  12. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx. PMID:26672449

  13. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  14. A dry-cooled AC quantum voltmeter

    Science.gov (United States)

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.

    2016-10-01

    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  15. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  16. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...

  17. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez;

    2015-01-01

    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  18. AC loss in superconducting tapes and cables

    NARCIS (Netherlands)

    Oomen, Marijn Pieter

    2000-01-01

    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  19. Thermal Simulation of AC Electromagnetic Contactor

    Institute of Scientific and Technical Information of China (English)

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen

    2005-01-01

    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  20. 76 FR 65633 - RIN 1904-AC43

    Science.gov (United States)

    2011-10-24

    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  1. AC Losses of Prototype HTS Transmission Cables

    Energy Technology Data Exchange (ETDEWEB)

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.

    1998-09-13

    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  2. Ac-dc converter firing error detection

    International Nuclear Information System (INIS)

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  3. Kinematics and stellar populations of low-luminosity early-type galaxies in the Abell 496 cluster

    Science.gov (United States)

    Chilingarian, I. V.; Cayatte, V.; Durret, F.; Adami, C.; Balkowski, C.; Chemin, L.; Laganá, T. F.; Prugniel, P.

    2008-07-01

    Context: The morphology and stellar populations of low-luminosity early-type galaxies in clusters have until now been limited to a few relatively nearby clusters such as Virgo or Fornax. Scenarii for the formation and evolution of dwarf galaxies in clusters are therefore not well constrained. Aims: We investigate here the morphology and stellar populations of low-luminosity galaxies in the relaxed richness class 1 cluster Abell 496 (z = 0.0330). Methods: Deep multiband imaging obtained with the CFHT Megacam allowed us to select a sample of faint galaxies, defined here as objects with magnitudes 18 power R = 6300. We present structural analysis and colour maps for the 48 galaxies belonging to the cluster. We fit the spectra of 46 objects with PEGASE.HR synthetic spectra to estimate the ages, metallicities, and velocity dispersions. We estimated possible biases by similarly analysing spectra of ~1200 early-type galaxies from the Sloan Digital Sky Survey Data Release 6 (SDSS DR6). We computed values of α/Fe abundance ratios from the measurements of Lick indices. We briefly discuss effects of the fixed aperture size on the measurements. Results: For the first time, high-precision estimates of stellar population properties have been obtained for a large sample of faint galaxies in a cluster, allowing for the extension of relations between stellar populations and internal kinematics to the low-velocity dispersion regime. We have revealed a peculiar population of elliptical galaxies in the core of the cluster, resembling massive early-type galaxies by their stellar population properties and velocity dispersions, but having luminosities of about 2 mag fainter. Conclusions: External mechanisms of gas removal (ram pressure stripping and gravitational harassment) are more likely to have occurred than internal mechanisms such as supernova-driven winds. The violent tidal stripping of intermediate-luminosity, early-type galaxies in the cluster core can explain the properties of

  4. Electric properties of carbon nano-onion/polyaniline composites: a combined electric modulus and ac conductivity study

    Science.gov (United States)

    Papathanassiou, Anthony N.; Mykhailiv, Olena; Echegoyen, Luis; Sakellis, Ilias; Plonska-Brzezinska, Marta E.

    2016-07-01

    The complex electric modulus and the ac conductivity of carbon nano-onion/polyaniline composites were studied from 1 mHz to 1 MHz at isothermal conditions ranging from 15 K to room temperature. The temperature dependence of the electric modulus and the dc conductivity analyses indicate a couple of hopping mechanisms. The distinction between thermally activated processes and the determination of cross-over temperature were achieved by exploring the temperature dependence of the fractional exponent of the dispersive ac conductivity and the bifurcation of the scaled ac conductivity isotherms. The results are analyzed by combining the granular metal model (inter-grain charge tunneling of extended electron states located within mesoscopic highly conducting polyaniline grains) and a 3D Mott variable range hopping model (phonon assisted tunneling within the carbon nano-onions and clusters).

  5. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Directory of Open Access Journals (Sweden)

    Pawel Szczesniak

    2015-03-01

    Full Text Available In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two modelling techniques are applied to a same AC-AC converter called matrix-reactance frequency converter based on buck-boost topology. These techniques are compared on the basis of their rapidity, quantity of calculations and transformations and its limitations.

  6. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Directory of Open Access Journals (Sweden)

    J. G. Oliveira

    2012-01-01

    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  7. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  8. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Science.gov (United States)

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  9. HST/ACS Imaging of Omega Centauri: Optical Counterparts of Chandra X-Ray Sources

    CERN Document Server

    Cool, Adrienne M; Arias, Tersi; Brochmann, Michelle; Dorfman, Jason; Gafford, April; White, Vivian; Anderson, Jay

    2012-01-01

    We present results of a search for optical counterparts of X-ray sources in and toward the globular cluster Omega Centauri (NGC 5139) using the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope. The ACS data consist of a mosaic of Wide Field Channel (WFC) images obtained using F625W, F435W, and F658N filters; with 9 pointings we cover the central ~10'x10' of the cluster and encompass 109 known Chandra sources. We find promising optical counterparts for 59 of the sources, ~40 of which are likely to be associated with the cluster. These include 27 candidate cataclysmic variables (CVs), 24 of which are reported here for the first time. Fourteen of the CV candidates are very faint, with absolute magnitudes in the range M_625 = 10.4 - 12.6, making them comparable in brightness to field CVs near the period minimum discovered in the SDSS (Gansicke et al. 2009). Additional optical counterparts include three BY Dra candidates, a possible blue straggler, and a previously-reported quiescent low-mass X-ray ...

  10. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    OpenAIRE

    Sagar.S.Pawar; Prakash.T.Patil

    2015-01-01

    This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  11. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Directory of Open Access Journals (Sweden)

    Sagar. S. Pawar

    2015-04-01

    Full Text Available This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  12. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  13. A new class of hybrid AC/AC direct power converters

    OpenAIRE

    Klumpner, Christian; Wijekoon, Thiwanka; Wheeler, Patrick

    2005-01-01

    Variable voltage and variable frequency conversion of electrical energy from an AC source to an AC load is done in traditional power converters via a DC-link where an energy storage element (electrolytic capacitors) is situated. Despite its well-known benefits, it has the disadvantage of being bulky and to limit the converter lifetime. On the other hand, Direct Power Conversion (DPC) is an attractive concept, which doesn’t need an energy storage buffer, but has two main disadvantages: reduced...

  14. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    OpenAIRE

    Pawel Szczesniak

    2015-01-01

    In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two m...

  15. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  16. What Makes Clusters Decline?

    DEFF Research Database (Denmark)

    Østergaard, Christian Richter; Park, Eun Kyung

    2015-01-01

    Most studies on regional clusters focus on identifying factors and processes that make clusters grow. However, sometimes technologies and market conditions suddenly shift, and clusters decline. This paper analyses the process of decline of the wireless communication cluster in Denmark....... The longitudinal study on the high-tech cluster reveals that technological lock-in and exit of key firms have contributed to decline. Entrepreneurship has a positive effect on the cluster’s adaptive capabilities, while multinational companies have contradicting effects by bringing in new resources to the cluster...

  17. AC losses in a HTS coil carrying DC current in AC external magnetic field

    International Nuclear Information System (INIS)

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  18. Identifying Contaminated K-band Globular Cluster RR Lyrae Photometry

    CERN Document Server

    Majaess, Daniel J; Gieren, Wolfgang P

    2012-01-01

    Acquiring near-infrared K-band (2.2 um) photometry for RR Lyrae variables in globular clusters and nearby galaxies is advantageous since the resulting distances are less impacted by reddening and metallicity. However, K-band photometry for RR Lyrae variables in M5, Reticulum, M92, omega Cen, and M15 display clustercentric trends. HST ACS data imply that multiple stars in close proximity to RR Lyrae variables located near the cluster core, where the stellar density increases markedly, are generally unresolved in ground-based images. RR Lyrae variables near the cluster cores appear to suffer from photometric contamination, thereby yielding underestimated cluster distances and biased ages. The impact is particularly pernicious since the contamination propagates a systematic uncertainty into the distance scale, and hinders the quest for precision cosmology. The clustercentric trends are probably unassociated with variations in chemical composition since an empirical K-band period-magnitude relation inferred from ...

  19. Where is the matter in the Merging Cluster Abell 2218?

    OpenAIRE

    Elíasdóttir, Árdís; Limousin, Marceau; Richard, Johan,; Hjorth, Jens,; Kneib, Jean-Paul,; Natarajan, Priya; Pedersen, Kristian; Jullo, Eric; Paraficz, Danuta

    2007-01-01

    We present a parametric strong lensing model of the cluster Abell 2218 based on HST ACS data. We constrain the lens model using 8 previously known multiply imaged systems, of which 7 have spectroscopically confirmed redshifts. In addition, we propose five candidate multiply imaged systems and estimate their redshifts using our mass model. The model parameters are optimized in the source plane by a bayesian Monte Carlo Markov Chain as implemented in the the publicly available software Lenstool...

  20. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an...

  1. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  2. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area....

  3. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  4. Star clusters and associations

    International Nuclear Information System (INIS)

    All 33 papers presented at the symposium were inputted to INIS. They dealt with open clusters, globular clusters, stellar associations and moving groups, and local kinematics and galactic structures. (E.S.)

  5. Quantum tunnelling of magnetization in Mn12-ac studied by 55Mn NMR

    OpenAIRE

    Morello, A.; Bakharev, O. N.; Brom, H. B.; de Jongh, L.J.

    2002-01-01

    We present an ultra-low temperature study (down to T = 20 mK) of the nuclear spin-lattice relaxation (SLR) in the 55Mn nuclei of the molecular magnet Mn12-ac. The nuclear spins act as local probes for the electronic spin fluctuations, due to thermal excitations and to tunnelling events. In the quantum regime (below T = 0.75 K), the nuclear SLR becomes temperature-independent and is driven by fluctuations of the cluster's electronic spin due to the quantum tunnelling of magnetization in the gr...

  6. Carbon radioactivity of {sup 223}Ac and a search for nitrogen emission

    Energy Technology Data Exchange (ETDEWEB)

    Guglielmetti, A; Faccio, D; Bonetti, R [Istituto di Fisica Generale Applicata and INFN, Milano (Italy); Shishkin, S V; Tretyakova, S P [JINR, Dubna (Russian Federation); Dmitriev, S V; Ogloblin, A A; Pik-Pichak, G A [Kurchatov Institute, Moscow (Russian Federation); Meulen, N P van der; Steyn, G F; Walt, T N van der; Vermeulen, C; McGee, D [iThemba LABS, Somerset West 7129 (South Africa)], E-mail: Alessandra.Guglielmetti@mi.infn.it

    2008-05-15

    A very intense {sup 227}Pa source was produced in order to study the possible {sup 14}C and {sup 15}N spontaneous emission from {sup 223}Ac. After the irradiation of a hemispherical, highly efficient array of nuclear track detectors, about 350 Carbon events were found leading to a branching ratio with respect to alpha decay B = 3.2 10{sup -11}. Comparison with other {sup 14}C emitters allows the study of the influence of even-odd effects on cluster radioactivity.

  7. Controlled clustering of carboxylated SPIONs through polyethylenimine

    Energy Technology Data Exchange (ETDEWEB)

    Nesztor, Dániel; Bali, Krisztina; Tóth, Ildikó Y.; Szekeres, Márta; Tombácz, Etelka, E-mail: tombacz@chem.u-szeged.hu

    2015-04-15

    Clusters of magnetite nanoparticles (MNPs) were synthesized using poly(acrylic acid-co-maleic acid) coated MNPs (PAM@MNP) and branched polyethylenimine (PEI). Materials were characterized by potentiometric titration, zeta potential and dynamic light scattering (DLS) measurements. PEI and PAM@MNP are oppositely charged as characterized by zeta potential measurements (+8, −34 mV respectively) and titration (10.30 mmol −NH{sub 3}{sup +}/g PEI; 0.175 mmol −COO{sup −}/g PAM@MNP) at pH 6.5±0.2; therefore magnetic clusters are formed by electrostatic adhesion. Two different preparation methods and the effect of PEI and electrolyte (NaCl) concentration on the cluster formation was studied. Choosing an optimal concentration of PEI (charge ratio of PEI to PAM@MNP: 0.17) and electrolyte (10 mM), a concentrated (10 g MNP/L) product containing PEI–PAM@MNP nanoclusters with size of 165±10 nm was prepared. Its specific absorption rate (SAR) measured in AC magnetic field (110 kHz, 25 mT) is 12 W/g Fe. The clustered product is expected to have enhanced contrast efficiency in MRI. - Highlights: • SPION clusters of controlled size were prepared by means of electrostatic adhesion. • Nanocluster formation optimum was at 0.17 charge ratio of PEI to PAM@MNP. • Huge aggregates form at higher PEI to PAM@MNP charge ratio. • Higher ionic strength promotes the formation of clusters at lower PEI concentrations.

  8. Quantum Annealing for Clustering

    OpenAIRE

    Kurihara, Kenichi; Tanaka, Shu; Miyashita, Seiji

    2014-01-01

    This paper studies quantum annealing (QA) for clustering, which can be seen as an extension of simulated annealing (SA). We derive a QA algorithm for clustering and propose an annealing schedule, which is crucial in practice. Experiments show the proposed QA algorithm finds better clustering assignments than SA. Furthermore, QA is as easy as SA to implement.

  9. Emergence of regional clusters

    DEFF Research Database (Denmark)

    Dahl, Michael S.; Østergaard, Christian Richter; Dalum, Bent

    2010-01-01

    approach to analyse how successful early firms can lead to formation of clusters. Three key determinants are identified: (1) the geographical dimension of entrepreneurial activity, (2) spinoffs from successful firms and (3) new market opportunities. The chapter studies in great detail the evolution...... of the wireless communications cluster in Northern Denmark and compare it with the evolution of other clusters....

  10. The Durban Auto Cluster

    DEFF Research Database (Denmark)

    Lorentzen, Jochen; Robbins, Glen; Barnes, Justin

    2004-01-01

    The paper describes the formation of the Durban Auto Cluster in the context of trade liberalization. It argues that the improvement of operational competitiveness of firms in the cluster is prominently due to joint action. It tests this proposition by comparing the gains from cluster activities i...

  11. Cluster Physics with Merging Galaxy Clusters

    Directory of Open Access Journals (Sweden)

    Sandor M. Molnar

    2016-02-01

    Full Text Available Collisions between galaxy clusters provide a unique opportunity to study matter in a parameter space which cannot be explored in our laboratories on Earth. In the standard LCDM model, where the total density is dominated by the cosmological constant ($Lambda$ and the matter density by cold dark matter (CDM, structure formation is hierarchical, and clusters grow mostly by merging.Mergers of two massive clusters are the most energetic events in the universe after the Big Bang,hence they provide a unique laboratory to study cluster physics.The two main mass components in clusters behave differently during collisions:the dark matter is nearly collisionless, responding only to gravity, while the gas is subject to pressure forces and dissipation, and shocks and turbulenceare developed during collisions. In the present contribution we review the different methods used to derive the physical properties of merging clusters. Different physical processes leave their signatures on different wavelengths, thusour review is based on a multifrequency analysis. In principle, the best way to analyze multifrequency observations of merging clustersis to model them using N-body/HYDRO numerical simulations. We discuss the results of such detailed analyses.New high spatial and spectral resolution ground and space based telescopeswill come online in the near future. Motivated by these new opportunities,we briefly discuss methods which will be feasible in the near future in studying merging clusters.

  12. AC plasma anemometer—characteristics and design

    Science.gov (United States)

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram

    2015-08-01

    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  13. Entropy production in ac-calorimetry

    OpenAIRE

    Garden, Jean-Luc; Richard, Jacques

    2007-01-01

    In calorimetry and particularly in heat capacity measurements, different characteristic relaxation time constants may perturb the experiment which cannot be considered at thermodynamic equilibrium. In this case, thermodynamics of irreversible processes has to be taken into account and the calorimetric measurements must be considered as dynamic. In a temperature modulated experiment, such as ac-calorimetry, these non-equilibrium experiments give rise to the notion of frequency dependent comple...

  14. Cluster beam sources. Part 1. Methods of cluster beams generation

    Directory of Open Access Journals (Sweden)

    A.Ju. Karpenko

    2012-10-01

    Full Text Available The short review on cluster beams generation is proposed. The basic types of cluster sources are considered and the processes leading to cluster formation are analyzed. The parameters, that affects the work of cluster sources are presented.

  15. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  16. Dicty_cDB: FCL-AC08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC08 (Link to dictyBase) - - - Contig-U15080-1 FCL-AC08P ...(Link to Original site) FCL-AC08F 616 FCL-AC08Z 291 FCL-AC08P 907 - - Show FCL-AC08 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC08Q....Seq.d/ Representative seq. ID FCL-AC08P (Link to Original site) Representative DNA sequence >FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-...ignificant alignments: (bits) Value FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-AC/FCL-AC08Q.Seq.d/ 1322 0.0 SFA226 (S

  17. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    Institute of Scientific and Technical Information of China (English)

    万衡; 喻嬿; 黄道

    2002-01-01

    针对传统AC-DC-AC变换存在的缺陷,采用高频调制直接AC-AC变换技术,实现了两种不同结构的单相AC-AC直接变换器,对其特点和仿真结果进行了分析,并探讨了应用前景.

  18. Cluster analysis for applications

    CERN Document Server

    Anderberg, Michael R

    1973-01-01

    Cluster Analysis for Applications deals with methods and various applications of cluster analysis. Topics covered range from variables and scales to measures of association among variables and among data units. Conceptual problems in cluster analysis are discussed, along with hierarchical and non-hierarchical clustering methods. The necessary elements of data analysis, statistics, cluster analysis, and computer implementation are integrated vertically to cover the complete path from raw data to a finished analysis.Comprised of 10 chapters, this book begins with an introduction to the subject o

  19. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  20. Molecular biology of maize Ac/Ds elements: an overview.

    Science.gov (United States)

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard

    2013-01-01

    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  1. Clusters in nuclei

    CERN Document Server

    Beck, Christian

    Following the pioneering discovery of alpha clustering and of molecular resonances, the field of nuclear clustering is today one of those domains of heavy-ion nuclear physics that faces the greatest challenges, yet also contains the greatest opportunities. After many summer schools and workshops, in particular over the last decade, the community of nuclear molecular physicists has decided to collaborate in producing a comprehensive collection of lectures and tutorial reviews covering the field. This third volume follows the successful Lect. Notes Phys. 818 (Vol. 1) and 848 (Vol. 2), and comprises six extensive lectures covering the following topics:  - Gamma Rays and Molecular Structure - Faddeev Equation Approach for Three Cluster Nuclear Reactions - Tomography of the Cluster Structure of Light Nuclei Via Relativistic Dissociation - Clustering Effects Within the Dinuclear Model : From Light to Hyper-heavy Molecules in Dynamical Mean-field Approach - Clusterization in Ternary Fission - Clusters in Light N...

  2. Unconventional methods for clustering

    Science.gov (United States)

    Kotyrba, Martin

    2016-06-01

    Cluster analysis or clustering is a task of grouping a set of objects in such a way that objects in the same group (called a cluster) are more similar (in some sense or another) to each other than to those in other groups (clusters). It is the main task of exploratory data mining and a common technique for statistical data analysis used in many fields, including machine learning, pattern recognition, image analysis, information retrieval, and bioinformatics. The topic of this paper is one of the modern methods of clustering namely SOM (Self Organising Map). The paper describes the theory needed to understand the principle of clustering and descriptions of algorithm used with clustering in our experiments.

  3. Spatial cluster modelling

    CERN Document Server

    Lawson, Andrew B

    2002-01-01

    Research has generated a number of advances in methods for spatial cluster modelling in recent years, particularly in the area of Bayesian cluster modelling. Along with these advances has come an explosion of interest in the potential applications of this work, especially in epidemiology and genome research. In one integrated volume, this book reviews the state-of-the-art in spatial clustering and spatial cluster modelling, bringing together research and applications previously scattered throughout the literature. It begins with an overview of the field, then presents a series of chapters that illuminate the nature and purpose of cluster modelling within different application areas, including astrophysics, epidemiology, ecology, and imaging. The focus then shifts to methods, with discussions on point and object process modelling, perfect sampling of cluster processes, partitioning in space and space-time, spatial and spatio-temporal process modelling, nonparametric methods for clustering, and spatio-temporal ...

  4. Survey on Text Document Clustering

    OpenAIRE

    M.Thangamani; Dr.P.Thangaraj

    2010-01-01

    Document clustering is also referred as text clustering, and its concept is merely equal to data clustering. It is hardly difficult to find the selective information from an ‘N’number of series information, so that document clustering came into picture. Basically cluster means a group of similar data, document clustering means segregating the data into different groups of similar data. Clustering can be of mathematical, statistical or numerical domain. Clustering is a fundamental data analysi...

  5. Agricultural Clusters in the Netherlands

    NARCIS (Netherlands)

    Schouten, M.A.; Heijman, W.J.M.

    2012-01-01

    Michael Porter was the first to use the term cluster in an economic context. He introduced the term in The Competitive Advantage of Nations (1990). The term cluster is also known as business cluster, industry cluster, competitive cluster or Porterian cluster. This article aims at determining and mea

  6. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    Institute of Scientific and Technical Information of China (English)

    周振军; 李磊

    2011-01-01

    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  7. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2009-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled......-second average at its output, while simultaneously achieving inductive voltage boosting by shooting through either an appropriately selected inverter phase-leg or two phase-legs being commanded simultaneously. More interestingly, these performance features are achieved with no increase in the number...

  8. Realization of a Direct Soft Switching AC/AC Converter for Wireless Power Transfer Applications

    OpenAIRE

    Vuorsalo, Simo

    2015-01-01

    This thesis describes the design, realization and testing of a three-phase to one-phase direct AC/AC converter, also known as the matrix converter. The switching is using the soft-switching strategy which is also known in the literature as the Zero Current Switching strategy. To achieve ZCS, the circuit needs resonant behavior which is achieved by the transmitter primary side that is an LC circuit. This circuit acts as a tank circuit and the switching frequency is the resonant frequency of th...

  9. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    Directory of Open Access Journals (Sweden)

    S. Arumugam S. Ramareddy M. Sridhar

    2011-12-01

    Full Text Available This paper presents a novel soft-switching pulse width modulation (PWM utility frequency AC to high frequency (HF AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which includes HFAC power regulation ranges and actual efficiency characteristics based on zero voltage soft switching operation ranges.. The simulation circuits are models are developed and they are simulated using ORCAD.

  10. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2007-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... a low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper....

  11. Stellar Clusters in NGC 1313: Evidence for Infant Mortality

    CERN Document Server

    Pellerin, A; Harris, J; Calzetti, D; Pellerin, Anne; Meyer, Martin; Harris, Jason; Calzetti, Daniela

    2007-01-01

    We present evidence that infant mortality of stellar clusters is likely to be a major and very efficient process for the dissolution of young clusters in the spiral galaxy NGC 1313. Performing stellar PSF photometry on archival HST/ACS images of the galaxy, we find that a large fraction of early B-type stars are seen outside of star clusters and well spread within the galactic disk, consistent with the scenario of infant mortality. We also calculate the UV flux produced by the stars in and out the clusters and find that 75 to 90% of the UV flux in NGC 1313 is produced by stars outside the clusters. These results suggest that the infant mortality of star clusters is probably the underlying cause of the diffuse UV emission in starburst galaxies. Infant mortality would also explain the numerous B-type stars observed in the background field of our Galaxy as well. We exclude the possibility that unresolved low-mass star clusters and scaled OB associations might be the main source for the diffuse UV emission.

  12. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  13. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  14. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  15. An ac biased superconducting flux transformer

    International Nuclear Information System (INIS)

    The coupled motion of the vortex lattice of two electrically insulated, superimposed, superconducting thin films (primary and secondary) in a perpendicular magnetic field, is predicted to exhibit a Josephson-like behavior. For a dc applied current flowing in the primary film, the voltage difference between the time-averaged primary and secondary flux flow voltages obeys the equations of a resistively shunted junction model. If an ac current is superimposed on the dc current. Shapiro-type steps are predicted in the current-voltage characteristic. In contrast to the conventional Josephson effect, the voltage positions of these steps can be tuned by the applied magnetic field. (orig.)

  16. Mapa acústico parcial de Benetusser

    OpenAIRE

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental.

  17. The Hubble Space Telescope Cluster Supernova Survey: V. Improving the Dark Energy Constraints Above z>1 and Building an Early-Type-Hosted Supernova Sample

    CERN Document Server

    Suzuki, N; Lidman, C; Aldering, G; Amanullah, R; Barbary, K; Barrientos, L F; Botyanszki, J; Brodwin, M; Connolly, N; Dawson, K S; Dey, A; Doi, M; Donahue, M; Deustua, S; Eisenhardt, P; Ellingson, E; Faccioli, L; Fadeyev, V; Fakhouri, H K; Fruchter, A S; Gilbank, D G; Gladders, M D; Goldhaber, G; Gonzalez, A H; Goobar, A; Gude, A; Hattori, T; Hoekstra, H; Hsiao, E; Huang, X; Ihara, Y; Jee, M J; Johnston, D; Kashikawa, N; Koester, B; Konishi, K; Kowalski, M; Linder, E V; Lubin, L; Melbourne, J; Meyers, J; Morokuma, T; Munshi, F; Mullis, C; Oda, T; Panagia, N; Perlmutter, S; Postman, M; Pritchard, T; Rhodes, J; Ripoche, P; Rosati, P; Schlegel, D J; Spadafora, A; Stanford, S A; Stanishev, V; Stern, D; Strovink, M; Takanashi, N; Tokita, K; Wagner, M; Wang, L; Yasuda, N; Yee, H K C

    2011-01-01

    We present ACS, NICMOS, and Keck AO-assisted photometry of 20 Type Ia supernovae SNe Ia from the HST Cluster Supernova Survey. The SNe Ia were discovered over the redshift interval 0.623 1 SNe Ia. We describe how such a sample could be efficiently obtained by targeting cluster fields with WFC3 on HST.

  18. Clustering Categorical Data:A Cluster Ensemble Approach

    Institute of Scientific and Technical Information of China (English)

    He Zengyou(何增友); Xu Xiaofei; Deng Shengchun

    2003-01-01

    Clustering categorical data, an integral part of data mining,has attracted much attention recently. In this paper, the authors formally define the categorical data clustering problem as an optimization problem from the viewpoint of cluster ensemble, and apply cluster ensemble approach for clustering categorical data. Experimental results on real datasets show that better clustering accuracy can be obtained by comparing with existing categorical data clustering algorithms.

  19. Spatial Scan Statistic: Selecting clusters and generating elliptic clusters

    DEFF Research Database (Denmark)

    Christiansen, Lasse Engbo; Andersen, Jens Strodl

    2004-01-01

    The spatial scan statistic is widely used to search for clusters. This paper shows that the usually applied elimination of overlapping clusters to find secondary clusters is sensitive to smooth changes in the shape of the clusters. We present an algorithm for generation of set of confocal elliptic...... clusters. In addition, we propose a new way to present the information in a given set of clusters based on the significance of the clusters....

  20. Cosmology with cluster surveys

    Indian Academy of Sciences (India)

    Subhabrata Majumdar

    2004-10-01

    Surveys of clusters of galaxies provide us with a powerful probe of the density and nature of the dark energy. The red-shift distribution of detected clusters is highly sensitive to the dark energy equation of state parameter . Upcoming Sunyaev–Zel'dovich (SZ) surveys would provide us large yields of clusters to very high red-shifts. Self-calibration of cluster scaling relations, possible for such a huge sample, would be able to constrain systematic biases on mass estimators. Combining cluster red-shift abundance with limited mass follow-up and cluster mass power spectrum can then give constraints on , as well as on 8 and to a few per cents.

  1. CSR in Industrial Clusters

    DEFF Research Database (Denmark)

    Lund-Thomsen, Peter; Pillay, Renginee G.

    2012-01-01

    Purpose – The paper seeks to review the literature on CSR in industrial clusters in developing countries, identifying the main strengths, weaknesses, and gaps in this literature, pointing to future research directions and policy implications in the area of CSR and industrial cluster development...... in this field and their comments incorporated in the final version submitted to Corporate Governance. Findings – The article traces the origins of the debate on industrial clusters and CSR in developing countries back to the early 1990s when clusters began to be seen as an important vehicle for local economic...... development in the South. At the turn of the millennium the industrial cluster debate expanded as clusters were perceived as a potential source of poverty reduction, while their role in promoting CSR among small and medium-sized enterprises began to take shape from 2006 onwards. At present, there is still...

  2. Melting of sodium clusters

    CERN Document Server

    Reyes-Nava, J A; Beltran, M R; Michaelian, K

    2002-01-01

    Thermal stability properties and the melting-like transition of Na_n, n=13-147, clusters are studied through microcanonical molecular dynamics simulations. The metallic bonding in the sodium clusters is mimicked by a many-body Gupta potential based on the second moment approximation of a tight-binding Hamiltonian. The characteristics of the solid-to-liquid transition in the sodium clusters are analyzed by calculating physical quantities like caloric curves, heat capacities, and root-mean-square bond length fluctuations using simulation times of several nanoseconds. Distinct melting mechanisms are obtained for the sodium clusters in the size range investigated. The calculated melting temperatures show an irregular variation with the cluster size, in qualitative agreement with recent experimental results. However, the calculated melting point for the Na_55 cluster is about 40 % lower than the experimental value.

  3. Structures in Galaxy Clusters

    CERN Document Server

    Escalera, E; Girardi, M; Giuricin, G; Mardirossian, F; Mazure, A; Mezzetti, M

    1993-01-01

    The analysis of the presence of substructures in 16 well-sampled clusters of galaxies suggests a stimulating hypothesis: Clusters could be classified as unimodal or bimodal, on the basis of to the sub-clump distribution in the {\\em 3-D} space of positions and velocities. The dynamic study of these clusters shows that their fundamental characteristics, in particular the virial masses, are not severely biased by the presence of subclustering if the system considered is bound.

  4. Cluster Symmetries and Dynamics

    Directory of Open Access Journals (Sweden)

    Freer Martin

    2016-01-01

    Full Text Available Many light nuclei display behaviour that indicates that rather than behaving as an A-body systems, the protons and neutrons condense into clusters. The α-particle is the most obvious example of such clustering. This contribution examines the role of such α-clustering on the structure, symmetries and dynamics of the nuclei 8Be, 12C and 16O, recent experimental measurements and future perspectives.

  5. Clustering Techniques in Bioinformatics

    Directory of Open Access Journals (Sweden)

    Muhammad Ali Masood

    2015-01-01

    Full Text Available Dealing with data means to group information into a set of categories either in order to learn new artifacts or understand new domains. For this purpose researchers have always looked for the hidden patterns in data that can be defined and compared with other known notions based on the similarity or dissimilarity of their attributes according to well-defined rules. Data mining, having the tools of data classification and data clustering, is one of the most powerful techniques to deal with data in such a manner that it can help researchers identify the required information. As a step forward to address this challenge, experts have utilized clustering techniques as a mean of exploring hidden structure and patterns in underlying data. Improved stability, robustness and accuracy of unsupervised data classification in many fields including pattern recognition, machine learning, information retrieval, image analysis and bioinformatics, clustering has proven itself as a reliable tool. To identify the clusters in datasets algorithm are utilized to partition data set into several groups based on the similarity within a group. There is no specific clustering algorithm, but various algorithms are utilized based on domain of data that constitutes a cluster and the level of efficiency required. Clustering techniques are categorized based upon different approaches. This paper is a survey of few clustering techniques out of many in data mining. For the purpose five of the most common clustering techniques out of many have been discussed. The clustering techniques which have been surveyed are: K-medoids, K-means, Fuzzy C-means, Density-Based Spatial Clustering of Applications with Noise (DBSCAN and Self-Organizing Map (SOM clustering.

  6. 15th Cluster workshop

    CERN Document Server

    Laakso, Harri; Escoubet, C. Philippe; The Cluster Active Archive : Studying the Earth’s Space Plasma Environment

    2010-01-01

    Since the year 2000 the ESA Cluster mission has been investigating the small-scale structures and processes of the Earth's plasma environment, such as those involved in the interaction between the solar wind and the magnetospheric plasma, in global magnetotail dynamics, in cross-tail currents, and in the formation and dynamics of the neutral line and of plasmoids. This book contains presentations made at the 15th Cluster workshop held in March 2008. It also presents several articles about the Cluster Active Archive and its datasets, a few overview papers on the Cluster mission, and articles reporting on scientific findings on the solar wind, the magnetosheath, the magnetopause and the magnetotail.

  7. Management of cluster headache.

    Science.gov (United States)

    Tfelt-Hansen, Peer C; Jensen, Rigmor H

    2012-07-01

    The prevalence of cluster headache is 0.1% and cluster headache is often not diagnosed or misdiagnosed as migraine or sinusitis. In cluster headache there is often a considerable diagnostic delay - an average of 7 years in a population-based survey. Cluster headache is characterized by very severe or severe orbital or periorbital pain with a duration of 15-180 minutes. The cluster headache attacks are accompanied by characteristic associated unilateral symptoms such as tearing, nasal congestion and/or rhinorrhoea, eyelid oedema, miosis and/or ptosis. In addition, there is a sense of restlessness and agitation. Patients may have up to eight attacks per day. Episodic cluster headache (ECH) occurs in clusters of weeks to months duration, whereas chronic cluster headache (CCH) attacks occur for more than 1 year without remissions. Management of cluster headache is divided into acute attack treatment and prophylactic treatment. In ECH and CCH the attacks can be treated with oxygen (12 L/min) or subcutaneous sumatriptan 6 mg. For both oxygen and sumatriptan there are two randomized, placebo-controlled trials demonstrating efficacy. In both ECH and CCH, verapamil is the prophylactic drug of choice. Verapamil 360 mg/day was found to be superior to placebo in one clinical trial. In clinical practice, daily doses of 480-720 mg are mostly used. Thus, the dose of verapamil used in cluster headache treatment may be double the dose used in cardiology, and with the higher doses the PR interval should be checked with an ECG. At the start of a cluster, transitional preventive treatment such as corticosteroids or greater occipital nerve blockade can be given. In CCH and in long-standing clusters of ECH, lithium, methysergide, topiramate, valproic acid and ergotamine tartrate can be used as add-on prophylactic treatment. In drug-resistant CCH, neuromodulation with either occipital nerve stimulation or deep brain stimulation of the hypothalamus is an alternative treatment strategy

  8. POWER FACTOR IMPROVEMENT IN THREE PHASE AC-AC CONVERTER THROUGH MODIFIED SPWM

    Directory of Open Access Journals (Sweden)

    P.VASUKI,

    2011-02-01

    Full Text Available Recently, a new generation of ac-ac single-phase and three-phase power converters with more commutations per half cycle has been proposed for ac power due to the increasing availability and power capability of high frequency controlled-on and off power emiconductor switching devices. This paper presents three phase ac-acconverter whose control strategy is based on modified sinusoidal ulse-width modulation switching technique. As majority of the industrial loads are being inductive, the power factor is less. To improve the power factor, the delayed current is shifted to the input voltage, through a modification of the classical sinusoidal pulse width modulation switching technique. In this way, the decrease in the phase angle between the input current and voltage is feasible, and consequently, high cost compensation capacitors can be avoided. The improvement of power factor through this switching technique on the proposed converter is investigated and verified via simulation using the software Matlab/Simulink.

  9. Carbon in Red Giants in Globular Clusters and Dwarf Spheroidal Galaxies

    Science.gov (United States)

    Kirby, Evan N.; Guo, Michelle; Zhang, Andrew J.; Deng, Michelle; Cohen, Judith G.; Guhathakurta, Puragra; Shetrone, Matthew D.; Lee, Young Sun; Rizzi, Luca

    2015-03-01

    We present carbon abundances of red giants in Milky Way (MW) globular clusters and dwarf spheroidal galaxies (dSphs). Our sample includes measurements of carbon abundances for 154 giants in the clusters NGC 2419, M68, and M15 and 398 giants in the dSphs Sculptor, Fornax, Ursa Minor, and Draco. This sample doubles the number of dSph stars with measurements of [C/Fe]. The [C/Fe] ratio in the clusters decreases with increasing luminosity above log (L/{{L}})≃ 1.6, which can be explained by deep mixing in evolved giants. The same decrease is observed in dSphs, but the initial [C/Fe] of the dSph giants is not uniform. Stars in dSphs at lower metallicities have larger [C/Fe] ratios. We hypothesize that [C/Fe] (corrected to the initial carbon abundance) declines with increasing [Fe/H] due to the metallicity dependence of the carbon yield of asymptotic giant branch stars and due to the increasing importance of SNe Ia at higher metallicities. We also identified 11 very carbon-rich giants (eight previously known) in three dSphs. However, our selection biases preclude a detailed comparison to the carbon-enhanced fraction of the MW stellar halo. Nonetheless, the stars with [C/Fe]\\lt +1 in dSphs follow a different [C/Fe] track with [Fe/H] than the halo stars. Specifically, [C/Fe] in dSphs begins to decline at lower [Fe/H] than in the halo. The difference in the metallicity of the [C/Fe] “knee” adds to the evidence from [α/Fe] distributions that the progenitors of the halo had a shorter timescale for chemical enrichment than the surviving dSphs. The data presented herein were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation.

  10. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  11. Levantamiento del campo acústico de una fuente sonora subacuática en el tanque hidroacústico del Instituto de Acústica

    OpenAIRE

    Ranz Guerra, Carlos; Cobo, Pedro

    2000-01-01

    6 pp.-- PACS nrs.: 43.30.Jx, 43.30.Sf.-- Comunicación presentada en los siguientes congresos: Acústica 2000, II Congreso Iberoamericano de Acústica. XXXI Congreso Nacional de Acústica: TecniAcústica 2000. II Congreso Ibérico de Acústica. II Jornadas Iberoamericanas de Acústica. EAA Symposium on Architectural Acoustics.

  12. Document Clustering Based on Semi-Supervised Term Clustering

    Directory of Open Access Journals (Sweden)

    Hamid Mahmoodi

    2012-05-01

    Full Text Available The study is conducted to propose a multi-step feature (term selection process and in semi-supervised fashion, provide initial centers for term clusters. Then utilize the fuzzy c-means (FCM clustering algorithm for clustering terms. Finally assign each of documents to closest associated term clusters. While most text clustering algorithms directly use documents for clustering, we propose to first group the terms using FCM algorithm and then cluster documents based on terms clusters. We evaluate effectiveness of our technique on several standard text collections and compare our results with the some classical text clustering algorithms.

  13. Dicty_cDB: FCL-AC03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC03 (Link to dictyBase) - - - Contig-U16477-1 FCL-AC03P ...(Link to Original site) FCL-AC03F 538 FCL-AC03Z 570 FCL-AC03P 1108 - - Show FCL-AC03 Library FCL (Link to library) Clone ID FCL-...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC03Q....Seq.d/ Representative seq. ID FCL-AC03P (Link to Original site) Representative DNA sequence >FCL-AC03 (FCL-AC03Q) /CSM/FCL/FCL-...AC/FCL-AC03Q.Seq.d/ AATTTTTAAAAAAAAAAGAAAATAAAAAAAAAAATAATATTTTATTAGTCATTATAAAAT TGTGAAT

  14. Dicty_cDB: FCL-AC20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC20 (Link to dictyBase) - - - Contig-U15117-1 FCL-AC20Z ...(Link to Original site) - - FCL-AC20Z 600 - - - - Show FCL-AC20 Library FCL (Link to library) Clone ID FCL-A... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC20Q.Seq.d/ Representative seq. ID FCL-...AC20Z (Link to Original site) Representative DNA sequence >FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-

  15. Hierarchically Clustered Star Formation in the Magellanic Clouds

    CERN Document Server

    Gouliermis, Dimitrios A; Ossenkopf, Volker; Klessen, Ralf S; Dolphin, Andrew E

    2012-01-01

    We present a cluster analysis of the bright main-sequence and faint pre--main-sequence stellar populations of a field ~ 90 x 90 pc centered on the HII region NGC 346/N66 in the Small Magellanic Cloud, from imaging with HST/ACS. We extend our earlier analysis on the stellar cluster population in the region to characterize the structuring behavior of young stars in the region as a whole with the use of stellar density maps interpreted through techniques designed for the study of the ISM structuring. In particular, we demonstrate with Cartwrigth & Whitworth's Q parameter, dendrograms, and the Delta-variance wavelet transform technique that the young stellar populations in the region NGC 346/N66 are hierarchically clustered, in agreement with other regions in the Magellanic Clouds observed with HST. The origin of this hierarchy is currently under investigation.

  16. Power flow control of intertied ac microgrids

    DEFF Research Database (Denmark)

    Nutkani, Inam Ullah; Loh, Poh Chiang; Blaabjerg, Frede

    2013-01-01

    Microgrids are small reliable grids formed by clustering distributed sources and loads together. They can, in principle, operate at different voltages and frequencies like 50, 60, 400 Hz or even dc. Tying them together or to the mains grid for energy sharing would therefore require the insertion ...

  17. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi;

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...

  18. Estudio acústico del Conservatorio de Piles

    OpenAIRE

    VILLA MORANT, SARA

    2014-01-01

    El objetivo de este proyecto es realizar un estudio acústico general de la "Casa de la Cultura" de Piles, sobre todo de los recintos que más lo requieren, como la sala principal de música. El edificio, al tratarse de una construcción antigua, no reúne las especificaciones acústicas establecidas en el Código Técnico vigente en la actualidad. En primer lugar, se realiza el estudio del acondicionamiento acústico de la sala principal, entendiéndose como acondicionamiento acústico la definición de...

  19. Control of high-frequency AC link electronic transformer

    OpenAIRE

    Krishnaswami, H; Ramanarayanan, V.

    2005-01-01

    An isolated high-frequency link AC/AC converter is termed an electronic transformer.The electronic transformer has size and cost advantages over a conventional transformer because of high-frequency operation of the magnetic core. Of the various topologies of electronic transformer, the high-frequency AC link electronic transformer achieves high-frequency AC power transformation without a DC link. The circuit uses the standard H-bridge, one on either side of the high-frequency transformer. A n...

  20. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  1. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  2. Effects of Fe doping on ac susceptibility of Pr0.75Na0.25MnO3

    Institute of Scientific and Technical Information of China (English)

    Li Yu; Cheng Qian; Qi Da-Wei; Wang Ji-Liang; Zhang Jing; Wang Shuang; Guan Jing

    2011-01-01

    Ac susceptibility at low temperatures of Pr0.75Na0.25Mn1-xFexO3 (0 ≤ x ≤ 0.30) is investigated.The peak value of the real component of ac susceptibility x′ at the freezing temperature Tf is suppressed with the increasing frequency.The peak value of x′ shows a linear relation between Tf and the logarithm of the frequency ω.The normalized slope P =ΔTf/TfΔlgω,which is much lower than canonical insulating spin glass systems in which 0.06 ≤ P ≤ 0.08.The peak value of the imaginary component of the ac susceptibility x″ at Tf for the x =0,0.02,0.30 samples increases with increasing frequency,suggesting a cluster glass ground state with a coexistence of charge-ordered phase and correlated ferromagnetic clusters in spin glass matrix.The peak value of x″ at Tf for the x =0.10 sample decreases with increasing frequency,suggesting a phase separation ground state.The peak value of x″ at Tf for the x =0.05 sample decreases with increasing frequency for ω ≤ 52 Hz and increases subsequently till 701 Hz,and then decreases with further increasing frequency for ω ≥ 1501 Hz.This complex behaviour is ascribed to the competition between the effects of large and little ferromagnetic clusters in the sample.The ground state of x =0.05 sample is a transition state from cluster glass to phase separation.

  3. From collisions to clusters

    DEFF Research Database (Denmark)

    Loukonen, Ville; Bork, Nicolai; Vehkamaki, Hanna

    2014-01-01

    to overcome the possible initial non-optimal collision orientations. No post-collisional cluster break up is observed. The reasons for the efficient clustering are (i) the proton transfer reaction which takes place in each of the collision simulations and (ii) the subsequent competition over the proton...

  4. Cost-Effective Clustering

    CERN Document Server

    Gottlieb, S

    2001-01-01

    Small Beowulf clusters can effectively serve as personal or group supercomputers. In such an environment, a cluster can be optimally designed for a specific problem (or a small set of codes). We discuss how theoretical analysis of the code and benchmarking on similar hardware lead to optimal systems.

  5. Coma cluster of galaxies

    Science.gov (United States)

    1999-01-01

    Atlas Image mosaic, covering 34' x 34' on the sky, of the Coma cluster, aka Abell 1656. This is a particularly rich cluster of individual galaxies (over 1000 members), most prominently the two giant ellipticals, NGC 4874 (right) and NGC 4889 (left). The remaining members are mostly smaller ellipticals, but spiral galaxies are also evident in the 2MASS image. The cluster is seen toward the constellation Coma Berenices, but is actually at a distance of about 100 Mpc (330 million light years, or a redshift of 0.023) from us. At this distance, the cluster is in what is known as the 'Hubble flow,' or the overall expansion of the Universe. As such, astronomers can measure the Hubble Constant, or the universal expansion rate, based on the distance to this cluster. Large, rich clusters, such as Coma, allow astronomers to measure the 'missing mass,' i.e., the matter in the cluster that we cannot see, since it gravitationally influences the motions of the member galaxies within the cluster. The near-infrared maps the overall luminous mass content of the member galaxies, since the light at these wavelengths is dominated by the more numerous older stellar populations. Galaxies, as seen by 2MASS, look fairly smooth and homogeneous, as can be seen from the Hubble 'tuning fork' diagram of near-infrared galaxy morphology. Image mosaic by S. Van Dyk (IPAC).

  6. Clustering Text Data Streams

    Institute of Scientific and Technical Information of China (English)

    Yu-Bao Liu; Jia-Rong Cai; Jian Yin; Ada Wai-Chee Fu

    2008-01-01

    Clustering text data streams is an important issue in data mining community and has a number of applications such as news group filtering, text crawling, document organization and topic detection and tracing etc. However, most methods are similarity-based approaches and only use the TF*IDF scheme to represent the semantics of text data and often lead to poor clustering quality. Recently, researchers argue that semantic smoothing model is more efficient than the existing TF.IDF scheme for improving text clustering quality. However, the existing semantic smoothing model is not suitable for dynamic text data context. In this paper, we extend the semantic smoothing model into text data streams context firstly. Based on the extended model, we then present two online clustering algorithms OCTS and OCTSM for the clustering of massive text data streams. In both algorithms, we also present a new cluster statistics structure named cluster profile which can capture the semantics of text data streams dynamically and at the same time speed up the clustering process. Some efficient implementations for our algorithms are also given. Finally, we present a series of experimental results illustrating the effectiveness of our technique.

  7. Brightest Cluster Galaxy Identification

    Science.gov (United States)

    Leisman, Luke; Haarsma, D. B.; Sebald, D. A.; ACCEPT Team

    2011-01-01

    Brightest cluster galaxies (BCGs) play an important role in several fields of astronomical research. The literature includes many different methods and criteria for identifying the BCG in the cluster, such as choosing the brightest galaxy, the galaxy nearest the X-ray peak, or the galaxy with the most extended profile. Here we examine a sample of 75 clusters from the Archive of Chandra Cluster Entropy Profile Tables (ACCEPT) and the Sloan Digital Sky Survey (SDSS), measuring masked magnitudes and profiles for BCG candidates in each cluster. We first identified galaxies by hand; in 15% of clusters at least one team member selected a different galaxy than the others.We also applied 6 other identification methods to the ACCEPT sample; in 30% of clusters at least one of these methods selected a different galaxy than the other methods. We then developed an algorithm that weighs brightness, profile, and proximity to the X-ray peak and centroid. This algorithm incorporates the advantages of by-hand identification (weighing multiple properties) and automated selection (repeatable and consistent). The BCG population chosen by the algorithm is more uniform in its properties than populations selected by other methods, particularly in the relation between absolute magnitude (a proxy for galaxy mass) and average gas temperature (a proxy for cluster mass). This work supported by a Barry M. Goldwater Scholarship and a Sid Jansma Summer Research Fellowship.

  8. Blue emitting undecaplatinum clusters

    Science.gov (United States)

    Chakraborty, Indranath; Bhuin, Radha Gobinda; Bhat, Shridevi; Pradeep, T.

    2014-07-01

    A blue luminescent 11-atom platinum cluster showing step-like optical features and the absence of plasmon absorption was synthesized. The cluster was purified using high performance liquid chromatography (HPLC). Electrospray ionization (ESI) and matrix assisted laser desorption ionization (MALDI) mass spectrometry (MS) suggest a composition, Pt11(BBS)8, which was confirmed by a range of other experimental tools. The cluster is highly stable and compatible with many organic solvents.A blue luminescent 11-atom platinum cluster showing step-like optical features and the absence of plasmon absorption was synthesized. The cluster was purified using high performance liquid chromatography (HPLC). Electrospray ionization (ESI) and matrix assisted laser desorption ionization (MALDI) mass spectrometry (MS) suggest a composition, Pt11(BBS)8, which was confirmed by a range of other experimental tools. The cluster is highly stable and compatible with many organic solvents. Electronic supplementary information (ESI) available: Details of experimental procedures, instrumentation, chromatogram of the crude cluster; SEM/EDAX, DLS, PXRD, TEM, FT-IR, and XPS of the isolated Pt11 cluster; UV/Vis, MALDI MS and SEM/EDAX of isolated 2 and 3; and 195Pt NMR of the K2PtCl6 standard. See DOI: 10.1039/c4nr02778g

  9. Investigation of Cluster and Cluster Queuing System

    OpenAIRE

    Halifu, Saerda

    2008-01-01

    Cluster became main platform as parallel and distributed computing structure for high performance computing. Following the development of high performance computer architecture more and more different branches of natural science benefit fromhuge and efficient computational power. For instance bio-informatics, climate science, computational physics, computational chemistry, marine science, etc. Efficient and reliable computing powermay not only expending demand of existing high performance com...

  10. The Cluster Substructure - Alignment Connection

    CERN Document Server

    Plionis, M

    2002-01-01

    Using the APM cluster data we investigate whether the dynamical status of clusters is related to the large-scale structure of the Universe. We find that cluster substructure is strongly correlated with the tendency of clusters to be aligned with their nearest neighbour and in general with the nearby clusters that belong to the same supercluster. Furthermore, dynamically young clusters are more clustered than the overall cluster population. These are strong indications that cluster develop in a hierarchical fashion by anisotropy merging along the large-scale filamentary superclusters within which they are embedded.

  11. Job Oriented Monitoring Clusters

    Directory of Open Access Journals (Sweden)

    Vijayalaxmi Cigala,

    2011-03-01

    Full Text Available There has been a lot of development in the field of clusters and grids. Recently, the use of clusters has been on rise in every possible field. This paper proposes a system that monitors jobs onlarge computational clusters. Monitoring jobs is essential to understand how jobs are being executed. This helps us in understanding the complete life cycle of the jobs being executed on large clusters. Also, this paper describes how the information obtained by monitoring the jobs would help in increasing the overall throughput of clusters. Heuristics help in efficient job distribution among the computational nodes, thereby accomplishing fair job distribution policy. The proposed system would be capable of loadbalancing among the computational nodes, detecting failures, taking corrective actions after failure detection, job monitoring, system resource monitoring, etc.

  12. Pulsars in Globular Clusters

    CERN Document Server

    Camilo, F; Camilo, Fernando; Rasio, Frederic A.

    2005-01-01

    More than 100 radio pulsars have been detected in 24 globular clusters. The largest observed samples are in Terzan 5 and 47 Tucanae, which together contain 45 pulsars. Accurate timing solutions, including positions in the cluster, are known for many of these pulsars. Here we provide an observational overview of some properties of pulsars in globular clusters, as well as properties of the globular clusters with detected pulsars. The many recent detections also provide a new opportunity to re-examine theoretically the formation and evolution of recycled pulsars in globular clusters. Our brief review considers the most important dynamical interaction and binary evolution processes: collisions, exchange interactions, mass transfer, and common-envelope phases.

  13. Mathematical classification and clustering

    CERN Document Server

    Mirkin, Boris

    1996-01-01

    I am very happy to have this opportunity to present the work of Boris Mirkin, a distinguished Russian scholar in the areas of data analysis and decision making methodologies. The monograph is devoted entirely to clustering, a discipline dispersed through many theoretical and application areas, from mathematical statistics and combina­ torial optimization to biology, sociology and organizational structures. It compiles an immense amount of research done to date, including many original Russian de­ velopments never presented to the international community before (for instance, cluster-by-cluster versions of the K-Means method in Chapter 4 or uniform par­ titioning in Chapter 5). The author's approach, approximation clustering, allows him both to systematize a great part of the discipline and to develop many in­ novative methods in the framework of optimization problems. The optimization methods considered are proved to be meaningful in the contexts of data analysis and clustering. The material presented in ...

  14. On TPC cluster reconstruction

    CERN Document Server

    Dydak, F; Nefedov, Y; Wotschack, J; Zhemchugov, A

    2004-01-01

    For a bias-free momentum measurement of TPC tracks, the correct determination of cluster positions is mandatory. We argue in particular that (i) the reconstruction of the entire longitudinal signal shape in view of longitudinal diffusion, electronic pulse shaping, and track inclination is important both for the polar angle reconstruction and for optimum r phi resolution; and that (ii) self-crosstalk of pad signals calls for special measures for the reconstruction of the z coordinate. The problem of 'shadow clusters' is resolved. Algorithms are presented for accepting clusters as 'good' clusters, and for the reconstruction of the r phi and z cluster coordinates, including provisions for 'bad' pads and pads next to sector boundaries, respectively.

  15. Cool Cluster Correctly Correlated

    Energy Technology Data Exchange (ETDEWEB)

    Sergey Aleksandrovich Varganov

    2005-12-17

    Atomic clusters are unique objects, which occupy an intermediate position between atoms and condensed matter systems. For a long time it was thought that physical and chemical properties of atomic dusters monotonically change with increasing size of the cluster from a single atom to a condensed matter system. However, recently it has become clear that many properties of atomic clusters can change drastically with the size of the clusters. Because physical and chemical properties of clusters can be adjusted simply by changing the cluster's size, different applications of atomic clusters were proposed. One example is the catalytic activity of clusters of specific sizes in different chemical reactions. Another example is a potential application of atomic clusters in microelectronics, where their band gaps can be adjusted by simply changing cluster sizes. In recent years significant advances in experimental techniques allow one to synthesize and study atomic clusters of specified sizes. However, the interpretation of the results is often difficult. The theoretical methods are frequently used to help in interpretation of complex experimental data. Most of the theoretical approaches have been based on empirical or semiempirical methods. These methods allow one to study large and small dusters using the same approximations. However, since empirical and semiempirical methods rely on simple models with many parameters, it is often difficult to estimate the quantitative and even qualitative accuracy of the results. On the other hand, because of significant advances in quantum chemical methods and computer capabilities, it is now possible to do high quality ab-initio calculations not only on systems of few atoms but on clusters of practical interest as well. In addition to accurate results for specific clusters, such methods can be used for benchmarking of different empirical and semiempirical approaches. The atomic clusters studied in this work contain from a few atoms

  16. Cluster ion beam evaporation

    International Nuclear Information System (INIS)

    Cluster ions can be made by the supercooling due to adiabatic expansion of substances to be vaporized which are ejected from a nozzle. This paper is described on the recent progress of studies concerning the cluster beam. The technique of cluster ion beam has been applied for the studies of thermonuclear plasma, the fabrication of thin films, crystal growth and electronic devices. The density of cluster ion beam is larger than that of atomic ion beam, and the formation of thin films can be easily done in high vacuum. This method is also useful for epitaxial growth. Metallic vapour cluster beam was made by the help of jetting rare gas beam. Various beam sources were developed. The characteristics of these sources were measured and analyzed. (Kato, T.)

  17. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Science.gov (United States)

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  18. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Directory of Open Access Journals (Sweden)

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  19. An ac bridge readout for bolometric detectors

    Science.gov (United States)

    Rieke, F. M.; Lange, A. E.; Beeman, J. W.; Haller, E. E.

    1989-01-01

    The authors have developed a bolometer readout circuit which greatly improves the low-frequency stability of bolometric detectors. The circuit uses an ac bias voltage and two matched bolometers and allows stable dc bolometer operation for integration times greater than 10 s. In astronomical applications the readout allows for qualitatively different observation modes (e.g. staring or slow-drift scanning) which are particularly well suited for space observations and for the use of arrays. In many applications the readout can increase sensitivity. The authors present noise spectra for 4He temperature bolometers with no excess noise at frequencies greater than 0.1 Hz. The measured optical responsivity of a bolometer operated with the present readout is the same as that of a bolometer operated with a conventional readout.

  20. Effective ac response in weakly nonlinear composites

    Energy Technology Data Exchange (ETDEWEB)

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  1. AC Dielectrophoresis Using Elliptic Electrode Geometry

    Directory of Open Access Journals (Sweden)

    S. M. Rezaul Hasan

    2011-01-01

    Full Text Available This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of specimen in a dielectrophoretic cage is also being reported. Using an actuating signal between 1 kHz and 1 MHz, successful trapping of 45 μm polystyrene beads suspended in distilled water was demonstrated due to negative dielectrophoresis near 100 kHz using the novel elliptic electrode.

  2. Josephson arrays for dc and ac metrology

    International Nuclear Information System (INIS)

    Large series arrays of underdamped SIS tunnel junctions are the basic element of the primary dc voltage standards used at present. The development of versatile quantum voltmeters for dc and ac metrology requires the preparation of large and perfect series arrays of overdamped Josephson junctions. Overdamped junctions can be realized by externally shunted SIS junctions or by internally shunted SNS or SINIS junctions. Arrays of up to 8000 SINIS junctions or 30000 SNS junctions were successfully operated at the 1 V dc level. In addition to being used in large arrays for voltage metrology and oscillators, the described junction types may become very useful for the preparation of highly integrated single-flux-quantum digital devices. (author)

  3. The AC and DC Conductivity of Nanocomposites

    Directory of Open Access Journals (Sweden)

    David S. McLachlan

    2007-01-01

    Full Text Available The microstructures of binary (conductor-insulator composites, containing nanoparticles, will usually have one of two basic structures. The first is the matrix structure where the nanoparticles (granules are embedded in and always coated by the matrix material and there are no particle-particle contacts. The AC and DC conductivity of this microstructure is usually described by the Maxwell-Wagner/Hashin-Shtrikman or Bricklayer model. The second is a percolation structure, which can be thought to be made up by randomly packing the two types of granules (not necessarily the same size together. In percolation systems, there exits a critical volume fraction below which the electrical properties are dominated by the insulating component and above which the conducting component dominates. Such percolation systems are best analyzed using the two-exponent phenomenological percolation equation (TEPPE. This paper discusses all of the above and addresses the problem of how to distinguish among the microstructures using electrical measurements.

  4. The Burst Cluster: Dark Matter in a Cluster Merger Associated with the Short Gamma Ray Burst, GRB 050509B

    CERN Document Server

    Dahle, Hakon; Lopez, Laura A; Kouveliotou, Chryssa; Patel, Sandeep K; Rol, Evert; van der Horst, Alexander J; Fynbo, Johan P; Wijers, Ralph A M J; Burrows, David N; Gehrels, Neil; Grupe, Dirk; Ramirez-Ruiz, Enrico; Michalowski, Michal J

    2013-01-01

    We have identified a merging galaxy cluster with evidence of two distinct sub-clusters. The X-ray and optical data suggest that the subclusters are moving away from each other after closest approach. This cluster merger was discovered from observations of the well localized short-duration gamma-ray burst (GRB), GRB 050509B. The Swift/Burst Alert Telescope (BAT) source position is coincident with a cluster of galaxies ZwCl 1234.0+02916. The subsequent Swift/X-Ray Telescope (XRT) localization of the X-ray afterglow found the GRB coincident with 2MASX J12361286+2858580, a giant red elliptical galaxy in the cluster. Deep multi-epoch optical images were obtained to constrain the evolution of the GRB afterglow, including a 27480s exposure in the F814W band with Hubble Space Telescope Advanced Camera for Surveys (ACS), among the deepest imaging ever obtained towards a known galaxy cluster in a single passband. We perform a weak gravitational lensing analysis, including mapping the total mass distribution of the merg...

  5. Dicty_cDB: FCL-AC29 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC29 (Link to dictyBase) - - - Contig-U15392-1 FCL-AC29P ...(Link to Original site) FCL-AC29F 104 FCL-AC29Z 591 FCL-AC29P 695 - - Show FCL-AC29 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC29Q....Seq.d/ Representative seq. ID FCL-AC29P (Link to Original site) Representative DNA sequence >FCL-AC29 (FCL-AC29Q) /CSM/FCL/FCL-...roducing significant alignments: (bits) Value VSC293 (VSC293Q) /CSM/VS/VSC2-D/VSC293Q.Seq.d/ 1063 0.0 FCL-AC29 (FCL-

  6. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  7. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    DEFF Research Database (Denmark)

    Qin, Zian

    . With the proposed new active power decoupling method, the ripple power in the converter can be compensated in a more efficient and more compact way. Then, Chapter 5 changes the scope of the thesis to three-phase converters, and the nine-switch converter, as a reduced switch version of two three-phase full......-bridges connected back-to-back, is studied. Application criteria of the nine-switch converter are investigated for reducing the relatively high stress introduced by the less number of switches. In Chapter 6 a rotating speed controller design method is proposed for improving the thermal loading of the three...... to users. Their performances including cost, efficiency, reliability, and so on, therefore are more important concerns than they were. The objective of this thesis is to study and propose advanced design methods for robust ac-dc-ac converters, which are widely used interfaces in energy conversion system...

  8. Textile Industrial Clusters in China

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    "National Textile Industry Cluster Development Seminar" convened, held by China National Textile and Apparel Council, 23 cities and towns were awarded as China’s Textile Industry Cluster Pilot District. By far, China’s textile industrial clusters have grown

  9. Spanning Tree Based Attribute Clustering

    DEFF Research Database (Denmark)

    Zeng, Yifeng; Jorge, Cordero Hernandez

    2009-01-01

    inconsistent edges from a maximum spanning tree by starting appropriate initial modes, therefore generating stable clusters. It discovers sound clusters through simple graph operations and achieves significant computational savings. We compare the Star Discovery algorithm against earlier attribute clustering...

  10. Cluster knockout reactions

    Indian Academy of Sciences (India)

    Arun K Jain; B N Joshi

    2014-04-01

    Cluster knockout reactions are expected to reveal the amount of clustering (such as that of , d and even of heavier clusters such as 12C, 16O etc.) in the target nucleus. In simple terms, incident medium high-energy nuclear projectile interacts strongly with the cluster (present in the target nucleus) as if it were existing as a free entity. Theoretically, the relatively softer interactions of the two outgoing particles with the residual nucleus lead to optical distortions and are treated in terms of distorted wave (DW) formalism. The long-range projectile–cluster interaction is accounted for, in terms of the finite range (FR) direct reaction formalism, as against the more commonly adopted zero-range (ZR) distorted wave impulse approximation (DWIA) formalism. Comparison of the DWIA calculations with the observed data provide information about the momentum distribution and the clustering spectroscopic factor of the target nucleus. Interesting results and some recent advancements in the area of (, 2) reactions and heavy cluster knockout reactions are discussed. Importance of the finite-range vertex and the final-state interactions are brought out.

  11. Software-Defined Cluster

    Institute of Scientific and Technical Information of China (English)

    聂华; 杨晓君; 刘淘英

    2015-01-01

    The cluster architecture has played an important role in high-end computing for the past 20 years. With the advent of Internet services, big data, and cloud computing, traditional clusters face three challenges: 1) providing flexible system balance among computing, memory, and I/O capabilities;2) reducing resource pooling overheads;and 3) addressing low performance-power efficiency. This position paper proposes a software-defined cluster (SDC) architecture to deal with these challenges. The SDC architecture inherits two features of traditional cluster: its architecture is multicomputer and it has loosely-coupled interconnect. SDC provides two new mechanisms: global I/O space (GIO) and hardware-supported native access (HNA) to remote devices. Application software can define a virtual cluster best suited to its needs from resources pools provided by a physical cluster, and traditional cluster ecosystems need no modification. We also discuss a prototype design and implementation of a 32-processor cloud server utilizing the SDC architecture.

  12. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  13. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  14. Equivalent circuit models for ac impedance data analysis

    Science.gov (United States)

    Danford, M. D.

    1990-01-01

    A least-squares fitting routine has been developed for the analysis of ac impedance data. It has been determined that the checking of the derived equations for a particular circuit with a commercially available electronics circuit program is essential. As a result of the investigation described, three equivalent circuit models were selected for use in the analysis of ac impedance data.

  15. Considerations for an Ac Dipole for the LHC

    CERN Document Server

    Bai, M; Fischer, W; Oddo, P; Schmickler, Hermann; Serrano, J; Jansson, A; Syphers, M; Kopp, S; Miyamoto, R

    2007-01-01

    Following successful experience at the BNL AGS, FNAL Tevatron, and CERN SPS, an AC Dipole will be adopted at the LHC for rapid measurements of ring optics. This paper describes some of the parameters of the AC dipole for the LHC, scaling from performance of the FNAL and BNL devices.

  16. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%), for kidneys 20 ± 1% (19...

  17. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  18. AC loss in large-scale superconducting cables

    NARCIS (Netherlands)

    Mulder, G.B.J.

    1993-01-01

    A review is given of recent work on ac losses, carried out at our institute. The emphasis is on large-scale conductors for fusion applications, such as the `cable-in-conduit¿ prototype conductors to be used for NET. Calculation methods for the ac losses are presented together with some experimental

  19. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Directory of Open Access Journals (Sweden)

    Marian GAICEANU

    2003-12-01

    Full Text Available In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller 30 MIPS 32-bit fixed-point digital signal processor (DSP, were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this way a small DC link capacitor is required to handle the dc voltage error control. The feed-forward (Sul and Lipo, 1990 current component provides fast correction of the reference control to load power variation. In order to obtain the feed-forward current component, the load power must to be known. In this paper the load power is estimated from the dc link, indirectly, through a dc load current estimator. In this way the author overcomes the use of the serial communication between control boards (Gaiceanu, 2004 in order to deliver the load power information from the inverter side. The load current estimator is based on the DC link voltage and on the load current of the supply converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feed-forward current component has no ripple, no additional hardware, and more fast control response. Through simulation and experimental results the performances of the proposed load current estimator scheme are demonstrated.

  20. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  1. Sustainable AC/AC hybrid electrochemical capacitors in aqueous electrolyte approaching the performance of organic systems

    Science.gov (United States)

    Abbas, Qamar; Babuchowska, Paulina; Frąckowiak, Elżbieta; Béguin, François

    2016-09-01

    A high energy hybrid AC/AC electrochemical capacitor has been realized in aqueous Li2SO4+KI electrolyte mixture. Owing to the redox processes associated with the 2I-/I2 system, the positive electrode operates in narrow potential range and displays high capacity. During prolonged potentiostatic floating at 1.6 V, the hybrid cell demonstrates remarkably stable capacitance and resistance. Analyses by temperature programmed desorption after floating at 1.6 V proved that oxidation of the positive AC electrode is prevented by the use of Li2SO4+KI, which enables the maximum potential of this electrode to be shifted below the water oxidation potential. When charged at 0.2 A g-1 up to U = 1.6 V, the hybrid cell displays a high capacitance of 75 F g-1 (300 F g-1 per mass of one electrode) compared to 47 F g-1 (188 F g-1 per mass of one electrode) for a symmetric cell in Li2SO4. At 0.2 A g-1 up to 1.6 V, the hybrid capacitor in Li2SO4+KI displays an energy density of 26 Wh kg-1 which approaches the energy density of 30.9 Wh kg-1 measured when the same carbon is implemented in a capacitor using TEABF4/ACN electrolyte and charged up to 2.5 V.

  2. Extending Beowulf Clusters

    Science.gov (United States)

    Steinwand, Daniel R.; Maddox, Brian; Beckmann, Tim; Hamer, George

    2003-01-01

    Beowulf clusters can provide a cost-effective way to compute numerical models and process large amounts of remote sensing image data. Usually a Beowulf cluster is designed to accomplish a specific set of processing goals, and processing is very efficient when the problem remains inside the constraints of the original design. There are cases, however, when one might wish to compute a problem that is beyond the capacity of the local Beowulf system. In these cases, spreading the problem to multiple clusters or to other machines on the network may provide a cost-effective solution.

  3. Cluster Management Institutionalization

    DEFF Research Database (Denmark)

    Normann, Leo; Agger Nielsen, Jeppe

    2015-01-01

    institutionalism together with a longitudinal case-based inquiry into how cluster management has entered and penetrated the management practices of day care in Denmark. We demonstrate how cluster management became widely adopted in the day care field not only because of its intrinsic properties but also because...... legitimized at the field level, then spread, and finally translated into action in the adopting organizations. Instead, we observed entangled field and organizational-level processes. Accordingly, we argue that cluster management institutionalization is most readily understood by simultaneously investigating...

  4. Introduction to cluster dynamics

    CERN Document Server

    Reinhard, Paul-Gerhard

    2008-01-01

    Clusters as mesoscopic particles represent an intermediate state of matter between single atoms and solid material. The tendency to miniaturise technical objects requires knowledge about systems which contain a ""small"" number of atoms or molecules only. This is all the more true for dynamical aspects, particularly in relation to the qick development of laser technology and femtosecond spectroscopy. Here, for the first time is a highly qualitative introduction to cluster physics. With its emphasis on cluster dynamics, this will be vital to everyone involved in this interdisciplinary subje

  5. Dwarfs in Coma Cluster

    Science.gov (United States)

    2007-01-01

    [figure removed for brevity, see original site] Click on image for larger poster version This false-color mosaic of the central region of the Coma cluster combines infrared and visible-light images to reveal thousands of faint objects (green). Follow-up observations showed that many of these objects, which appear here as faint green smudges, are dwarf galaxies belonging to the cluster. Two large elliptical galaxies, NGC 4889 and NGC 4874, dominate the cluster's center. The mosaic combines visible-light data from the Sloan Digital Sky Survey (color coded blue) with long- and short-wavelength infrared views (red and green, respectively) from NASA's Spitzer Space Telescope.

  6. Raspberry Pi super cluster

    CERN Document Server

    Dennis, Andrew K

    2013-01-01

    This book follows a step-by-step, tutorial-based approach which will teach you how to develop your own super cluster using Raspberry Pi computers quickly and efficiently.Raspberry Pi Super Cluster is an introductory guide for those interested in experimenting with parallel computing at home. Aimed at Raspberry Pi enthusiasts, this book is a primer for getting your first cluster up and running.Basic knowledge of C or Java would be helpful but no prior knowledge of parallel computing is necessary.

  7. Partially supervised speaker clustering.

    Science.gov (United States)

    Tang, Hao; Chu, Stephen Mingyu; Hasegawa-Johnson, Mark; Huang, Thomas S

    2012-05-01

    Content-based multimedia indexing, retrieval, and processing as well as multimedia databases demand the structuring of the media content (image, audio, video, text, etc.), one significant goal being to associate the identity of the content to the individual segments of the signals. In this paper, we specifically address the problem of speaker clustering, the task of assigning every speech utterance in an audio stream to its speaker. We offer a complete treatment to the idea of partially supervised speaker clustering, which refers to the use of our prior knowledge of speakers in general to assist the unsupervised speaker clustering process. By means of an independent training data set, we encode the prior knowledge at the various stages of the speaker clustering pipeline via 1) learning a speaker-discriminative acoustic feature transformation, 2) learning a universal speaker prior model, and 3) learning a discriminative speaker subspace, or equivalently, a speaker-discriminative distance metric. We study the directional scattering property of the Gaussian mixture model (GMM) mean supervector representation of utterances in the high-dimensional space, and advocate exploiting this property by using the cosine distance metric instead of the euclidean distance metric for speaker clustering in the GMM mean supervector space. We propose to perform discriminant analysis based on the cosine distance metric, which leads to a novel distance metric learning algorithm—linear spherical discriminant analysis (LSDA). We show that the proposed LSDA formulation can be systematically solved within the elegant graph embedding general dimensionality reduction framework. Our speaker clustering experiments on the GALE database clearly indicate that 1) our speaker clustering methods based on the GMM mean supervector representation and vector-based distance metrics outperform traditional speaker clustering methods based on the “bag of acoustic features” representation and statistical

  8. Clustering in nuclear environment

    International Nuclear Information System (INIS)

    The properties of few-body clusters (mass number A ≤ 4) are modified if they are immersed in a nuclear medium. In particular, Pauli blocking that reflects the antisymmetrization of the many-body wave function is responsible for the medium modification of light clusters and the dissolution with increasing density. A more consistent description is given with takes also the contribution of correlations in the continuum into account. The relation between cluster formation in warm dense matter and in nuclear structure is discussed

  9. 单相电压型Z源AC/AC变流器电路%Single-Phase Voltage-Fed Z-Source AC/AC Converter

    Institute of Scientific and Technical Information of China (English)

    房绪鹏

    2006-01-01

    提出了一种新型AC/AC变流器电路--单相电压型Z源AC/AC变流器;介绍了其电路拓扑、工作原理、控制方法等;给出了相应的仿真和实验结果.仿真和实验证实了该电路拓扑的合理性和优越性.

  10. Ac response of a coupled double quantum dot

    Institute of Scientific and Technical Information of China (English)

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang

    2005-01-01

    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  11. Determination for β-delayed fission probability of 230Ac

    Institute of Scientific and Technical Information of China (English)

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝

    2002-01-01

    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  12. Estimation of the Thurstonian model for the 2-AC protocol

    DEFF Research Database (Denmark)

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model....... This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative...

  13. Combining cluster number counts and galaxy clustering

    Science.gov (United States)

    Lacasa, Fabien; Rosenfeld, Rogerio

    2016-08-01

    The abundance of clusters and the clustering of galaxies are two of the important cosmological probes for current and future large scale surveys of galaxies, such as the Dark Energy Survey. In order to combine them one has to account for the fact that they are not independent quantities, since they probe the same density field. It is important to develop a good understanding of their correlation in order to extract parameter constraints. We present a detailed modelling of the joint covariance matrix between cluster number counts and the galaxy angular power spectrum. We employ the framework of the halo model complemented by a Halo Occupation Distribution model (HOD). We demonstrate the importance of accounting for non-Gaussianity to produce accurate covariance predictions. Indeed, we show that the non-Gaussian covariance becomes dominant at small scales, low redshifts or high cluster masses. We discuss in particular the case of the super-sample covariance (SSC), including the effects of galaxy shot-noise, halo second order bias and non-local bias. We demonstrate that the SSC obeys mathematical inequalities and positivity. Using the joint covariance matrix and a Fisher matrix methodology, we examine the prospects of combining these two probes to constrain cosmological and HOD parameters. We find that the combination indeed results in noticeably better constraints, with improvements of order 20% on cosmological parameters compared to the best single probe, and even greater improvement on HOD parameters, with reduction of error bars by a factor 1.4-4.8. This happens in particular because the cross-covariance introduces a synergy between the probes on small scales. We conclude that accounting for non-Gaussian effects is required for the joint analysis of these observables in galaxy surveys.

  14. Distribution of star formation rates during the rapid assembly of NGC 1399 as deduced from its globular cluster system

    Science.gov (United States)

    Schulz, C.; Hilker, M.; Kroupa, P.; Pflamm-Altenburg, J.

    2016-10-01

    Ultra-compact dwarf galaxies (UCDs) share many properties with globular clusters (GCs) and are found in similar environments. Here, a large sample of UCDs and GCs around NGC 1399, the central giant elliptical of the Fornax galaxy cluster, is used to infer their formation history and also to shed light on the formation of NGC 1399 itself. We assumed that all GCs and UCDs in our sample are the result of star cluster (SC) formation processes and used them as tracers of past star formation activities. After correcting our GC/UCD sample for mass loss, we interpreted their overall mass function to be a superposition of SC populations that formed coevally during different formation epochs. The SC masses of each population were distributed according to the embedded cluster mass function (ECMF), a pure power law with the slope - β. Each ECMF was characterized by a stellar upper mass limit, Mmax, which depended on the star formation rate (SFR). We decomposed the observed GC/UCD mass function into individual SC populations and converted Mmax of each SC population to an SFR. The overall distribution of SFRs reveals under which conditions the GC/UCD sample around NGC 1399 formed. Considering the constraints set by the age of the GCs/UCDs and the present stellar mass of NGC 1399, we found that the formation of the GCs/UCDs can be well explained within our framework with values for β below 2.3. This finding agrees very well with the observation of young SCs where β ≈ 2.0 is usually found. Even though we took into account that some of the most massive objects might not be genuine SCs and applied different corrections for the mass loss, we found that these considerations do not influence much the outcome. We derived the peak SFRs to be between approximately 300 and 3000 M⊙ yr-1, which matches the SFRs observed in massive high-redshift sub-millimeter galaxies and an SFR estimate inferred from NGC 1399 based on the so-called downsizing picture, meaning that more massive

  15. An Ac transposon system based on maize chromosome 4S for isolating long-distance-transposed Ac tags in the maize genome.

    Science.gov (United States)

    Wang, Fei; Li, Zhaoying; Fan, Jun; Li, Pengfei; Hu, Wei; Wang, Gang; Xu, Zhengkai; Song, Rentao

    2010-12-01

    Transposon tagging is an important tool for gene isolation and functional studies. In maize, several transposon-tagging systems have been developed, mostly using Activator/Dissociation (Ac/Ds) and Mutator systems. Here, we establish another Ac-based transposon system with the donor Ac tightly linked with sugary1 (su1) on maize chromosome 4S. Newly transposed Ac (tr-Acs) were detected based on a negative dosage effect, and long-distance-transposed Ac events were identified and isolated from the donor Ac by a simple backcross scheme. In this study, we identified 208 independent long-distance-transposed Ac lines. Thirty-one flanking sequences of these tr-Acs were isolated and localized in the maize genome. As found in previous studies, the tr-Acs preferentially inserted into genic sequences. The distribution of tr-Acs is not random. In our study, the tr-Acs preferentially transposed into chromosomes 1, 2, 9 and 10. We discuss the preferential distribution of tr-Acs from Ac systems. Our system is complementary to two other Ac-based regional-mutagenesis systems in maize, and the combined use of these systems will achieve an even and high-density distribution of Ac elements throughout the maize genome for functional-genomics studies.

  16. 40 CFR 86.162-00 - Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2.

    Science.gov (United States)

    2010-07-01

    ... Procedures § 86.162-00 Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. The alternative air conditioning test procedures AC1 and AC2 are approved by the Administrator... requirements of paragraph (a) of this section and meet the requirements of § 86.163-00. Air conditioning...

  17. Spectroscopy of globular clusters in the low-luminosity spiral galaxy NGC 45

    CERN Document Server

    Mora, Marcelo D; Kissler-Patig, Markus

    2008-01-01

    CONTEXT: Extragalactic globular clusters have been studied in elliptical galaxies and in a few luminous spiral galaxies, but little is known about globular clusters in low-luminosity spirals. AIMS: Past observations with the ACS have shown that NGC 45 hosts a large population of globular clusters (19), as well as several young star clusters. In this work we aim to confirm the bona fide globular cluster status for 8 of 19 globular cluster candidates and to derive metallicities, ages, and velocities. METHODS: VLT/FORS2 multislit spectroscopy in combination with the Lick/IDS system was used to derive velocities and to constrain metallicities and [alpha/Fe] element ratio of the globular clusters. RESULTS: We confirm the 8 globular clusters as bona fide globular clusters. Their velocities indicate halo or bulge-like kinematics, with little or no overall rotation. From absorption indices such as H_beta, H_gamma, and H_delta and the combined [MgFe]' index, we found that the globular clusters are metal-poor [Z/H]<...

  18. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  19. La acústica submarina y su desarrollo desde la creación del Instituto de Acústica

    OpenAIRE

    Ranz Guerra, Carlos; Cobo, Pedro; Carbó, Rafael; Santiago Páez, José Salvador; Soler, A. M.; Briones, J. M.; Jimeno, I.; Muñoz, N; Camarasa, M.; Recuero López, Manuel

    2000-01-01

    PACS: 43.30.Xm; 43.30.Yj; 43.30.Vh; 43.30.Nb; 43.30.Ma.-- Publicado en el Vol. XXXI, núm. 3-4, tercer y cuarto trimestre 2000 de la Revista de Acústica: Número especial dedicado al XXV Aniversario del Instituto de Acústica del C.S.I.C.

  20. Evolution of clustered storage

    CERN Document Server

    CERN. Geneva; Van de Vyvre, Pierre

    2007-01-01

    The session actually featured two presentations: * Evolution of clustered storage by Lance Hukill, Quantum Corporation * ALICE DAQ - Usage of a Cluster-File System: Quantum StorNext by Pierre Vande Vyvre, CERN-PH the second one prepared at short notice by Pierre (thanks!) to present how the Quantum technologies are being used in the ALICE experiment. The abstract to Mr Hukill's follows. Clustered Storage is a technology that is driven by business and mission applications. The evolution of Clustered Storage solutions starts first at the alignment between End-users needs and Industry trends: * Push-and-Pull between managing for today versus planning for tomorrow * Breaking down the real business problems to the core applications * Commoditization of clients, servers, and target devices * Interchangeability, Interoperability, Remote Access, Centralized control * Oh, and yes, there is a budget and the "real world" to deal with This presentation will talk through these needs and trends, and then ask the question, ...

  1. Dynamic Bayesian clustering.

    Science.gov (United States)

    Fowler, Anna; Menon, Vilas; Heard, Nicholas A

    2013-10-01

    Clusters of time series data may change location and memberships over time; in gene expression data, this occurs as groups of genes or samples respond differently to stimuli or experimental conditions at different times. In order to uncover this underlying temporal structure, we consider dynamic clusters with time-dependent parameters which split and merge over time, enabling cluster memberships to change. These interesting time-dependent structures are useful in understanding the development of organisms or complex organs, and could not be identified using traditional clustering methods. In cell cycle data, these time-dependent structure may provide links between genes and stages of the cell cycle, whilst in developmental data sets they may highlight key developmental transitions. PMID:24131050

  2. Internal Cluster Structure

    CERN Document Server

    Bartelmann, Matthias; Meneghetti, Massimo; Schmidt, Robert

    2013-01-01

    The core structure of galaxy clusters is fundamentally important. Even though self-gravitating systems have no stable equilibrium state due to their negative heat capacity, numerical simulations find density profiles which are universal in the sense that they are fairly flat within a scale radius and gradually steepen farther outward, asymptotically approaching a logarithmic slope of $\\approx-3$ near the virial radius. We argue that the reason for the formation of this profile is not satisfactorily understood. The ratio between the virial radius and the scale radius, the so-called concentration, is found in simulations to be closely related to the mass and the redshift and low for cluster-sized haloes, but observed to be substantially higher at least in a subset of observed clusters. Haloes formed from cold dark matter should furthermore be richly substructured. We review theoretical and observational aspects of cluster cores here, discuss modifications by baryonic physics and observables that can provide bet...

  3. Altered Chromosomal Positioning, Compaction, and Gene Expression with a Lamin A/C Gene Mutation

    Science.gov (United States)

    Abuisneineh, Fida; Fahrenbach, John P.; Zhang, Yuan; MacLeod, Heather; Dellefave, Lisa; Pytel, Peter; Selig, Sara; Labno, Christine M.; Reddy, Karen; Singh, Harinder; McNally, Elizabeth

    2010-01-01

    Background Lamins A and C, encoded by the LMNA gene, are filamentous proteins that form the core scaffold of the nuclear lamina. Dominant LMNA gene mutations cause multiple human diseases including cardiac and skeletal myopathies. The nuclear lamina is thought to regulate gene expression by its direct interaction with chromatin. LMNA gene mutations may mediate disease by disrupting normal gene expression. Methods/Findings To investigate the hypothesis that mutant lamin A/C changes the lamina's ability to interact with chromatin, we studied gene misexpression resulting from the cardiomyopathic LMNA E161K mutation and correlated this with changes in chromosome positioning. We identified clusters of misexpressed genes and examined the nuclear positioning of two such genomic clusters, each harboring genes relevant to striated muscle disease including LMO7 and MBNL2. Both gene clusters were found to be more centrally positioned in LMNA-mutant nuclei. Additionally, these loci were less compacted. In LMNA mutant heart and fibroblasts, we found that chromosome 13 had a disproportionately high fraction of misexpressed genes. Using three-dimensional fluorescence in situ hybridization we found that the entire territory of chromosome 13 was displaced towards the center of the nucleus in LMNA mutant fibroblasts. Additional cardiomyopathic LMNA gene mutations were also shown to have abnormal positioning of chromosome 13, although in the opposite direction. Conclusions These data support a model in which LMNA mutations perturb the intranuclear positioning and compaction of chromosomal domains and provide a mechanism by which gene expression may be altered. PMID:21179469

  4. Altered chromosomal positioning, compaction, and gene expression with a lamin A/C gene mutation.

    Directory of Open Access Journals (Sweden)

    Stephanie K Mewborn

    Full Text Available BACKGROUND: Lamins A and C, encoded by the LMNA gene, are filamentous proteins that form the core scaffold of the nuclear lamina. Dominant LMNA gene mutations cause multiple human diseases including cardiac and skeletal myopathies. The nuclear lamina is thought to regulate gene expression by its direct interaction with chromatin. LMNA gene mutations may mediate disease by disrupting normal gene expression. METHODS/FINDINGS: To investigate the hypothesis that mutant lamin A/C changes the lamina's ability to interact with chromatin, we studied gene misexpression resulting from the cardiomyopathic LMNA E161K mutation and correlated this with changes in chromosome positioning. We identified clusters of misexpressed genes and examined the nuclear positioning of two such genomic clusters, each harboring genes relevant to striated muscle disease including LMO7 and MBNL2. Both gene clusters were found to be more centrally positioned in LMNA-mutant nuclei. Additionally, these loci were less compacted. In LMNA mutant heart and fibroblasts, we found that chromosome 13 had a disproportionately high fraction of misexpressed genes. Using three-dimensional fluorescence in situ hybridization we found that the entire territory of chromosome 13 was displaced towards the center of the nucleus in LMNA mutant fibroblasts. Additional cardiomyopathic LMNA gene mutations were also shown to have abnormal positioning of chromosome 13, although in the opposite direction. CONCLUSIONS: These data support a model in which LMNA mutations perturb the intranuclear positioning and compaction of chromosomal domains and provide a mechanism by which gene expression may be altered.

  5. Mesoscopic turbulence and local order in Janus particles self-propelling under an ac electric field

    Science.gov (United States)

    Nishiguchi, Daiki; Sano, Masaki

    2015-11-01

    To elucidate mechanisms of mesoscopic turbulence exhibited by active particles, we experimentally study turbulent states of nonliving self-propelled particles. We realize an experimental system with dense suspensions of asymmetrical colloidal particles (Janus particles) self-propelling on a two-dimensional surface under an ac electric field. Velocity fields of the Janus particles in the crowded situation can be regarded as a sort of turbulence because it contains many vortices and their velocities change abruptly. Correlation functions of their velocity field reveal the coexistence of polar alignment and antiparallel alignment interactions, which is considered to trigger mesoscopic turbulence. Probability distributions of local order parameters for polar and nematic orders indicate the formation of local clusters with particles moving in the same direction. A broad peak in the energy spectrum of the velocity field appears at the spatial scales where the polar alignment and the cluster formation are observed. Energy is injected at the particle scale and conserved quantities such as energy could be cascading toward the larger clusters.

  6. Finnish Mobile Gaming Cluster

    OpenAIRE

    Masira, Elijah; Chowdhury, Nafis Ahmed

    2014-01-01

    Abstract The Finnish mobile gaming cluster is one of the most promising industries that have been growing significantly in the past few years to become a substantial cultural export product / service of Finland. The main objective of this research was to gain a persuasive understanding about the emergence of the mobile gaming cluster in Finland and explore the factors behind its success. The literature review centers on M. E Porter’s publications on competitiveness and other publication...

  7. Clustering audiology data

    OpenAIRE

    Anwar, Naveed; Oakes, Michael; Wermter, Stefan; Heinrich, Stefan

    2010-01-01

    In this paper we describe new results of statistical and neural data mining of audiology patient records, with the ultimate aim of looking for factors influencing which patients would most benefit from being fitted with a hearing aid. We describe how a combination of neural and statistical techniques can usefully subdivide a set of patients into clusters, based on their hearing thresholds at six different frequencies, and then label the clusters with meaningful text labels. In our first exper...

  8. Industry clusters and SMEs

    OpenAIRE

    Arnoud Muizer; Gert Jan Hospers

    1999-01-01

    Studie naar de rol van clusters van bedrijven in de economie. Clusters van bedrijven krijgen een groeiende aandacht op alle bestuurlijke niveaus. De achterliggende gedachte is dat samenwerking tussen bedrijven op technologisch gebied leidt tot de creatie van extra toegevoegde waarde, niet alleen voor de samenwerkingspartners zelf, maar ook voor de lokale, regionale en nationale economie. In de studie wordt een clusterdefinitie gepresenteerd en een raamwerk dat als basis kan dienen voor nader ...

  9. Spatial connectivity of urban clusters and regional climate effects

    Science.gov (United States)

    Jia, G.; Hu, Y.; Xu, R.

    2015-12-01

    Rapid urbanization in East Asia in past three decades is considered as a remarkable process that featured with expansion of urban clusters and tightened linkages within and among clusters. Such process could lead to much larger scale climate effects, and could even contribute to sub-regional and regional climate change. In large area of urban clusters with significant expansion of built-up in relatively short period, local urban heat islands could contribute to sub-regional climate forcing. Here we use visible/near infrared and thermal infrared satellite data to estimate multiple scale structure of urban clusters, and to assess effects of urban heat islands at local and regional scales in East Asia. Our estimates of urban extent were greater than previously reported in most global datasets. Strong spatial connection and internal expansion were found in major urban clusters in past 30 years, and was accelerated in past 10 years. Many city clusters were merging into each other, with gradual blurring boundaries and disappearing of gaps among member cities. Cities and towns were more connected with roads and commercial corridors, while wildland and urban greens became more isolated as patches among built-up areas. We would argue that in many cases in this region, urban clusters are no longer "islands", they are now "seas" in term of climate related urban canopy. Urban greens such as parks and plantation were long recognized for their cooling effects that buffer the urban heat island effect, however, such cooling effects tend to be weakened as their patches became smaller and isolated, and over dominated by urban surfaces. There were significant positive relations between urban fraction and urban heat island effects as demonstrated by VNIR and TIR data from multiple satellites. Those new estimates are expected to effectively improve climate simulation for better understanding the impacts of inter-connected urban clusters on air temperature, precipitation, wind speed

  10. Centroid Based Text Clustering

    Directory of Open Access Journals (Sweden)

    Priti Maheshwari

    2010-09-01

    Full Text Available Web mining is a burgeoning new field that attempts to glean meaningful information from natural language text. Web mining refers generally to the process of extracting interesting information and knowledge from unstructured text. Text clustering is one of the important Web mining functionalities. Text clustering is the task in which texts are classified into groups of similar objects based on their contents. Current research in the area of Web mining is tacklesproblems of text data representation, classification, clustering, information extraction or the search for and modeling of hidden patterns. In this paper we propose for mining large document collections it is necessary to pre-process the web documents and store the information in a data structure, which is more appropriate for further processing than a plain web file. In this paper we developed a php-mySql based utility to convert unstructured web documents into structured tabular representation by preprocessing, indexing .We apply centroid based web clustering method on preprocessed data. We apply three methods for clustering. Finally we proposed a method that can increase accuracy based on clustering ofdocuments.

  11. Galaxy cluster's rotation

    CERN Document Server

    Manolopoulou, Maria

    2016-01-01

    We study the possible rotation of cluster galaxies, developing, testing and applying a novel algorithm which identifies rotation, if such does exits, as well as its rotational centre, its axis orientation, rotational velocity amplitude and, finally, the clockwise or counterclockwise direction of rotation on the plane of the sky. To validate our algorithms we construct realistic Monte-Carlo mock rotating clusters and confirm that our method provides robust indications of rotation. We then apply our methodology on a sample of Abell clusters with z<~0.1 with member galaxies selected from the SDSS DR10 spectroscopic database. We find that ~35% of our clusters are rotating when using a set of strict criteria, while loosening the criteria we find this fraction increasing to ~48%. We correlate our rotation indicators with the cluster dynamical state, provided either by their Bautz-Morgan type or by their X-ray isophotal shape and find for those clusters showing rotation that the significance and strength of their...

  12. Cluster bomb ocular injuries

    Directory of Open Access Journals (Sweden)

    Ahmad M Mansour

    2012-01-01

    Full Text Available Purpose: To present the visual outcomes and ocular sequelae of victims of cluster bombs. Materials and Methods: This retrospective, multicenter case series of ocular injury due to cluster bombs was conducted for 3 years after the war in South Lebanon (July 2006. Data were gathered from the reports to the Information Management System for Mine Action. Results: There were 308 victims of clusters bombs; 36 individuals were killed, of which 2 received ocular lacerations and; 272 individuals were injured with 18 receiving ocular injury. These 18 surviving individuals were assessed by the authors. Ocular injury occurred in 6.5% (20/308 of cluster bomb victims. Trauma to multiple organs occurred in 12 of 18 cases (67% with ocular injury. Ocular findings included corneal or scleral lacerations (16 eyes, corneal foreign bodies (9 eyes, corneal decompensation (2 eyes, ruptured cataract (6 eyes, and intravitreal foreign bodies (10 eyes. The corneas of one patient had extreme attenuation of the endothelium. Conclusions: Ocular injury occurred in 6.5% of cluster bomb victims and 67% of the patients with ocular injury sustained trauma to multiple organs. Visual morbidity in civilians is an additional reason for a global ban on the use of cluster bombs.

  13. Modeling the Formation of Globular Cluster Systems in the Virgo Cluster

    CERN Document Server

    Li, Hui

    2014-01-01

    Globular cluster (GC) systems are some of the oldest and most unique building blocks of galaxies. The mass and chemical composition of GCs preserve the fossil record of the early stages of formation of their host galaxies. The observed distribution of GC colors within massive early-type galaxies in the ACS Virgo Cluster Survey (ACSVCS) reveals a multi-modal shape, which likely corresponds to a multi-modal metallicity distribution. In this paper, we present a simple model for the formation and dynamical disruption of globular clusters that aims to match the ACSVCS data. We test the hypothesis that GCs are formed during major mergers of gas-rich galaxies and inherit the metallicity of their hosts. To trace merger events, we use halo merger trees extracted from a large cosmological N-body simulation. We select 20 halos in the mass range 2*10^{12}-7*10^{13} M_sun and match them to 18 Virgo galaxies with K-band luminosity between 3*10^{10} and 3*10^{11}L_sun. To set the Iron abundances, we use an empirical galaxy ...

  14. Cluster fusion algorithm: application to Lennard-Jones clusters

    DEFF Research Database (Denmark)

    Solov'yov, Ilia; Solov'yov, Andrey V.; Greiner, Walter

    2008-01-01

    paths up to the cluster size of 150 atoms. We demonstrate that in this way all known global minima structures of the Lennard-Jones clusters can be found. Our method provides an efficient tool for the calculation and analysis of atomic cluster structure. With its use we justify the magic number sequence......We present a new general theoretical framework for modelling the cluster structure and apply it to description of the Lennard-Jones clusters. Starting from the initial tetrahedral cluster configuration, adding new atoms to the system and absorbing its energy at each step, we find cluster growing...... for the clusters of noble gas atoms and compare it with experimental observations. We report the striking correspondence of the peaks in the dependence of the second derivative of the binding energy per atom on cluster size calculated for the chain of the Lennard-Jones clusters based on the icosahedral symmetry...

  15. Cluster fusion algorithm: application to Lennard-Jones clusters

    DEFF Research Database (Denmark)

    Solov'yov, Ilia; Solov'yov, Andrey V.; Greiner, Walter

    2006-01-01

    paths up to the cluster size of 150 atoms. We demonstrate that in this way all known global minima structures of the Lennard-Jones clusters can be found. Our method provides an efficient tool for the calculation and analysis of atomic cluster structure. With its use we justify the magic number sequence......We present a new general theoretical framework for modelling the cluster structure and apply it to description of the Lennard-Jones clusters. Starting from the initial tetrahedral cluster configuration, adding new atoms to the system and absorbing its energy at each step, we find cluster growing...... for the clusters of noble gas atoms and compare it with experimental observations. We report the striking correspondence of the peaks in the dependence of the second derivative of the binding energy per atom on cluster size calculated for the chain of the Lennard-Jones clusters based on the icosahedral symmetry...

  16. Central rotations of Milky Way Globular Clusters

    CERN Document Server

    Fabricius, Maximilian H; Rukdee, Surangkhana; Saglia, Roberto P; Bender, Ralf; Hopp, Ulrich; Thomas, Jens; Opitsch, Michael; Williams, Michael J

    2014-01-01

    Most Milky Way globular clusters (GCs) exhibit measurable flattening, even if on a very low level. Both cluster rotation and tidal fields are thought to cause this flattening. Nevertheless, rotation has only been confirmed in a handful of GCs, based mostly on individual radial velocities at large radii. We are conducting a survey of the central kinematics of Galactic GCs using the new Integral Field Unit instrument VIRUS-W. We detect rotation in all 11 GCs that we have observed so far, rendering it likely that a large majority of the Milky Way GCs rotate. We use published catalogs of the ACS survey of GCs to derive central ellipticities and position angles. We show that in all cases where the central ellipticity permits an accurate measurement of the position angle, those angles are in excellent agreement with the kinematic position angles that we derive from the VIRUS-W velocity fields. We find an unexpected tight correlation between central rotation and outer ellipticity, indicating that rotation drives fla...

  17. Importance of Attenuation Correction (AC for Small Animal PET Imaging

    Directory of Open Access Journals (Sweden)

    Henrik H. El Ali

    2012-10-01

    Full Text Available The purpose of this study was to investigate whether a correction for annihilation photon attenuation in small objects such as mice is necessary. The attenuation recovery for specific organs and subcutaneous tumors was investigated. A comparison between different attenuation correction methods was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7 were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II. CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%, for kidneys 20 ± 1% (19–21%, and for bladder 18 ± 3% (15–21%. The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction.

  18. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  19. AC Impedance Behaviour of Black Diamond Films

    Institute of Scientific and Technical Information of China (English)

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN

    2005-01-01

    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  20. Faint Galaxies in deep ACS observations

    CERN Document Server

    Benítez, N; Bouwens, R; Menanteau, F; Blakeslee, J P; Gronwall, C; Illingworth, G D; Meurer, G; Broadhurst, T J; Clampin, M; Franx, M; Hartig, G F; Magee, D; Sirianni, M; Ardila, D R; Bartko, F; Brown, R A; Burrows, C J; Cheng, E S; Cross, N J G; Feldman, P D; Golimowski, D A; Infante, L; Kimble, R A; Krist, J E; Lesser, M P; Levay, Z G; Martel, A R; Miley, G K; Postman, M; Rosati, P; Sparks, W B; Tran, H D; Tsvetanov, Z I; Zheng, R L

    2003-01-01

    We present the analysis of the faint galaxy population in the Advanced Camera for Surveys (ACS) Early Release Observation fields VV 29 (UGC 10214) and NGC 4676. Here we attempt to thoroughly consider all aspects relevant for faint galaxy counting and photometry, developing methods which are based on public software and that are easily reproducible by other astronomers. Using simulations we determine the best SExtractor parameters for the detection of faint galaxies in deep HST observations, paying special attention to the issue of deblending, which significantly affects the normalization and shape of the number count distribution. We confirm, as claimed by Bernstein, Freedman and Madore (2002), that Kron-like magnitudes, such as the ones generated by SExtractor, can miss more than half of the light of faint galaxies, what dramatically affects the slope of the number counts. We present catalogs for the VV 29 and NGC 4676 fields with photometry in the g,V and I bands. We also show that combining the bayesian so...

  1. Globular Cluster Populations in Four Early-Type Poststarburst Galaxies

    CERN Document Server

    Maybhate, Aparna; Schweizer, Francois; Puzia, Thomas H; Carter, David

    2008-01-01

    We present a study of the globular cluster systems of four early-type poststarburst galaxies using deep g and I-band images from the ACS camera aboard the Hubble Space Telescope (HST). All the galaxies feature shells distributed around their main bodies and are thus likely merger remnants. The color distribution of the globular clusters in all four galaxies shows a broad peak centered on g-I ~ 1.4, while PGC 6240 and PGC 42871 show a significant number of globular clusters with g-I ~ 1.0. The latter globular clusters are interpreted as being of age ~ 500 Myr and likely having been formed in the merger. The color of the redder peak is consistent with that expected for an old metal-poor population that is very commonly found around normal galaxies. However, all galaxies except PGC 10922 contain several globular clusters that are significantly brighter than the maximum luminosity expected of a single old metal-poor population. To test for multiple-age populations of overlapping g-I color, we model the luminosity...

  2. Multiwavelength photometry in the Globular Cluster M2

    CERN Document Server

    Dalessandro, E; Lanzoni, B; Ferraro, F R; Schiavon, R; Rood, R T

    2009-01-01

    We present a multiwavelength photometric analysis of the globular cluster M2. The data-set has been obtained by combining high-resolution (HST/WFPC2 and ACS) and wide-field (GALEX) space observations and ground based (MEGACAM-CFHT, EMMI-NTT) images. The photometric sample covers the entire cluster extension from the very central regions up to the tidal radius and beyond. It allows an accurate determination of the cluster center of gravity and other structural parameters derived from the star count density profile. Moreover we study the BSS population and its radial distribution. A total of 123 BSS has been selected, and their radial distribution has been found to be bimodal (highly peaked in the center, decreasing at intermediate radii and rising outward), as already found in a number of other clusters. The radial position of the minimum of the BSS distribution is consistent with the radius of avoidance caused by the dynamical friction of massive objects over the cluster age. We also searched for gradients in...

  3. Analysis of Input and Output Ripples of PWM AC Choppers

    Directory of Open Access Journals (Sweden)

    Pekik Argo Dahono

    2008-11-01

    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  4. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  5. DC and AC biasing of a transition edge sensor microcalorimeter

    International Nuclear Information System (INIS)

    We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

  6. Study on radioimmunoassay of Bt Cry1Ac protein

    International Nuclear Information System (INIS)

    Bt Cry1Ac protein was extracted from incubation of Bacillus thuringiensis HD-73, and cutting into more specific protein segment with high insect-resistance. High-affinity multi-colonial antibodies of Bt Cry1 Ac protein were obtained after injected it into New Zealand rabbits. By 125I labeling of Bt Cry1 Ac protein, a RIA kit was established. In this method, centrifuge for separation was not necessary due to the use of magnetic micro-particle and the specifications of the kit were found equal to those of imported ELISA. (authors)

  7. An Improved AC-BM Algorithm for Monitoring Watch List

    Directory of Open Access Journals (Sweden)

    Mo Yiwen

    2013-07-01

    Full Text Available With the expanding of database of the watch list of anti-money laundering, improving the speed in matching between the watch list and the database of account holders and clients’ transaction is especially important. This paper proposes an improved AC-BM Algorithm, a matching algorithm of subsection, to improve the speed of matching. Experiment results show the time performance of the improved algorithm is better than traditional BM algorithm, AC algorithm and the AC-BM algorithm. It can improve the efficiency of on-line monitoring of anti-money laundering.  

  8. Cyclotron production of Ac-225 for targeted alpha therapy.

    Science.gov (United States)

    Apostolidis, C; Molinet, R; McGinley, J; Abbas, K; Möllenbeck, J; Morgenstern, A

    2005-03-01

    The feasibility of producing Ac-225 by proton irradiation of Ra-226 in a cyclotron through the reaction Ra-226(p,2n)Ac-225 has been experimentally demonstrated for the first time. Proton energies were varied from 8.8 to 24.8 MeV and cross-sections were determined by radiochemical analysis of reaction yields. Maximum yields were reached at incident proton energies of 16.8 MeV. Radiochemical separation of Ac-225 from the irradiated target yielded a product suitable for targeted alpha therapy of cancer.

  9. The rotation of Galaxy Clusters

    OpenAIRE

    Tovmassian, Hrant M.

    2015-01-01

    The method for detection of the galaxy cluster rotation based on the study of distribution of member galaxies with velocities lower and higher of the cluster mean velocity over the cluster image is proposed. The search for rotation is made for flat clusters with $a/b>1.8$ and BMI type clusters which are expected to be rotating. For comparison there were studied also round clusters and clusters of NBMI type, the second by brightness galaxy in which does not differ significantly from the cluste...

  10. Stellar populations in star clusters

    CERN Document Server

    Li, Chengyuan; Deng, Licai

    2016-01-01

    Stellar populations contain the most important information about star clus- ter formation and evolution. Until several decades ago, star clusters were believed to be ideal laboratories for studies of simple stellar populations (SSPs). However, discoveries of multiple stellar populations in Galactic globular clusters have expanded our view on stellar populations in star clusters. They have simultaneously generated a number of controversies, particularly as to whether young star clusters may have the same origin as old globular clusters. In addition, extensive studies have revealed that the SSP scenario does not seem to hold for some intermediate-age and young star clusters either, thus making the origin of multiple stellar populations in star clusters even more complicated. Stellar population anomalies in numerous star clusters are well-documented, implying that the notion of star clusters as true SSPs faces serious challenges. In this review, we focus on stellar populations in massive clusters with different ...

  11. The clustered nature of star formation. Pre--main-sequence clusters in the star-forming region NGC 602/N90 in the Small Magellanic Cloud

    CERN Document Server

    Gouliermis, Dimitrios A; Dolphin, Andrew E; Gennaro, Mario; Tognelli, Emanuele; Moroni, Pier Giorgio Prada

    2012-01-01

    Located at the tip of the wing of the Small Magellanic Cloud (SMC), the star-forming region NGC602/N90 is characterized by the HII nebular ring N90 and the young cluster of pre--main-sequence (PMS) and early-type main sequence stars NGC602. We present a thorough cluster analysis of the stellar sample identified with HST/ACS camera in the region. We show that apart from the central cluster, low-mass PMS stars are congregated in thirteen additional small compact sub-clusters at the periphery of NGC602. We find that the spatial distribution of the PMS stars is bimodal, with an unusually large fraction (~60%) of the total population being clustered, while the remaining is diffusely distributed in the inter-cluster area. From the corresponding color-magnitude diagrams we disentangle an age-difference of ~2.5Myr between NGC602 and the compact sub-clusters which appear younger. The diffuse PMS population appears to host stars as old as those in NGC602. Almost all detected PMS sub-clusters appear to be centrally conc...

  12. Clustering by Pattern Similarity

    Institute of Scientific and Technical Information of China (English)

    Hai-xun Wang; Jian Pei

    2008-01-01

    The task of clustering is to identify classes of similar objects among a set of objects. The definition of similarity varies from one clustering model to another. However, in most of these models the concept of similarity is often based on such metrics as Manhattan distance, Euclidean distance or other Lp distances. In other words, similar objects must have close values in at least a set of dimensions. In this paper, we explore a more general type of similarity. Under the pCluster model we proposed, two objects are similar if they exhibit a coherent pattern on a subset of dimensions. The new similarity concept models a wide range of applications. For instance, in DNA microarray analysis, the expression levels of two genes may rise and fall synchronously in response to a set of environmental stimuli. Although the magnitude of their expression levels may not be close, the patterns they exhibit can be very much alike. Discovery of such clusters of genes is essential in revealing significant connections in gene regulatory networks. E-commerce applications, such as collaborative filtering, can also benefit from the new model, because it is able to capture not only the closeness of values of certain leading indicators but also the closeness of (purchasing, browsing, etc.) patterns exhibited by the customers. In addition to the novel similarity model, this paper also introduces an effective and efficient algorithm to detect such clusters, and we perform tests on several real and synthetic data sets to show its performance.

  13. Clustering in bubbly liquids

    Science.gov (United States)

    Figueroa, Bernardo; Zenit, Roberto

    2004-11-01

    We are conducting experiments to determine the amount of clustering that occurs when small gas bubbles ascend in clean water. In particular, we are interested in flows for which the liquid motion around the bubbles can be described, with a certain degree of accuracy, using potential flow theory. This model is applicable for the case of bubbly liquids in which the Reynolds number is large and the Weber number is small. To clearly observe the formation of bubble clusters we propose the use of a Hele-Shaw-type channel. In this thin channel the bubbles cannot overlap in the depth direction, therefore the identification of bubble clusters cannot be misinterpreted. Direct video image analysis is performed to calculate the velocity and size of the bubbles, as well as the formation of clusters. Although the walls do affect the motion of the bubbles, the clustering phenomena does occur and has the same qualitative behavior as in fully three-dimensional flows. A series of preliminary measurements are presented. A brief discussion of our plans to perform PIV measurements to obtain the liquid velocity fields is also presented.

  14. Single-Phase Four Switch Z-Source AC-AC Converters%单相四开关Z源AC-AC变换器

    Institute of Scientific and Technical Information of China (English)

    汤雨; 谢少军; 张超华

    2007-01-01

    提出了一种单相四开关Z源AC-AC变换器,它包括电压型与电流型两类.与传统脉宽调制AC-AC变换器相比,它具有如下特点:输出电压范围宽且可升可降,输出电压与输入电压可同相或反相,冲击和谐波电流小,可靠性高.针对AC-AC变换器中固有的开关管换流问题,提出了一种适用于单相四开关Z源AC-AC变换器的换流方案,无需外加缓冲吸收电路即可实现开关管的安全换流.以电压型单相四开关Z源AC-AC变换器为例,对其进行了理论分析、仿真和原理试验研究.实验结果证实了Z源变换器的特性及换流方案的可行性.

  15. Signature of cluster disruption within magnetic fluid samples: The key information provided by low frequency alternating current susceptibility measurements

    Science.gov (United States)

    Du, Zhongzhou; Liu, Wenzhong; Zhong, Jing; Zhou, Ming; Zhang, Pu; Cesar Morais, Paulo

    2014-05-01

    This paper is focused on the signature of thermal-assisted cluster disruption while analyzing the inverse alternating current (AC) susceptibility (1/χ) versus temperature (T) curves recorded at lower AC frequencies (f), below 300 Hz. A commercial oil-based magnetic fluid (MF) sample was used in the experiments to investigate the critical temperature (T*) that characterizes the thermal disruption of aggregates suspended within the MF sample. T* was found to reduce as f increased within the frequency range of our investigation (63-263 Hz). Furthermore, T* was found to scale with the square of the applied AC frequency. Both theoretical and experimental evidences support that the excitation field frequency (f) dependence of the critical temperature (T*) is well described by T*(f)=T*(0)-Af/21+Bf2. The model is based on energy absorption of magnetic nanoparticles in an AC magnetic field.

  16. Bayesian Analysis of Two Stellar Populations in Galactic Globular Clusters II: NGC 5024, NGC 5272, and NGC 6352

    CERN Document Server

    Wagner-Kaiser, R; Robinson, E; von Hippel, T; Sarajedini, A; van Dyk, D A; Stein, N; Jefferys, W H

    2016-01-01

    We use Cycle 21 Hubble Space Telescope (HST) observations and HST archival ACS Treasury observations of Galactic Globular Clusters to find and characterize two stellar populations in NGC 5024 (M53), NGC 5272 (M3), and NGC 6352. For these three clusters, both single and double-population analyses are used to determine a best fit isochrone(s). We employ a sophisticated Bayesian analysis technique to simultaneously fit the cluster parameters (age, distance, absorption, and metallicity) that characterize each cluster. For the two-population analysis, unique population level helium values are also fit to each distinct population of the cluster and the relative proportions of the populations are determined. We find differences in helium ranging from $\\sim$0.05 to 0.11 for these three clusters. Model grids with solar $\\alpha$-element abundances ([$\\alpha$/Fe] =0.0) and enhanced $\\alpha$-elements ([$\\alpha$/Fe]=0.4) are adopted.

  17. Structure of Dark Matter and Baryons in AMIBA SZE Galaxy Clusters (II)

    Science.gov (United States)

    Ho, Paul

    2010-01-01

    We propose deep BR_cz' imaging with Suprime-Cam of several hot X-ray (> 8 keV) clusters of galaxies for which Sunyaev-Zel'dovich effect (SZE) observations are underway at 3mm with the Array for Microwave Background Anisotropy (AMiBA) and superb resolution HST/ACS strong lensing (SL) data are readily available. Joint weak lensing (WL), SL, multicolor imaging, and SZE observations, combined with archival X-ray data, will probe in a model-independent manner the structure of dark matter, member galaxies, and the hot cluster gas in rich cluster environments. Our targets are composed of a class of the most massive clusters at moderate redshifts (0.2 <~ z <~ 0.7), allowing us to derive reliable WL shape measurements and thus accurate mass profiles out to the cluster virial radius. Our proposal aims to (1) map out the mass distribution in clusters via WL techniques, and compare with the distributions of hot and cold baryonic components, (2) make an accurate determination of the cluster mass profile from a joint WL+SL analysis, (3) derive cluster gas-mass fraction profiles free from the hydrostatic equilibrium assumption, and (4) examine directly the cluster mass vs. SZE observable relation, which will provide an important basis for cosmological tests with upcoming blind SZE surveys.

  18. Clusters in Light Nuclei

    CERN Document Server

    Beck, C; Zafra, A Sanchez i; Thummerer, S; Azaiez, F; Bednarczyk, P; Courtin, S; Curien, D; Dorvaux, O; Goasduff, A; ~Lebhertz, D; Nourreddine, A; ~Rousseau, M; Salsac, M -D; von Oertzen, W; Gebauer, B; Wheldon, C; Kokalova, Tz; Efimov, G; Zherebchevsky, V; Schulz, Ch; Bohlen, H G; Kamanin, D; de Angelis, G; Gadea, A; Lenzi, S; Napoli, D R; Szilner, S; Milin, M; Catford, W N; Jenkins, D G; Royer, G

    2010-01-01

    A great deal of research work has been undertaken in the alpha-clustering study since the pioneering discovery, half a century ago, of 12C+12C molecular resonances. Our knowledge of the field of the physics of nuclear molecules has increased considerably and nuclear clustering remains one of the most fruitful domains of nuclear physics, facing some of the greatest challenges and opportunities in the years ahead. In this work, the occurence of "exotic" shapes in light N=Z alpha-like nuclei is investigated. Various approaches of superdeformed and hyperdeformed bands associated with quasimolecular resonant structures are presented. Results on clustering aspects are also discussed for light neutron-rich Oxygen isotopes.

  19. Dicty_cDB: FCL-AC22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC22 (Link to dictyBase) - G03266 DDB0186811 Contig-U14995-1 FCL-...AC22P (Link to Original site) FCL-AC22F 430 FCL-AC22Z 521 FCL-AC22P 951 - - Show FCL-AC22 Library FC...L (Link to library) Clone ID FCL-AC22 (Link to dictyBase) Atlas ID - NBRP ID G03266 dictyBase ID DDB0186811 ...Link to Contig Contig-U14995-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-...AC22Q.Seq.d/ Representative seq. ID FCL-AC22P (Link to Original site) Representative DNA sequence >FCL-

  20. Dicty_cDB: FCL-AC23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC23 (Link to dictyBase) - G01760 DDB0186002 Contig-U16043-1 FCL-...AC23P (Link to Original site) FCL-AC23F 132 FCL-AC23Z 582 FCL-AC23P 714 - - Show FCL-AC23 Library FC...L (Link to library) Clone ID FCL-AC23 (Link to dictyBase) Atlas ID - NBRP ID G01760 dictyBase ID DDB0186002 ...Link to Contig Contig-U16043-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-...AC23Q.Seq.d/ Representative seq. ID FCL-AC23P (Link to Original site) Representative DNA sequence >FCL-

  1. PROSPECTS OF MULTIFILAMENTARY SUPERCONDUCTOR AC 50 Hz APPLICATIONS

    OpenAIRE

    Hlásnik, I.

    1984-01-01

    It is shown that parameters of modern multifilamentary superconductors and their possible improvements allow their application to AC 50 Hz windings working at Bm of about 1 T and giving energy and total cost savings.

  2. Dc to ac converter operates efficiently at low input voltages

    Science.gov (United States)

    1965-01-01

    Self-oscillating dc to ac converter with transistor switching to produce a square wave output is used for low and high voltage power sources. The converter has a high efficiency throughout a wide range of loads.

  3. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  4. AC susceptibility of polycrystalline (Bi-Pb 2223 superconductors

    Directory of Open Access Journals (Sweden)

    H. Salamati

    2004-06-01

    Full Text Available   The temperature dependence of ac susceptibility of (Bi-Pb2223 polycrystalline samples was measured as a function of frequency and ac field amplitude. Analysis of the temperature dependence of the AC susceptibility near the transition temperature (Tc has been done employing Bean’s critical state model. The observed variation of intergranular critical current densities (Jc with temperature indicates that the weak links are superconductor- normal metal-superconductor (SNS type for this sample. The frequency effect on AC susceptibility was also measured. As the frequency increases, (TP shifts to higher temperatures. This effect can be interpreted in terms of flux creep. The temperature T, and field, , dependence of activation energy obtained from the Arrhenius plot for the frequency ( f and ( TP , can be described as: U(Hac,T=U0(1-T/TCHac-0.18

  5. A precursor of β-delayed fission:230Ac

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The 230Ra has been produced via multinucleon transfer and dissipativefragmentation of heavy target in the 60 MeV/u 18O ion reaction with natural thorium.The radium was radiochemically separated from irradiated thorium targets. 230Acwas obtained by 230Ra β-→ 230Ac. Thin Ra sources were prepared for observing fissionfragments from β-delayed fission of 230Ac. The sources were exposed to the micafission track detectors and measured by a HPGe γ detector. The two fission eventswere obtained and could been assigned to theβ-delayed fission of 230Ac. The β-delayedfission probability of 230Ac was determined to be (1.19+0.85) × 10-8.

  6. Vanadogermanate cluster anions.

    Science.gov (United States)

    Whitfield, T; Wang, X; Jacobson, A J

    2003-06-16

    Three novel vanadogermanate cluster anions have been synthesized by hydrothermal reactions. The cluster anions are derived from the (V(18)O(42)) Keggin cluster shell by substitution of V=O(2+) "caps" by Ge(2)O(OH)(2)(4+) species. In Cs(8)[Ge(4)V(16)O(42)(OH)(4)].4.7H(2)O, 1, (monoclinic, space group C2/c (No. 15), Z = 8, a = 44.513(2) A, b = 12.7632(7) A, c = 22.923(1) A, beta = 101.376(1) degrees ) and (pipH(2))(4)(pipH)(4)[Ge(8)V(14)O(50).(H(2)O)] (pip = C(4)N(2)H(10)), 2 (tetragonal, space group P4(2)/nnm (No. 134), Z = 2, a = 14.9950(7) A, c = 18.408(1) A), two and four VO(2+) caps are replaced, respectively, and each cluster anion encapsulates a water molecule. In K(5)H(8)Ge(8)V(12)SO(52).10H(2)O, 3, (tetragonal, space group I4/m (No. 87), Z = 2, a = 15.573(1) A, c = 10.963(1) A), four VO(2+) caps are replaced by Ge(2)O(OH)(2)(4+) species, and an additional two are omitted. The cluster ion in 3 contains a sulfate anion disordered over two positions. The cluster anions are analogous to the vanadoarsenate anions [V(18)(-)(n)()As(2)(n)()O(42)(X)](m)(-) (X = SO(3), SO(4), Cl; n = 3, 4) previously reported. PMID:12793808

  7. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Directory of Open Access Journals (Sweden)

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  8. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Directory of Open Access Journals (Sweden)

    Kerry N. Allahar

    2014-01-01

    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  9. Molecular dynamics simulation of gold cluster growth during sputter deposition

    Science.gov (United States)

    Abraham, J. W.; Strunskus, T.; Faupel, F.; Bonitz, M.

    2016-05-01

    We present a molecular dynamics simulation scheme that we apply to study the time evolution of the self-organized growth process of metal cluster assemblies formed by sputter-deposited gold atoms on a planar surface. The simulation model incorporates the characteristics of the plasma-assisted deposition process and allows for an investigation over a wide range of deposition parameters. It is used to obtain data for the cluster properties which can directly be compared with recently published experimental data for gold on polystyrene [M. Schwartzkopf et al., ACS Appl. Mater. Interfaces 7, 13547 (2015)]. While good agreement is found between the two, the simulations additionally provide valuable time-dependent real-space data of the surface morphology, some of whose details are hidden in the reciprocal-space scattering images that were used for the experimental analysis.

  10. Refractory chronic cluster headache

    DEFF Research Database (Denmark)

    Mitsikostas, Dimos D; Edvinsson, Lars; Jensen, Rigmor H;

    2014-01-01

    for clinical and research use. The preparation of the final consensus followed three stages. Internal between authors, a larger between all European Headache Federation members and finally an international one among all investigators that have published clinical studies on cluster headache the last five years......Chronic cluster headache (CCH) often resists to prophylactic pharmaceutical treatments resulting in patients' life damage. In this rare but pragmatic situation escalation to invasive management is needed but framing criteria are lacking. We aimed to reach a consensus for refractory CCH definition...

  11. Kinematics of Clustering

    CERN Document Server

    Wang, Steven; Metcalfe, Guy; Wu, Jie

    2014-01-01

    The dynamical system for inertial particles in fluid flow has both attracting and repelling regions, the interplay of which can localize particles. In laminar flow experiments we find that particles, initially moving throughout the fluid domain, can undergo an instability and cluster into subdomains of the fluid when the flow Reynolds number exceeds a critical value that depends on particle and fluid inertia. We derive an expression for the instability boundary and for a universal curve that describes the clustering rate for all particles.

  12. South Asian Cluster

    Directory of Open Access Journals (Sweden)

    Ionel Sergiu Pirju

    2014-12-01

    Full Text Available This article aims at presenting the South Asian cluster composed of India, Indonesia, Iran and Malaysia, the intercultural values that characterizes it, the supported leadership style and tracing the main macroeconomic considerations which characterizes them. The research is synchronic, analysing the contemporary situation of these countries without reference to their evolution in time, by using the positivist paradigm that explains the reality at one point. It will be analysed the overall cluster with the existing interactions between the countries that composes it, while the article being one of information will avoid building recommendation, or new theories.

  13. Cluster's last stand?

    OpenAIRE

    Lockwood, Mike

    1997-01-01

    On 4 June last year the first attempt to make three-dimensional measurements in space was lost when the Ariane 5 rocket veered off course and self-destructed, 39 s into its maiden flight. On board were four identical spacecraft which made up Cluster,a mission that the European Space Agency called a “cornerstone” of its Horizon 2000 scientific programme. A full description of the Cluster satellites is given in a special issue of Space Science Reviews (Escoubet et al. 1997). Their loss de...

  14. Clustering Game Behavior Data

    DEFF Research Database (Denmark)

    Bauckhage, C.; Drachen, Anders; Sifa, Rafet

    2015-01-01

    and other techniques for player profiling and play style analysis have, therefore, become popular in the nascent field of game analytics. However, the proper use of clustering techniques requires expertise and an understanding of games is essential to evaluate results. With this paper, we address game data...... scientists and present a review and tutorial focusing on the application of clustering techniques to mine behavioral game data. Several algorithms are reviewed and examples of their application shown. Key topics such as feature normalization are discussed and open problems in the context of game analytics...

  15. Development of the Field of Flexible AC Transmission Systems (FACTS)

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ Theoretical and technological development of large capacity power electronics and flexible AC transmission systems are one of the most important projects developed by Tsinghua University. The Flexible AC Transmission System (FACTS) technology which uses power electronics to improve the efficiency and quality of the electrical generation, transmission and distribution system is considered to be one of the most significant technological innovations for power systems in the 20th century. The advanced static var generator (ASVG) is a key FACTS device.

  16. Muc5ac mucin expression during rat skin development

    OpenAIRE

    V. Ferretti; Á. Segal-Eiras; Barbeito, C.G.; Croce, M. V.

    2015-01-01

    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days...

  17. Dynamics of a nanowire superlattice in an ac electric field

    OpenAIRE

    Zhang, Aizhen; Voon, L. C. Lew Yan; M. Willatzen

    2005-01-01

    With a one-band envelope function theory, we investigate the dynamics of a finite nanowire superlattice driven by an ac electric field by solving numerically the time-dependent Schroedinger equation. We find that for an ac electric field resonant with two energy levels located in two different minibands, the coherent dynamics in nanowire superlattices is much more complex as compared to the standard two-level description. Depending on the energy levels involved in the transitions, the coheren...

  18. Theory of the ac spin-valve effect

    OpenAIRE

    Kochan, Denis; Gmitra, Martin; Fabian, Jaroslav

    2011-01-01

    The spin-valve complex magnetoimpedance of symmetric ferromagnet/normal metal/ferromagnet junctions is investigated within the drift-diffusion (standard) model of spin injection. The ac magnetoresistance---the real part difference of the impedances of the parallel and antiparallel magnetization configurations---exhibits an overall damped oscillatory behavior, as an interplay of the diffusion and spin relaxation times. In wide junctions the ac magnetoresistance oscillates between positive and ...

  19. Fractal AC circuits and propagating waves on fractals

    CERN Document Server

    Akkermans, Eric; Dunne, Gerald; Rogers, Luke G; Teplyaev, Alexander

    2015-01-01

    We extend Feynman's analysis of the infinite ladder AC circuit to fractal AC circuits. We show that the characteristic impedances can have positive real part even though all the individual impedances inside the circuit are purely imaginary. This provides a physical setting for analyzing wave propagation of signals on fractals, by analogy with the Telegrapher's Equation, and generalizes the real resistance metric on a fractal, which provides a measure of distance on a fractal, to complex impedances.

  20. AC resistivity of d-wave ceramic superconductors

    OpenAIRE

    Li, Mai Suan; Dominguez, Daniel

    2000-01-01

    We model d-wave ceramic superconductors with a three-dimensional lattice of randomly distributed $\\pi$ Josephson junctions with finite self-inductance. The linear and nonlinear ac resistivity of the d-wave ceramic superconductors is obtained as function of temperature by solving the corresponding Langevin dynamical equations. We find that the linear ac resistivity remains finite at the temperature $T_p$ where the third harmonics of resistivity has a peak. The current amplitude dependence of t...

  1. An Emerge Approach in Inter Cluster Similarity for Quality Clusters

    Directory of Open Access Journals (Sweden)

    H. Venkateswara Reddy

    2013-04-01

    Full Text Available Relationship between the datasets is one most important issue in recent years. The recent methods are based mostly on the numerical data, but these methods are not suitable for real time data such as web pages, business transactions etc., which are known as Categorical data. It is difficult to find relationship in categorical data. In this paper, a new approach is proposed for finding the relationshipbetween the categorical data, hence to find relationship between the clusters. The main aim is to identify the quality clusters based on the relationship between clusters. If there is no relationship between clusters then those clusters are treated as quality clusters.

  2. Update on bedside ultrasound (US) diagnosis of acute cholecystitis (AC).

    Science.gov (United States)

    Zenobii, Maria Francesca; Accogli, Esterita; Domanico, Andrea; Arienti, Vincenzo

    2016-03-01

    Acute cholecystitis (AC) represents a principal cause of morbidity worldwide and is one of the most frequent reasons for hospitalization due to gastroenteric tract diseases. AC should be suspected in presence of clinical signs and of gallstones on an imaging study. Upper abdominal US represents the first diagnostic imaging step in the case of suspected AC. Computed tomography (CT) with intravenous contrast (IV) or magnetic resonance imaging (MRI) with gadolinium contrast and technetium hepatobiliary iminodiacetic acid (Tc-HIDA) can be employed to exclude complications. US examination should be performed with right subcostal oblique, with longitudinal and intercostal scans. Normal gallbladder US findings and AC major and minor US signs are described. Polyps, sludge and gallbladder wall thickening represent the more frequent pitfalls and they must be differentiated from stones, duodenal artifacts and many other non-inflammatory conditions that cause wall thickening, respectively. By means of bedside ultrasound, the finding of gallstones in combination with acute pain, when the clinician presses the gallbladder with the US probe (the sonographic Murphy's sign), has a 92.2 % positive predictive value for AC. In our preliminary experience, bedside US-performed by echoscopy (ES) and/or point-of-care US (POCUS) demonstrated good reliability in detecting signs of AC, and was always integrated with physical examination and performed by a skilled operator.

  3. AC electrophoretic deposition of organic-inorganic composite coatings.

    Science.gov (United States)

    Yoshioka, T; Chávez-Valdez, A; Roether, J A; Schubert, D W; Boccaccini, A R

    2013-02-15

    Alternating current electrophoretic deposition (AC-EPD) of polyacrylic acid (PAA)-titanium oxide (TiO(2)) nanoparticle composites on stainless steel electrodes was investigated in basic aqueous solution. AC square wave with duty cycle of 80% was applied at a frequency of 1 kHz. FTIR-ATR spectra showed that both AC and direct current (DC) EPD successfully deposited PAA-TiO(2) composites. The deposition rate using AC-EPD was lower than that obtained in direct current DC-EPD. However, the microstructure and surface morphology of the deposited composite coatings were different depending on the type of electric field applied. AC-EPD applied for not more than 5 min led to smooth films without bubble formation, while DC-EPD for 1 min or more showed deposits with microstructural defects possibly as result of water electrolysis. AC-EPD was thus for the first time demonstrated to be a suitable technique to deposit organic-inorganic composite coatings from aqueous suspensions, showing that applying a square wave and frequency of 1 kHz leads to uniform PAA-TiO(2) composite coatings on conductive materials.

  4. Temperature integration at the AC thermosensory neurons in Drosophila.

    Science.gov (United States)

    Tang, Xin; Platt, Michael D; Lagnese, Christopher M; Leslie, Jennifer R; Hamada, Fumika N

    2013-01-16

    Temperature sensation has a strong impact on animal behavior and is necessary for animals to avoid exposure to harmful temperatures. It is now well known that thermoTRP (transient receptor potential) channels in thermosensory neurons detect a variable range of temperature stimuli. However, little is known about how a range of temperature information is relayed and integrated in the neural circuits. Here, we show novel temperature integration between two warm inputs via Drosophila TRPA channels, TRPA1 and Pyrexia (Pyx). The internal AC (anterior cell) thermosensory neurons, which express TRPA1, detect warm temperatures and mediate temperature preference behavior. We found that the AC neurons were activated twice when subjected to increasing temperatures. The first response was at ∼25°C via TRPA1 channel, which is expressed in the AC neurons. The second response was at ∼27°C via the second antennal segments, indicating that the second antennal segments are involved in the detection of warm temperatures. Further analysis reveals that pyx-Gal4-expressing neurons have synapses on the AC neurons and that mutation of pyx eliminates the second response of the AC neurons. These data suggest that AC neurons integrate both their own TRPA1-dependent temperature responses and a Pyx-dependent temperature response from the second antennal segments. Our data reveal the first identification of temperature integration, which combines warm temperature information from peripheral to central neurons and provides the possibility that temperature integration is involved in the plasticity of behavioral outputs.

  5. A Novel High Performance Bridgeless Ac-Dc Boost Converter

    Directory of Open Access Journals (Sweden)

    S.M.AshrafulAlam Mohon

    2016-08-01

    Full Text Available A new single phase high performance bridgeless AC-DC Boost converter is proposed. The converter is made bridgeless by the use of two unidirectional switches and two diodes at the input ac side for power conversion for both positive and negative half cycle. Because of the high frequency switching, the power factor of the circuit is inherently corrected and it requires a small filter to make the input current near sinusoidal with limited THD. The significant improvement in THD makes the circuit a good choice in applications needing AC-DC conversion with power conditioning. The circuit exhibits such better performances than conventional AC-DC boost converter with variable loads at constant frequency switching with no additional control circuits. The efficiency of the circuit is also satisfactory. Analysis and simulation results of the circuit are obtained by using software simulation. The main advantage of this new AC-DC converter is its superior power quality over conventional AC-DC boost converter

  6. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  7. Combining cluster number counts and galaxy clustering

    CERN Document Server

    Lacasa, Fabien

    2016-01-01

    We present a detailed modelling of the joint covariance matrix between cluster number counts and the galaxy angular power spectrum. To this end, we use a Halo Model framework complemented by a Halo Occupation Distribution model (HOD), and we work in full-sky. We demonstrate the importance of accounting for non-Gaussianity to produce accurate covariance predictions, as the Gaussian part of the covariance can in fact become subdominant in certain configurations. We discuss in particular the case of the super-sample covariance (SSC), including the effects of galaxy shot-noise, halo second order bias and non-local bias, and demonstrating interesting mathematical properties. Using the joint covariance matrix and a Fisher matrix methodology, we examine the prospects of combining these two probes to constrain cosmological and HOD parameters. We find that the combination indeed results in noticeable better constraints, in particular because the cross-covariance introduces a synergy between the probes on small scales....

  8. Localized attack on clustering networks

    CERN Document Server

    Dong, Gaogao; Du, Ruijin; Shao, Shuai; Stanley, H Eugene; Shlomo, Havlin

    2016-01-01

    Clustering network is one of which complex network attracting plenty of scholars to discuss and study the structures and cascading process. We primarily analyzed the effect of clustering coefficient to other various of the single clustering network under localized attack. These network models including double clustering network and star-like NON with clustering and random regular (RR) NON of ER networks with clustering are made up of at least two networks among which exist interdependent relation among whose degree of dependence is measured by coupling strength. We show both analytically and numerically, how the coupling strength and clustering coefficient effect the percolation threshold, size of giant component, critical coupling point where the behavior of phase transition changes from second order to first order with the increase of coupling strength between the networks. Last, we study the two types of clustering network: one type is same with double clustering network in which each subnetwork satisfies ...

  9. Projection effects in cluster catalogues

    CERN Document Server

    Van Haarlem, M P; White, S D M

    1997-01-01

    We investigate the importance of projection effects in the identification of galaxy clusters in 2D galaxy maps and their effect on the estimation of cluster velocity dispersions. A volume limited galaxy catalogue that was derived from a Standard CDM N-body simulation was used. We select clusters using criteria that match those employed in the construction of real cluster catalogues and find that our mock Abell cluster catalogues are heavily contaminated and incomplete. Over one third (34 per cent) of clusters of richness class R>=1 are miclassifications arising from the projection of one or more clumps onto an intrinsically poor cluster. Conversely, 32 per cent of intrinsically rich clusters are missed from the R>=1 catalogues, mostly because of statistical fluctuations in the background count. Selection by X-ray luminosity rather than optical richness reduces, but does not completely eliminate, these problems. Contamination by unvirialised sub-clumps near a cluster leads to a considerable overestimation of t...

  10. Clustering of resting state networks.

    Directory of Open Access Journals (Sweden)

    Megan H Lee

    Full Text Available BACKGROUND: The goal of the study was to demonstrate a hierarchical structure of resting state activity in the healthy brain using a data-driven clustering algorithm. METHODOLOGY/PRINCIPAL FINDINGS: The fuzzy-c-means clustering algorithm was applied to resting state fMRI data in cortical and subcortical gray matter from two groups acquired separately, one of 17 healthy individuals and the second of 21 healthy individuals. Different numbers of clusters and different starting conditions were used. A cluster dispersion measure determined the optimal numbers of clusters. An inner product metric provided a measure of similarity between different clusters. The two cluster result found the task-negative and task-positive systems. The cluster dispersion measure was minimized with seven and eleven clusters. Each of the clusters in the seven and eleven cluster result was associated with either the task-negative or task-positive system. Applying the algorithm to find seven clusters recovered previously described resting state networks, including the default mode network, frontoparietal control network, ventral and dorsal attention networks, somatomotor, visual, and language networks. The language and ventral attention networks had significant subcortical involvement. This parcellation was consistently found in a large majority of algorithm runs under different conditions and was robust to different methods of initialization. CONCLUSIONS/SIGNIFICANCE: The clustering of resting state activity using different optimal numbers of clusters identified resting state networks comparable to previously obtained results. This work reinforces the observation that resting state networks are hierarchically organized.

  11. Controlo de um conversor AC-DC-AC para turbinas eólicas baseadas no PMSG

    OpenAIRE

    Bulhosa, João Paulo Rodrigues

    2009-01-01

    A dissertação teve como objectivo o estudo e implementação do controlo de um conversor AC-DC-AC, constituído por um conversor DC/DC elevador e um inversor de tensão monofásico, para efectuar a ligação à rede de turbinas eólicas baseadas no gerador síncrono de ímanes permanentes. O controlo global do conversor AC-DC-AC seguiu uma estratégia na qual o controlo do conversor elevador e do inversor de tensão monofásico é implementado de modo independente. O primeiro visa maximizar a potência ex...

  12. Study on AC/A ratio in myopia%近视患者AC/A率的临床意义

    Institute of Scientific and Technical Information of China (English)

    肖婉莉; 孙建宁

    2011-01-01

    目的:探讨AC/A率在近视发生发展中的作用及机制.方法:选择30名正视眼者(正视眼组)及90名近视眼者.对近视眼者根据屈光程度分为轻、中、高度近视眼3组;根据平时戴镜情况,分为从未戴镜、间断戴镜和持续戴镜组.采用同视机法测量AC/A率并进行分析和比较.结果:轻度近视眼组AC/A率平均值为(3.22±1.51)Δ/D,中度(3.46±1.00)Δ/D,高度(3.97±1.36)Δ/D,均高于正视眼组(P<0.05).从未戴镜组AC/A率高于间断戴镜及持续戴镜组(P<0.05).结论:近视患者高AC/A率是调节与辐辏功能不协调的一种表现,高AC/A率可导致眼球近视性改变.近视患者应进行矫正,恢复调节与辐辏的平衡.%Objective: To assess the difterence of accommodative convergence to accommodation (AC/A) ratio in myopia and emmetropia, then evaluate the relationship between AC/A ratio and myopia. Methods: Thirty emmetropia and 90 myopia cases were included in this study. The myopia cases were divided into mild myopia,moderate myopia and high myopia. The AC/A ratios were measured with a synoptophore, and the results were analyzed. Results: Average values of mild myopia group, moderate myopia group and high myopia group were (3.22 ± 1.51 ) Δ/D, (3.46 ± 1.00) Δ/D, (3.46 ± 1.00) Δ/D, a significant difference was found between each group and emmetropia group ( P < 0.05 ). The AC/A ratio of non- wearing glasses group was higher than that of discontinuous wearing and continued wearing glasses group. Conclusion: The increased AC/A ratio represents the incoordination of accommodations and convergences, which can lead to an aggravation of myopia, which should be readjusted.

  13. PVM Support for Clusters

    Science.gov (United States)

    Springer, P.

    2000-01-01

    The latest version of PVM (3.4.3) now contains support for a PC cluster running Linux, also known as a Beowulf system. A PVM user of a computer outside the Beowulf system can add the Beowulf as a single machine.

  14. Evolution of Galaxy Clustering

    OpenAIRE

    Bagla, J. S.

    1997-01-01

    We show that the galaxy correlation function does not evolve in proportion with the correlation function of the underlying mass distribution. Earliest galaxies cluster very strongly and the amplitude of the galaxy correlation function decreases from this large value. This continues till the average peaks have collapsed, after which, the galaxy correlation function does not evolve very strongly.

  15. Fuzzy clustering of mechanisms

    Indian Academy of Sciences (India)

    Amitabha Ghosh; Dilip Kumar Pratihar; M V V Amarnath; Guenter Dittrich; Jorg Mueller

    2012-10-01

    During the course of development of Mechanical Engineering, a large number of mechanisms (that is, linkages to perform various types of tasks) have been conceived and developed. Quite a few atlases and catalogues were prepared by the designers of machines and mechanical systems. However, often it is felt that a clustering technique for handling the list of large number of mechanisms can be very useful,if it is developed based on a scientific principle. In this paper, it has been shown that the concept of fuzzy sets can be conveniently used for this purpose, if an adequate number of properly chosen attributes (also called characteristics) are identified. Using two clustering techniques, the mechanisms have been classified in the present work and in future, it may be extended to develop an expert system, which can automate type synthesis phase of mechanical design. To the best of the authors’ knowledge, this type of clustering of mechanisms has not been attempted before. Thus, this is the first attempt to cluster the mechanisms based on some quantitative measures. It may help the engineers to carry out type synthesis of the mechanisms.

  16. Clustering under Perturbation Resilience

    CERN Document Server

    Balcan, Maria Florina

    2011-01-01

    Recently, Bilu and Linial \\cite{BL} formalized an implicit assumption often made when choosing a clustering objective: that the optimum clustering to the objective should be preserved under small multiplicative perturbations to distances between points. They showed that for max-cut clustering it is possible to circumvent NP-hardness and obtain polynomial-time algorithms for instances resilient to large (factor $O(\\sqrt{n})$) perturbations, and subsequently Awasthi et al. \\cite{ABS10} considered center-based objectives, giving algorithms for instances resilient to O(1) factor perturbations. In this paper, we greatly advance this line of work. For the $k$-median objective, we present an algorithm that can optimally cluster instances resilient to $(1 + \\sqrt{2})$-factor perturbations, solving an open problem of Awasthi et al.\\cite{ABS10}. We additionally give algorithms for a more relaxed assumption in which we allow the optimal solution to change in a small $\\epsilon$ fraction of the points after perturbation. ...

  17. Clustering high dimensional data

    DEFF Research Database (Denmark)

    Assent, Ira

    2012-01-01

    High-dimensional data, i.e., data described by a large number of attributes, pose specific challenges to clustering. The so-called ‘curse of dimensionality’, coined originally to describe the general increase in complexity of various computational problems as dimensionality increases, is known to...

  18. Detecting alternative graph clusterings.

    Science.gov (United States)

    Mandala, Supreet; Kumara, Soundar; Yao, Tao

    2012-07-01

    The problem of graph clustering or community detection has enjoyed a lot of attention in complex networks literature. A quality function, modularity, quantifies the strength of clustering and on maximization yields sensible partitions. However, in most real world networks, there are an exponentially large number of near-optimal partitions with some being very different from each other. Therefore, picking an optimal clustering among the alternatives does not provide complete information about network topology. To tackle this problem, we propose a graph perturbation scheme which can be used to identify an ensemble of near-optimal and diverse clusterings. We establish analytical properties of modularity function under the perturbation which ensures diversity. Our approach is algorithm independent and therefore can leverage any of the existing modularity maximizing algorithms. We numerically show that our methodology can systematically identify very different partitions on several existing data sets. The knowledge of diverse partitions sheds more light into the topological organization and helps gain a more complete understanding of the underlying complex network.

  19. Galactic Open Clusters

    CERN Document Server

    Von Hippel, T

    2005-01-01

    The study of open clusters has a classic feel to it since the subject predates anyone alive today. Despite the age of this topic, I show via an ADS search that its relevance and importance in astronomy has grown faster in the last few decades than astronomy in general. This is surely due to both technical reasons and the interconnection of the field of stellar evolution to many branches of astronomy. In this review, I outline what we know today about open clusters and what they have taught us about a range of topics from stellar evolution to Galactic structure to stellar disk dissipation timescales. I argue that the most important astrophysics we have learned from open clusters is stellar evolution and that its most important product has been reasonably precise stellar ages. I discuss where open cluster research is likely to go in the next few years, as well as in the era of 20m telescopes, SIM, and GAIA. Age will continue to be of wide relevance in astronomy, from cosmology to planet formation timescales, an...

  20. Disentangling Porterian Clusters

    DEFF Research Database (Denmark)

    Jagtfelt, Tue

    intertwined and that Porter’s consciously paradigmatic textbook very likely gained worldwide influence due to two interrelated factors. The first factor is the deliberately holistic gestalt figure propounded in Nations, which prompted scientific communities to pursue cluster research; the second factor...

  1. Curriculum Guide Construction Cluster.

    Science.gov (United States)

    Kline, Ken

    As part of a model construction cluster curriculum development project, this guide was developed and implemented in the Beaverton (Oregon) School District. The curriculum guide contains 16 units covering the following topics: introduction to construction jobs; safety and first aid; blueprint readings; basic mathematics; site work; framing; roofing…

  2. Data clustering algorithms and applications

    CERN Document Server

    Aggarwal, Charu C

    2013-01-01

    Research on the problem of clustering tends to be fragmented across the pattern recognition, database, data mining, and machine learning communities. Addressing this problem in a unified way, Data Clustering: Algorithms and Applications provides complete coverage of the entire area of clustering, from basic methods to more refined and complex data clustering approaches. It pays special attention to recent issues in graphs, social networks, and other domains.The book focuses on three primary aspects of data clustering: Methods, describing key techniques commonly used for clustering, such as fea

  3. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  4. Quartile Clustering: A quartile based technique for Generating Meaningful Clusters

    CERN Document Server

    Goswami, Saptarsi

    2012-01-01

    Clustering is one of the main tasks in exploratory data analysis and descriptive statistics where the main objective is partitioning observations in groups. Clustering has a broad range of application in varied domains like climate, business, information retrieval, biology, psychology, to name a few. A variety of methods and algorithms have been developed for clustering tasks in the last few decades. We observe that most of these algorithms define a cluster in terms of value of the attributes, density, distance etc. However these definitions fail to attach a clear meaning/semantics to the generated clusters. We argue that clusters having understandable and distinct semantics defined in terms of quartiles/halves are more appealing to business analysts than the clusters defined by data boundaries or prototypes. On the samepremise, we propose our new algorithm named as quartile clustering technique. Through a series of experiments we establish efficacy of this algorithm. We demonstrate that the quartile clusteri...

  5. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax development in the Indian malaria vector Anopheles culicifacies (Diptera: culicidae)

    Indian Academy of Sciences (India)

    Manoj Chugh; B R Gulati; S K Gakhar

    2010-03-01

    A repertoire of monoclonal antibodies (mAbs) was generated against the midgut proteins of Anopheles culicifacies mosquitoes. The mAbs AC-43 and AC-29 significantly inhibited Plasmodium vivax development inside the mosquito midgut. The number of oocysts that developed was reduced by 78.6% when mosquitoes ingested a combination of these two mAbs along with the blood meal. AC-43 mAb binds to the epitope common in 97, 80 and 43 kDa polypeptides from the midgut protein extract, as indicated by western blot analysis. Similarly, the mAb AC-29 recognized 52, 44, 40 and 29 kDa polypeptides. These female midgut-specific polypeptides are shared between An. culicifacies and An. stephensi, two major vectors of malaria in India. Deglycosylation assays revealed that -linked carbohydrates are the major components in epitopes corresponding to AC-43 and AC-29. Gold particle labelling revealed that both these mAbs preferentially bind to glycoproteins at the apical microvilli and the microvillus-associated network present inside transverse sections of the gut epithelium. These regions are particularly known to have receptors for ookinetes, which enable them to cross this epithelial barrier and provide them with certain necessary chemicals or components for further development into oocysts. Therefore, these glycoproteins appear to be potential candidates for a vectordirected transmission-blocking vaccine (TBV).

  6. Perceptions of breath alcohol concentration (BrAC) levels among a sample of bar patrons with BrAC values of 0.08% or higher.

    Science.gov (United States)

    Martin, Ryan J; Chaney, Beth H; Cremeens-Matthews, Jennifer; Vail-Smith, Karen

    2016-09-01

    Breath alcohol concentration (BrAC) is a commonly used measure of alcohol intoxication. Because of the potential negative consequences of excessive alcohol consumption, it is important to examine how accurately intoxicated individuals can estimate their BrAC values, especially individuals over the legal BrAC driving threshold (i.e., 0.08%). To better understand perceptions of BrAC values among intoxicated individuals, this field study examined actual BrAC values and BrAC range estimates (0.08% and above, 0.02-0.07%, less than 0.02%) among a sample of bar patrons (N = 454) with BrAC levels at 0.08% or higher. Bivariate and multivariate analyses were conducted to examine the relationship between actual BrAC values and perceived BrAC levels. We also examined whether the following demographic and drinking variables were associated with underestimating BrAC in this sample: gender, age, race, college student status, plans to get home, and hazardous drinking. Results indicated that the majority (60.4%) of participants underestimated their BrAC (i.e., less than 0.08%) and lower BrAC values correlated with underestimating BrAC ranges (p young (less than 21) intoxicated females are a group at high risk for sexual assault on college campuses. (PsycINFO Database Record PMID:27631614

  7. 21 CFR 880.6320 - AC-powered medical examination light.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate...

  8. The Rotation of Galaxy Clusters

    Science.gov (United States)

    Tovmassian, H. M.

    2015-09-01

    The method for detection of the galaxy cluster rotation based on the study of distribution of member galaxies with velocities lower and higher than the cluster mean velocity over the cluster image is proposed. The search for rotation is made for flat clusters with a/b > 1.8 and BMI type clusters which are expected to be rotating. For comparison there were studied also round clusters and clusters of NBMI type, the second by brightness galaxy, which does not differ significantly from the cluster cD galaxy. Seventeen out of studied 65 clusters are found to be rotating. It was found that the detection rate is sufficiently high for flat clusters, over 60%, and clusters of BMI type with dominant cD galaxy, ≈ 35% . The obtained results show that clusters were formed from the huge primordial gas clouds and preserved the rotation of the primordial clouds, unless they did not experience mergings with other clusters and groups of galaxies, as a result of which the rotation was prevented.

  9. The rotation of Galaxy Clusters

    CERN Document Server

    Tovmassian, Hrant M

    2015-01-01

    The method for detection of the galaxy cluster rotation based on the study of distribution of member galaxies with velocities lower and higher of the cluster mean velocity over the cluster image is proposed. The search for rotation is made for flat clusters with $a/b>1.8$ and BMI type clusters which are expected to be rotating. For comparison there were studied also round clusters and clusters of NBMI type, the second by brightness galaxy in which does not differ significantly from the cluster cD galaxy. Seventeen out of studied 65 clusters are found to be rotating. It was found that the detection rate is sufficiently high for flat clusters, over 60\\%, and clusters of BMI type with dominant cD galaxy, ~ 35%. The obtained results show that clusters were formed from the huge primordial gas clouds and preserved the rotation of the primordial clouds, unless they did not have merging with other clusters and groups of galaxies, in the result of which the rotation has been prevented.

  10. The role of the artificial conductivity in SPH simulations of galaxy clusters: effects on the ICM properties

    CERN Document Server

    Biffi, Veronica

    2014-01-01

    We study the thermal structure of the intra-cluster medium (ICM) in a set of cosmological hydrodynamical cluster simulations performed with an SPH numerical scheme employing an artificial conductivity (AC) term. We explore the effects of this term on the ICM temperature and entropy profiles, thermal distribution, velocity field and expected X-ray emission. We find that in adiabatic runs the artificial conductivity favours (i) the formation of an entropy core, raising and flattening the central entropy profiles, in better agreement with findings from Eulerian codes; and (ii) a systematic reduction of the cold gas component. In fact, the cluster large-scale structure and dynamical state are preserved across different runs, but the improved gas mixing enabled by the AC term strongly increases the stripping rate of gas from the cold clumps moving through the ICM. This in turn reduces the production of turbulence generated by the instabilities which develop because of the interaction between clumps and ambient ICM...

  11. Single-cluster dynamics for the random-cluster model

    NARCIS (Netherlands)

    Deng, Y.; Qian, X.; Blöte, H.W.J.

    2009-01-01

    We formulate a single-cluster Monte Carlo algorithm for the simulation of the random-cluster model. This algorithm is a generalization of the Wolff single-cluster method for the q-state Potts model to noninteger values q>1. Its results for static quantities are in a satisfactory agreement with those

  12. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...... to minimize the overall energy cost or in case of special applications, to improve the system redundancy. Also, having a generator that can simultaneously feed fractions of its power into multiple grids which are not coupled (different voltage, frequency, displacement angle) and continuously adjust...

  13. An Efficient Parallel Solution Framework for the Linear Solution of Large Systems on PC Clusters

    Institute of Scientific and Technical Information of China (English)

    Ozgur Kurc; Semih Ozmen

    2008-01-01

    In this paper,a parallel solution framework for the linear static analysis of large structures on PC clusters is presented.The framework consists of two main steps:data preparation and parallel solution.The parallel solution is performed by a substructure based method with direct solvers.The aim of the data prepa-ration step is to create the best possible substructures so that the parallel solution time is minimized.An ac-tual structural model was solved utilizing both homogeneous and heterogeneous PC clusters to illustrate the performance and applicability of the presented framework.

  14. Age of the Kepler Open Cluster NGC 6811 from an Eclipsing Binary

    DEFF Research Database (Denmark)

    Leitner, Marika; Sandquist, E. L.; Shetrone, M. D.;

    2013-01-01

    provide an extremely precise age for the cluster. We present the results of modeling Kepler and ground-based photometry as well as radial velocities obtained at the Hobby-Eberly Telescope, Nordic Optical Telescope, and MMT. We demonstrate that the stars have masses near 1.6 and 1.4 solar masses...... clump stars in the cluster (Stello et al. 2011). We gratefully acknowledge support from the NSF for M.L. as part of the REU program at San Diego State University under grant AST-0850564 and to E.L.S under grant AST-0908536, and NASA under grant NNX12AC88G....

  15. Sizes, Half-Mass Densities, and Mass Functions of Star Clusters in the Merger Remnant NGC 1316: Clues to the Fate of Second-Generation Globular Clusters

    CERN Document Server

    Goudfrooij, Paul

    2012-01-01

    We study mass functions of globular clusters derived from HST/ACS images of the early-type merger remnant galaxy NGC 1316 which hosts a significant population of metal-rich globular clusters of intermediate age (~3 Gyr). For the old, metal-poor (`blue') clusters, the peak mass of the mass function M_p increases with internal half-mass density rho_h as (M_p proportional to rho_h^0.44) whereas it stays approximately constant with galactocentric distance R_gal. The mass functions of these clusters are consistent with a simple scenario in which they formed with a Schechter initial mass function and evolved subsequently by internal two-body relaxation. For the intermediate-age population of metal-rich ("red") clusters, the faint end of the previously reported power-law luminosity function of the clusters with R_gal > 9 kpc is due to many of those clusters having radii larger than the theoretical maximum value imposed by the tidal field of NGC 1316 at their R_gal. This renders disruption by two-body relaxation inef...

  16. Behaviour analysis of AC-600 passive safety systems

    International Nuclear Information System (INIS)

    Southwest Center of Reactor Engineering Research and Design has finished the first step conceptual design of 600 mwe advanced PWR (AC-600). The main research emphases of AC-600 conceptual design include the advanced reactor core, the passive safety systems and the simplification. The passive safety systems of AC-600 consist of two reactor make up water tanks, two accumulators, two emergency feedwater tanks, two emergency natural draft air condensers, a containment water jacket and an enhanced primary cycle natural circulation flow system. 25% of the rated reactor power can be removed by the natural circulation cooling. The full pressure reactor make up water tanks are able to provide enough borated water which would be injected into the reactor coolant system during small LOCA. The coolant natural circulations can be established in the primary system and the passive secondary emergency feedwater system, removing residual heat from the reactor core to the atmosphere when station blackout occurs. It is indicated from analysis that the containment diameter of AC-600 is about 35 m. The large tanks and the large vertical distances between the tanks and reactor core are the main reason of using the big containment. It is also indicated from analysis that the low head safety injection pumps are required in AC-600 design to assure the recirculation system operation when large LOCA occurs. The reliability of AC-600 engineered safety systems is increased because the function of the passive safety systems is conducted through the immutable natural laws. The paper discusses the natural circulation ability and safety behavior of the passive safety systems during LOCA or station blackout for AC-600. The passive limits to excess reactivity and thermal hydraulic transients are also preliminarily discussed. Figs and tabs

  17. Strategy for Cloning Large Gene Assemblages as Illustrated Using the Phenylacetate and Polyhydroxyalkanoate Gene Clusters

    OpenAIRE

    García, Belén; Olivera, Elías R.; Sandoval, Ángel; Arias-Barrau, Elsa; Arias, Sagrario; Naharro, Germán; Luengo, José M.

    2004-01-01

    We report an easy procedure for isolating chromosome-clustered genes. By following this methodology, the entire set of genes belonging to the phenylacetic acid (PhAc; 18-kb) pathway as well as those required for the synthesis and mobilization of different polyhydroxyalkanoates (PHAs; 6.4 kb) in Pseudomonas putida U were recovered directly from the bacterial chromosome and cloned into a plasmid for the first time. The transformation of different bacteria with these genetic constructions confer...

  18. Descriptors of Modular Formation of Accounting and Analytical Cluster in Innovation Development of Agricultural Holdings

    OpenAIRE

    Zhanna Degaltseva

    2015-01-01

    In the context of the division of accounting into financial accounting, taxation accounting, management accounting and statistical accounting a problem of improving their relationship arises. The accounting and analytical cluster plays the role of the correlating factor of the relationship between the subdivisions of the agricultural holding property. To improve its work a modular principle of its building based on information technology was introduced. Practical implementation of modular ac...

  19. HST/ACS Lyman alpha imaging of the nearby starburst ESO338-IG04

    CERN Document Server

    Hayes, M; Mas-Hesse, J M; Kunth, D; Leitherer, C; Petrosian, A

    2005-01-01

    ESO338-IG04 is a well known, local, luminous Blue Compact Galaxy. It has a complex morphology and contains a central young starburst with compact young star clusters. The galaxy was imaged using HST/ACS in the Lyman alpha line and continuum. Using the Starburst99 synthetic spectra and other imaging data from HST/WFPC2 we developed a technique that allows us to make the first photometrically valid continuum subtraction for the LYa line. Our results are in qualitative agreement with the models of LYa escape being regulated by kinematical properties of the interstellar medium. The line-only image shows LYa in both emission and absorption. Notably, emission is seen from central bright young clusters and is in spatial agreement with the features present in a longslit spectrum taken with HST/STIS. Diffuse LYa emission regions are seen surrounding the central starburst where photons escape after one or more resonant scatterings in HI. These regions dominate the total LYa output. Photometry reveals a total LYa flux o...

  20. Eclipsing binaries in open clusters

    DEFF Research Database (Denmark)

    Southworth, John; Clausen, J.V.

    2006-01-01

    Stars: fundamental parameters - Stars : binaries : eclipsing - Stars: Binaries: spectroscopic - Open clusters and ass. : general Udgivelsesdato: 5 August......Stars: fundamental parameters - Stars : binaries : eclipsing - Stars: Binaries: spectroscopic - Open clusters and ass. : general Udgivelsesdato: 5 August...

  1. Radio observations of Planck clusters

    CERN Document Server

    Kale, Ruta

    2012-01-01

    Recently, a number of new galaxy clusters have been detected by the ESA-Planck satellite, the South Pole Telescope and the Atacama Cosmology Telescope using the Sunyaev-Zeldovich effect. Several of the newly detected clusters are massive, merging systems with disturbed morphology in the X-ray surface brightness. Diffuse radio sources in clusters, called giant radio halos and relics, are direct probes of cosmic rays and magnetic fields in the intra-cluster medium. These radio sources are found to occur mainly in massive merging clusters. Thus, the new SZ-discovered clusters are good candidates to search for new radio halos and relics. We have initiated radio observations of the clusters detected by Planck with the Giant Metrewave Radio Telescope. These observations have already led to the detection of a radio halo in PLCKG171.9-40.7, the first giant halo discovered in one of the new Planck clusters.

  2. The Evolution of Cluster Substructure

    CERN Document Server

    Jeltema, T E; Bautz, M W; Buote, D A; Jeltema, Tesla E.; Canizares, Claude R.; Bautz, Mark W.; Buote, David A.

    2003-01-01

    Using Chandra archival data, we have begun a study to quantify the evolution of cluster morphology with redshift. To quantify cluster morphology, we use the power ratio method developed by Buote and Tsai (1995). Power ratios are constructed from moments of the two-dimensional gravitational potential and are, therefore, related to a cluster's dynamical state. Our sample will include around 50 clusters from the Chandra archive with redshifts between 0.11 and 1.1. These clusters were selected from two fairly complete flux-limited X-ray surveys (the ROSAT Bright Cluster Sample and the Einstein Medium Sensitivity Survey), and additional high-redshift clusters were selected from recent ROSAT flux-limited surveys. Here we present preliminary results from the first 15 clusters in this sample. Of these, eight have redshifts below 0.5, and seven have redshifts above 0.5.

  3. Textile Industrial Clusters in China

    Institute of Scientific and Technical Information of China (English)

    Nie Ting

    2010-01-01

    @@ "National Textile Industry Cluster Development Seminar" convened,held by China National Textile and Apparel Council,23 cities and towns were awarded as China's Textile Industry Cluster Pilot District.By far,China's textile industrial clusters have grown to 164,which indicate a quick and gorgeous development.These textile industrial clusters have a great impact on the local economy and even the whole national textile industry's development.

  4. [Cluster analysis in biomedical researches].

    Science.gov (United States)

    Akopov, A S; Moskovtsev, A A; Dolenko, S A; Savina, G D

    2013-01-01

    Cluster analysis is one of the most popular methods for the analysis of multi-parameter data. The cluster analysis reveals the internal structure of the data, group the separate observations on the degree of their similarity. The review provides a definition of the basic concepts of cluster analysis, and discusses the most popular clustering algorithms: k-means, hierarchical algorithms, Kohonen networks algorithms. Examples are the use of these algorithms in biomedical research. PMID:24640781

  5. Clustering analysis using Swarm Intelligence

    OpenAIRE

    Farmani, Mohammad Reza

    2016-01-01

    This thesis is concerned with the application of the swarm intelligence methods in clustering analysis of datasets. The main objectives of the thesis are ∙ Take the advantage of a novel evolutionary algorithm, called artificial bee colony, to improve the capability of K-means in finding global optimum clusters in nonlinear partitional clustering problems. ∙ Consider partitional clustering as an optimization problem and an improved antbased algorithm, named Opposition-Based A...

  6. Defining Clusters of Related Industries

    OpenAIRE

    Mercedes Delgado; Porter, Michael E.; Scott Stern

    2014-01-01

    Clusters are geographic concentrations of industries related by knowledge, skills, inputs, demand, and/or other linkages. A growing body of empirical literature has shown the positive impact of clusters on regional and industry performance, including job creation, patenting, and new business formation. There is an increasing need for cluster-based data to support research, facilitate comparisons of clusters across regions, and support policymakers and practitioners in defining regional strate...

  7. Practical Introduction to Clustering Data

    CERN Document Server

    Hartmann, Alexander K

    2016-01-01

    Data clustering is an approach to seek for structure in sets of complex data, i.e., sets of "objects". The main objective is to identify groups of objects which are similar to each other, e.g., for classification. Here, an introduction to clustering is given and three basic approaches are introduced: the k-means algorithm, neighbour-based clustering, and an agglomerative clustering method. For all cases, C source code examples are given, allowing for an easy implementation.

  8. The Assembly of Galaxy Clusters

    Energy Technology Data Exchange (ETDEWEB)

    Berrier, Joel C.; Stewart, Kyle R.; Bullock, James S.; Purcell, Chris W.; Barton, Elizabeth J.; Wechsler, Risa H.

    2008-05-16

    We study the formation of fifty-three galaxy cluster-size dark matter halos (M = 10{sup 14.0-14.76} M{sub {circle_dot}}) formed within a pair of cosmological {Lambda}CDM N-body simulations, and track the accretion histories of cluster subhalos with masses large enough to host {approx} 0.1L{sub *} galaxies. By associating subhalos with cluster galaxies, we find the majority of galaxies in clusters experience no 'pre-processing' in the group environment prior to their accretion into the cluster. On average, {approx} 70% of cluster galaxies fall into the cluster potential directly from the field, with no luminous companions in their host halos at the time of accretion; and less than {approx} 12% are accreted as members of groups with five or more galaxies. Moreover, we find that cluster galaxies are significantly less likely to have experienced a merger in the recent past ({approx}< 6 Gyr) than a field halo of the same mass. These results suggest that local, cluster processes like ram-pressure stripping, galaxy harassment, or strangulation play the dominant role in explaining the difference between cluster and field populations at a fixed stellar mass; and that pre-evolution or past merging in the group environment is of secondary importance for setting cluster galaxy properties for most clusters. The accretion times for z = 0 cluster members are quite extended, with {approx} 20% incorporated into the cluster halo more than 7 Gyr ago and {approx} 20% within the last 2 Gyr. By comparing the observed morphological fractions in cluster and field populations, we estimate an approximate time-scale for late-type to early-type transformation within the cluster environment to be {approx} 6 Gyr.

  9. Massive star clusters in galaxies

    CERN Document Server

    Harris, William E

    2009-01-01

    The ensemble of all star clusters in a galaxy constitutes its star cluster system. In this review, the focus of the discussion is on the ability of star clusters, particularly the systems of old massive globular clusters (GCSs), to mark the early evolutionary history of galaxies. I review current themes and key findings in GCS research, and highlight some of the outstanding questions that are emerging from recent work.

  10. Analysis of AC loss in superconducting power devices calculated from short sample data

    OpenAIRE

    Rabbers, J.J.; Haken, ten, Bennie; Kate, ten, F.J.W.

    2003-01-01

    A method to calculate the AC loss of superconducting power devices from the measured AC loss of a short sample is developed. In coils and cables the magnetic field varies spatially. The position dependent field vector is calculated assuming a homogeneous current distribution. From this field profile and the transport current, the local AC loss is calculated. Integration over the conductor length yields the AC loss of the device. The total AC loss of the device is split up in different compone...

  11. Temas de Física para Ingeniería: Acústica

    OpenAIRE

    Beléndez Vázquez, Augusto

    1992-01-01

    Acústica, fluidos y termodinámica: "Acústica". Ondas sonoras, propagación. Sonidos puros, sonidos complejos y ruidos. Velocidad de propagación del sonido. Intensidad del sonido y potencia acústica. Impedancia acústica y transmisión del sonido. Medición del campo acústico: niveles. Audición. Interferencia de ondas sonoras y pulsaciones. Tubos sonoros. Efecto Doppler.

  12. On clusters and clustering from atoms to fractals

    CERN Document Server

    Reynolds, PJ

    1993-01-01

    This book attempts to answer why there is so much interest in clusters. Clusters occur on all length scales, and as a result occur in a variety of fields. Clusters are interesting scientifically, but they also have important consequences technologically. The division of the book into three parts roughly separates the field into small, intermediate, and large-scale clusters. Small clusters are the regime of atomic and molecular physics and chemistry. The intermediate regime is the transitional regime, with its characteristics including the onset of bulk-like behavior, growth and aggregation, a

  13. 一种简单新型拓扑Cuk AC/AC变换器及其仿真研究%A New Simple Topology of Cuk AC/AC Converter and Its Simulation

    Institute of Scientific and Technical Information of China (English)

    陈溪; 刘韬; 谭光慧; 纪延超

    2006-01-01

    由Cuk DC/DC变换器的拓扑结构导出一种只具有两个开关的PWM AC/AC变换器的简单新型拓扑--Cuk AC/AC变换器.给出单相和三相Cuk AC/AC变换器的拓扑结构,分析Cuk AC/AC变换器的外特性及小信号特性.仿真结果验证了所提的Cuk AC/AC变换器的合理性和可行性.

  14. Bayesian Analysis of Multiple Populations in Galactic Globular Clusters

    Science.gov (United States)

    Wagner-Kaiser, Rachel A.; Sarajedini, Ata; von Hippel, Ted; Stenning, David; Piotto, Giampaolo; Milone, Antonino; van Dyk, David A.; Robinson, Elliot; Stein, Nathan

    2016-01-01

    We use GO 13297 Cycle 21 Hubble Space Telescope (HST) observations and archival GO 10775 Cycle 14 HST ACS Treasury observations of Galactic Globular Clusters to find and characterize multiple stellar populations. Determining how globular clusters are able to create and retain enriched material to produce several generations of stars is key to understanding how these objects formed and how they have affected the structural, kinematic, and chemical evolution of the Milky Way. We employ a sophisticated Bayesian technique with an adaptive MCMC algorithm to simultaneously fit the age, distance, absorption, and metallicity for each cluster. At the same time, we also fit unique helium values to two distinct populations of the cluster and determine the relative proportions of those populations. Our unique numerical approach allows objective and precise analysis of these complicated clusters, providing posterior distribution functions for each parameter of interest. We use these results to gain a better understanding of multiple populations in these clusters and their role in the history of the Milky Way.Support for this work was provided by NASA through grant numbers HST-GO-10775 and HST-GO-13297 from the Space Telescope Science Institute, which is operated by AURA, Inc., under NASA contract NAS5-26555. This material is based upon work supported by the National Aeronautics and Space Administration under Grant NNX11AF34G issued through the Office of Space Science. This project was supported by the National Aeronautics & Space Administration through the University of Central Florida's NASA Florida Space Grant Consortium.

  15. Modelling ac ripple currents in HTS coated conductors

    Science.gov (United States)

    Xu, Zhihan; Grilli, Francesco

    2015-10-01

    Dc transmission using high temperature superconducting (HTS) coated conductors (CCs) offers a promising solution to the globally growing demand for effective, reliable and economic transmission of green energy up to the gigawatt level over very long distances. The credible estimation of the losses and thereby the heat dissipation involved, where ac ripples (introduced in rectification/ac-dc conversion) are viewed as a potential source of notable contribution, is highly essential for the rational design of practical HTS dc transmission cables and corresponding cryogenic systems to fulfil this demand. Here we report a targeted modelling study into the ac losses in a HTS CC subject to dc and ac ripple currents simultaneously, by solving Maxwell’s equations using the finite element method (FEM) in the commercial software package COMSOL. It is observed that the instantaneous loss exhibits only one peak per cycle in the HTS CC subject to sinusoidal ripples, given that the amplitude of the ac ripples is smaller than approximately 20% of that of the dc current. This is a distinct contrast to the usual observation of two peaks per cycle in a HTS CC subject to ac currents only. The unique mechanism is also revealed, which is directly associated with the finding that, around any local minima of the applied ac ripples, the critical state of -J c is never reached at the edges of the HTS CC, as it should be according to the Bean model. When running further into the longer term, it is discovered that the ac ripple loss of the HTS CC in full-wave rectification decays monotonically, at a speed which is found to be insensitive to the frequency of the applied ripples within our targeted situations, to a relatively low level of approximately 1.38 × 10-4 W m-1 in around 1.7 s. Comparison between this level and other typical loss contributions in a HTS dc cable implies that ac ripple currents in HTS CCs should only be considered as a minor source of dissipation in superconducting dc

  16. Recovery Rate of Clustering Algorithms

    NARCIS (Netherlands)

    Li, Fajie; Klette, Reinhard; Wada, T; Huang, F; Lin, S

    2009-01-01

    This article provides a simple and general way for defining the recovery rate of clustering algorithms using a given family of old clusters for evaluating the performance of the algorithm when calculating a family of new clusters. Under the assumption of dealing with simulated data (i.e., known old

  17. Analytical Approximations to Galaxy Clustering

    OpenAIRE

    Mo, H. J.

    1997-01-01

    We discuss some recent progress in constructing analytic approximations to the galaxy clustering. We show that successful models can be constructed for the clustering of both dark matter and dark matter haloes. Our understanding of galaxy clustering and galaxy biasing can be greatly enhanced by these models.

  18. Geographic Projection of Cluster Composites

    NARCIS (Netherlands)

    Nerbonne, J.; Bosveld-de Smet, L.M.; Kleiweg, P.; Blackwell, A.; Marriott, K.; Shimojima, A.

    2004-01-01

    A composite cluster map displays a fuzzy categorisation of geographic areas. It combines information from several sources to provide a visualisation of the significance of cluster borders. The basic technique renders the chance that two neighbouring locations are members of different clusters as the

  19. Programming with MPI on clusters

    International Nuclear Information System (INIS)

    The authors discuss the current state of development for the key aspects of MPI programming on clusters. These aspects are the evolution of the MPI Standard itself, developments in cluster hardware and system software that directly affect MPI implementations, and supporting software that facilitates the use of MPI on scalable clusters. In each case we give a brief background and summarize the current status

  20. Adaptive Clustering of Hypermedia Documents.

    Science.gov (United States)

    Johnson, Andrew; Fotouhi, Farshad

    1996-01-01

    Discussion of hypermedia systems focuses on a comparison of two types of adaptive algorithm (genetic algorithm and neural network) in clustering hypermedia documents. These clusters allow the user to index into the nodes to find needed information more quickly, since clustering is "personalized" based on the user's paths rather than representing…