WorldWideScience

Sample records for acs fornax cluster

  1. THE ACS FORNAX CLUSTER SURVEY. VI. THE NUCLEI OF EARLY-TYPE GALAXIES IN THE FORNAX CLUSTER

    Energy Technology Data Exchange (ETDEWEB)

    Turner, Monica L. [Department of Physics and Astronomy, University of Victoria, Victoria, BC V8W 3P6 (Canada); Cote, Patrick; Ferrarese, Laura; Blakeslee, John P. [Herzberg Institute of Astrophysics, National Research Council of Canada, Victoria, BC V9E 2E7 (Canada); Jordan, Andres [Departamento de Astronomia y Astrofisica, Pontificia Universidad Catolica de Chile, Av. Vicuna Mackenna 4860, Macul 7820436, Santiago (Chile); Mei, Simona [Department of Physics University of Paris Denis Diderot, F-75205 Paris Cedex 13 (France); Peng, Eric W. [Department of Astronomy, Peking University, Beijing 100871 (China); West, Michael J., E-mail: turnerm@uvic.ca [European Southern Observatory, Alonso de Cordova 3107, Vitacura, Santiago (Chile)

    2012-11-15

    The Advanced Camera for Surveys (ACS) Fornax Cluster Survey is a Hubble Space Telescope program to image 43 early-type galaxies in the Fornax cluster, using the F475W and F850LP bandpasses of the ACS. We employ both one-dimensional and two-dimensional techniques to characterize the properties of the stellar nuclei in these galaxies, defined as the central 'luminosity excesses', relative to a Sersic model fitted to the underlying host. We find 72% {+-} 13% of our sample (31 galaxies) to be nucleated, with only three of the nuclei offset by more than 0.''5 from their galaxy photocenter, and with the majority of nuclei having colors bluer than their hosts. The nuclei are observed to be larger, and brighter, than typical Fornax globular clusters and to follow different structural scaling relations. A comparison of our results to those from the ACS Virgo Cluster Survey reveals striking similarities in the properties of the nuclei belonging to these different environments. We briefly review a variety of proposed formation models and conclude that, for the low-mass galaxies in our sample, the most important mechanism for nucleus growth is probably infall of star clusters through dynamical friction, while for higher mass galaxies, gas accretion triggered by mergers, accretions, and tidal torques is likely to dominate, with the relative importance of these two processes varying smoothly as a function of galaxy mass. Some intermediate-mass galaxies in our sample show a complexity in their inner structure that may be the signature of the 'hybrid nuclei' that arose through parallel formation channels.

  2. The ACS Fornax Cluster Survey. XII. Diffuse Star Clusters in Early-type Galaxies

    CERN Document Server

    Liu, Yiqing; Lim, Sungsoon; Jordán, Andrés; Blakeslee, John; Côté, Patrick; Ferrarese, Laura; Pattarakijwanich, Petchara

    2016-01-01

    Diffuse star clusters (DSCs) are old and dynamically hot stellar systems that have lower surface brightness and more extended morphology than globular clusters (GCs). Using the images from HST/ACS Fornax Cluster Survey, we find that 12 out of 43 early-type galaxies (ETGs) in the Fornax cluster host significant numbers of DSCs. Together with literature data from the HST/ACS Virgo Cluster Survey, where 18 out of 100 ETGs were found to host DSCs, we systematically study the relationship of DSCs with GCs, and their host galaxy environment. Two DSC hosts are post-merger galaxies, with most of the other hosts either having low mass or showing clear disk components. We find that while the number ratio of DSCs to GCs is nearly constant in massive galaxies, the DSC-to-GC ratio becomes systematically higher in lower mass hosts. This suggests that DSCs may be more efficient at forming (or surviving) in low density environments. DSC hosts are not special either in their position in the cluster, or in the galactic color-m...

  3. The ACS Fornax Cluster Survey. XII. Diffuse Star Clusters in Early-type Galaxies

    Science.gov (United States)

    Liu, Yiqing; Peng, Eric W.; Lim, Sungsoon; Jordán, Andrés; Blakeslee, John; Côté, Patrick; Ferrarese, Laura; Pattarakijwanich, Petchara

    2016-10-01

    Diffuse star clusters (DSCs) are old and dynamically hot stellar systems that have lower surface brightness and more extended morphology than globular clusters (GCs). Using the images from Hubble Space Telescope (HST)/ACS Fornax Cluster Survey, we find that 12 out of 43 early-type galaxies (ETGs) in the Fornax Cluster host significant numbers of DSCs. Together with literature data from the HST/ACS Virgo Cluster Survey, where 18 out of 100 ETGs were found to host DSCs, we systematically study the relationship of DSCs with GCs and their host galaxy environment. Two DSC hosts are post-merger galaxies, with most of the other hosts either having low mass or showing clear disk components. We find that while the number ratio of DSCs to GCs is nearly constant in massive galaxies, the DSC-to-GC ratio becomes systematically higher in lower-mass hosts. This suggests that DSCs may be more efficient at forming (or surviving) in low-density environments. DSC hosts are not special either in their position in the cluster or in the galactic color-magnitude diagram. Why some disk and low-mass galaxies host DSCs while others do not is still a puzzle, however. The mean ages of DSC hosts and nonhosts are similar at similar masses, implying that formation efficiency rather than survival is the reason behind different DSC number fractions in ETGs.

  4. The ACS Fornax Cluster Survey. V. Measurement and Recalibration of Surface Brightness Fluctuations and a Precise Value of the Fornax--Virgo Relative Distance

    CERN Document Server

    Blakeslee, John P; Mei, Simona; Cote, Patrick; Ferrarese, Laura; Infante, Leopoldo; Peng, Eric W; Tonry, John L; West, Michael J

    2009-01-01

    We present g-z color and z-band surface brightness fluctuations (SBF) measurements for 43 early-type galaxies in the Fornax cluster imaged with HST/ACS. These are combined with measurements for Virgo cluster galaxies to derive a revised, nonlinear calibration of the z-band SBF absolute magnitude as a function of g-z. In all, we tabulate recalibrated SBF distances for 134 galaxies in Virgo, Fornax, the Virgo W' group, and NGC4697 in the Virgo Southern Extension. The calibration procedure yields a precise relative distance modulus for Fornax with respect to Virgo of 0.42+/-0.03 mag, or a distance ratio 1.214 +/- 0.017. The resulting Fornax distance modulus is 31.51 +/-0.03 +/-0.15 mag, 20.0 +/-0.3 +/-1.4 Mpc, where the second set of error bars reflects systematic uncertainty from our assumed Virgo distance of 16.5 Mpc. The rms distance scatter for the early-type Fornax galaxies is 0.49^{+0.11}_{-0.15} Mpc, consistent with its compact appearance on the sky. This translates to a depth scatter smaller than the int...

  5. The ACS Fornax Cluster Survey. VIII. The Luminosity Function of Globular Clusters in Virgo and Fornax Early-Type Galaxies and its Use as a Distance Indicator

    CERN Document Server

    Villegas, Daniela; Peng, Eric W; Blakeslee, John P; Cote, Patrick; Ferrarese, Laura; Kissler-Patig, Markus; Mei, Simona; Infante, Leopoldo; Tonry, John L; West, Michael J

    2010-01-01

    We use a highly homogeneous set of data from 132 early-type galaxies in the Virgo and Fornax clusters in order to study the properties of the globular cluster luminosity function (GCLF). The globular cluster system of each galaxy was studied using a maximum likelihood approach to model the intrinsic GCLF after accounting for contamination and completeness effects. The results presented here update our Virgo measurements and confirm our previous results showing a tight correlation between the dispersion of the GCLF and the absolute magnitude of the parent galaxy. Regarding the use of the GCLF as a standard candle, we have found that the relative distance modulus between the Virgo and Fornax clusters is systematically lower than the one derived by other distance estimators, and in particular it is 0.22mag lower than the value derived from surface brightness fluctuation measurements performed on the same data. From numerical simulations aimed at reproducing the observed dispersion of the value of the turnover ma...

  6. A Deep Look at the Fornax Cluster

    Science.gov (United States)

    Kohler, Susanna

    2016-04-01

    Traditionally, dense cluster centers are cannibalistic environments, with larger galaxies stripping stars from smaller interlopers in minor mergers and dynamical harassment. A recent survey of the Fornax cluster, one example of such an environment, reveals how this cluster may have been built.Clues in HalosContext for the southern constellation Fornax (the furnace). The Fornax cluster is marked with a red circle. [ESO, IAU and Sky Telescope]Deep surveys of dense cluster environments are necessary because the imprint of mass assembly is hidden in galactic halos, the faint outer regions of galaxies. Deep observations can reveal answers to questions about how the galaxies in these extreme environments formed and evolved for instance, did the majority of the galaxies stars form in situ, or were they accreted from interactions with other galaxies?The Fornax Deep Survey (FDS) is just such a campaign. FDS uses the European Southern Observatorys VLT Survey Telescope to obtain deep photometry of the entire 26 square degrees of the Fornax cluster, a spectacular galaxy cluster located 65 million light-years away.Central ObservationsThe FDS team plans to release the full results from the survey soon. For now, in an initial study led by Enrichetta Iodice (INAFs Astronomical Observatory of Capodimonte, Italy), the team presents their first findings from the two square degrees around NGC 1399, a supergiant elliptical galaxy in the cluster center.The two main results from this study are:The discovery of a faint stellar bridge between NGC 1399 and a nearby galaxy, NGC 1387.The characterization of NGC 1399s light profile, which shows that the galaxy consists of two main components separated by a strong break. The bright central galaxy is likely composed of stars that formed in situ, whereas the exponential outer component is a stellar halo composed of stars likely captured from accretion events.What do these points tell us about the history of the center of the Fornax cluster? These

  7. The Herschel Fornax Cluster Survey II: FIR properties of optically-selected Fornax cluster galaxies

    CERN Document Server

    Fuller, C; Auld, R; Smith, M W L; Baes, M; Bianchi, S; Bocchio, M; Boselli, A; Clemens, M; Davis, T A; De Looze, I; Alighieri, S di Serego; Grossi, M; Hughes, T M; Viaene, S; Serra, P

    2014-01-01

    The $Herschel$ Fornax Cluster Survey (HeFoCS) is a deep, far-infrared (FIR) survey of the Fornax cluster. The survey is in 5 $Herschel$ bands (100 - 500 $\\mu$m) and covers an area of 16 deg$^2$ centred on NGC1399. This paper presents photometry, detection rates, dust masses and temperatures using an optically selected sample from the Fornax Cluster Catalogue (FCC). Our results are compared with those previously obtained using data from the $Herschel$ Virgo Cluster Survey (HeViCS). In Fornax, we detect 30 of the 237 (13%) optically selected galaxies in at least one $Herschel$ band. The global detection rates are significantly lower than Virgo, reflecting the morphological make up of each cluster - Fornax has a lower fraction of late-type galaxies. For galaxies detected in at least 3 bands we fit a modified blackbody with a $\\beta = 2$ emissivity. Detected early-type galaxies (E/S0) have a mean dust mass, temperature, and dust-to-stars ratio of $\\log_{10}(/\\mathrm{M_{\\odot}}) = 5.82 \\pm 0.20$, $ = 20.82 \\pm 1.7...

  8. An Extended View of the Fornax Cluster

    CERN Document Server

    Waugh, M; Drinkwater, M J

    2000-01-01

    The Multibeam survey at the Parkes Radio Telescope has provided a wealth of 21 cm HI data. We have mosaicked ten standard HIPASS cubes to produce a datacube approximately 25 deg x 25 deg in size, centred on NGC1399, the optical centre of the Fornax Cluster. Some properties of the initial approx. 80 galaxies identified in HI are described. In the optical, Ferguson's Fornax Cluster Catalogue (FCC) identified 340 likely member galaxies in the central 40 sq.deg. In the radio we have detected a more uniform sheet of about 80 galaxies at the cluster velocity extending up to 15 deg from the cluster centre. At the cluster distance of about 15 Mpc, this corresponds to an elongated large-scale structure (LSS) more than 7 Mpc in extent. Galaxies were detected to a lower mass limit of 1x10^8M_sun and fewer than 25 of these were within the central 40 sq.deg, suggesting considerable HI depletion of galaxies in the centre of the cluster. Further, these results strongly indicate that HI surveys do not readily identify galaxy...

  9. Hidden Galaxies in the Fornax Cluster

    CERN Document Server

    Drinkwater, M J; Webster, R L; Barnes, D G; Gregg, M D; Phillipps, S; Jones, J B

    2000-01-01

    We are using the Multibeam 21cm receiver on the Parkes Telescope combined with the optical Two degree Field spectrograph (2dF) of the Anglo-Australian Telescope to obtain the first complete spectroscopic sample of the Fornax cluster. In the optical the survey is unique in that all objects (both ``stars'' and ``galaxies'') within our magnitude limits (Bj=16.5 to 19.7) are measured, producing the most complete survey of cluster members irrespective of surface brightness. We have detected two new classes of high surface brightness dwarf galaxy in the cluster. With 2dF we have discovered a population of very low luminosity (Mb approx -12) objects which are unresolved from the ground and may be the stripped nuclei of dwarf galaxies; they are unlike any known galaxies. In a survey of the brighter (Bj=16.5 to 18) galaxies with the FLAIR-II spectrograph we have found a number of new high surface brightness dwarf galaxies and show that the fraction of star-forming dwarf galaxies in the cluster is about 30 per cent, ab...

  10. Intra Cluster Globular Clusters around NGC 1399 in Fornax?

    CERN Document Server

    Schuberth, Y; Bassino, L; Hilker, M

    2007-01-01

    We investigate whether the globular clusters (GCs) in the recently published sample of GCs in the Fornax cluster by Bergond and coworkers are indeed intra-cluster objects. We combine the catalogue of radial velocity measurements by Bergond et al. with our CTIO MOSAIC photometry in the Washington system and analyse the relation of metal-poor and metal-rich GCs with their host galaxies. The metal-rich GCs appear to be kinematically associated with their respective host galaxies. The vast majority of the metal-poor GCs found in between the galaxies of the Fornax cluster have velocities which are consistent with them being members of the very extended NGC 1399 GC system. We find that when the sample is restricted to the most accurate velocity measurements, the GC velocity dispersion profile can be described with a mass model derived for the NGC 1399 GC system within 80 kpc. We identify one ``vagrant'' GC whose radial velocity suggests that it is not bound to any galaxy unless its orbit has a very large apogalacti...

  11. Variable Stars in the Fornax dSph Galaxy. III. The Globular Cluster Fornax 5

    CERN Document Server

    Greco, Claudia; Catelan, Marcio; Held, Enrico V; Poretti, Ennio; Gullieuszik, Marco; Maio, Marcella; Rest, Armin; De Lee, Nathan; Smith, Horace A; Pritzl, Barton J

    2009-01-01

    We present a new study of the variable star population in globular cluster 5 of the Fornax dwarf spheroidal galaxy, based on B and V time series photometry obtained with the MagIC camera of the 6.5 m Magellan Clay telescope and complementary HST archive data. Light curves and accurate periodicities were obtained for 30 RR Lyrae stars and 1 SX Phoenicis variable. The RR Lyrae sample includes 15 fundamental-mode pulsators, 13 first-overtone pulsators, 1 candidate double-mode pulsator and one RR Lyrae star with uncertain type classification. The average and minimum periods of the ab-type RR Lyrae stars, =0.590 days, P(ab,min)=0.53297 days, and the position in the horizontal branch type--metallicity plane, indicate that the cluster has Oosterhoff-intermediate properties, basically confirming previous indications by Mackey & Gilmore (2003b), although with some differences both in the period and type classification of individual variables. The average apparent magnitude of the Fornax 5 RR Lyrae stars is =21.35 ...

  12. The complex star cluster system of NGC 1316 (Fornax A)

    Science.gov (United States)

    Sesto, Leandro A.; Faifer, Favio R.; Forte, Juan C.

    2016-10-01

    This paper presents Gemini-gri' high-quality photometry for cluster candidates in the field of NGC 1316 (Fornax A) as part of a study that also includes GMOS spectroscopy. A preliminary discussion of the photometric data indicates the presence of four stellar cluster populations with distinctive features in terms of age, chemical abundance and spatial distribution. Two of them seem to be the usually old (metal poor and metal rich) populations typically found in elliptical galaxies. In turn, an intermediate-age (5 Gyr) globular cluster population is the dominant component of the sample (as reported by previous papers). We also find a younger cluster population with a tentative age of ≈ 1 Gyr.

  13. The complex star cluster system of NGC 1316 (Fornax A)

    CERN Document Server

    Sesto, Leandro A; Forte, Juan C

    2016-01-01

    This paper presents Gemini-$gri'$ high quality photometry for cluster candidates in the field of NGC 1316 (Fornax A) as part of a study that also includes GMOS spectroscopy. A preliminary discussion of the photometric data indicates the presence of four stellar cluster populations with distinctive features in terms of age, chemical abundance and spatial distribution. Two of them seem to be the usually old (metal poor and metal rich) populations typically found in elliptical galaxies. In turn, an intermediate-age (5 Gyr) globular cluster population is the dominant component of the sample (as reported by previous papers). We also find a younger cluster population with a tentative age of $\\approx$ 1 Gyr.

  14. Efficient star cluster formation in the core of a galaxy cluster: The dwarf irregular NGC 1427A in Fornax

    CERN Document Server

    Mora, Marcelo D; Puzia, Thomas H

    2014-01-01

    Gas-rich galaxies in dense environments such as galaxy clusters and massive groups are affected by a number of possible types of interactions with the cluster environment, which make their evolution radically different than that of field galaxies. The dIrr galaxy NGC 1427A, presently infalling towards the core of the Fornax galaxy cluster, offers a unique opportunity to study those processes in a level of detail not possible to achieve for galaxies at higher redshits. Using HST/ACS and auxiliary VLT/FORS ground-based observations, we study the properties of the most recent episodes of star formation in this gas-rich galaxy, the only one of its type near the core of the Fornax cluster. We study the structural and photometric properties of young star cluster complexes in NGC 1427A, identifying 12 bright such complexes with exceptionally blue colors. The comparison of our broadband near-UV/optical photometry with simple stellar population models yields ages below ~4x10^6 yr and stellar masses from a few thousand...

  15. Peculiar compact stellar systems in the Fornax cluster

    CERN Document Server

    Wittmann, Carolin; Pasquali, Anna; Hilker, Michael; Grebel, Eva K

    2016-01-01

    We search for hints to the origin and nature of compact stellar systems in the magnitude range of ultracompact dwarf galaxies in deep wide-field imaging data of the Fornax cluster core. We visually investigate a large sample of 355 spectroscopically confirmed cluster members with V-band equivalent magnitudes brighter than -10 mag for faint extended structures. Our data reveal peculiar compact stellar systems, which appear asymmetric or elongated from their outer light distribution. We characterize the structure of our objects by quantifying their core concentration, as well as their outer asymmetry and ellipticity. For the brighter objects of our sample we also investigate their spatial and phase-space distribution within the cluster. We argue that the distorted outer structure alone that is seen for some of our objects, is not sufficient to decide whether these systems have a star cluster or a galaxy origin. However, we find that objects with low core concentration and high asymmetry (or high ellipticity) ar...

  16. The Extended Spatial Distribution of Globular Clusters in the Core of the Fornax Cluster

    Science.gov (United States)

    D'Abrusco, R.; Cantiello, M.; Paolillo, M.; Pota, V.; Napolitano, N. R.; Limatola, L.; Spavone, M.; Grado, A.; Iodice, E.; Capaccioli, M.; Peletier, R.; Longo, G.; Hilker, M.; Mieske, S.; Grebel, E. K.; Lisker, T.; Wittmann, C.; van de Ven, G.; Schipani, P.; Fabbiano, G.

    2016-03-01

    We report the discovery of a complex extended density enhancement in the Globular Clusters (GCs) in the central ˜ 0.5{(^\\circ )}2 (˜ 0.06 Mpc2) of the Fornax cluster, corresponding to ˜ 50% of the area within 1 core radius. This overdensity connects the GC system of NGC 1399 to most of those of neighboring galaxies within ˜ 0\\_\\_AMP\\_\\_fdg;6 (˜ 210 kpc) along the W-E direction. The asymmetric density structure suggests that the galaxies in the core of the Fornax cluster experienced a lively history of interactions that have left a clear imprint on the spatial distribution of GCs. The extended central dominant structure is more prominent in the distribution of blue GCs, while red GCs show density enhancements that are more centrally concentrated on the host galaxies. We propose that the relatively small-scale density structures in the red GCs are caused by galaxy-galaxy interactions, while the extensive spatial distribution of blue GCs is due to stripping of GCs from the halos of core massive galaxies by the Fornax gravitational potential. Our investigations are based on density maps of candidate GCs extracted from the multi-band VLT Survey Telescope (VST) survey of Fornax (FDS), identified in a three-dimensional color space and further selected based on their g-band magnitude and morphology.

  17. The mass distribution of the Fornax dSph: constraints from its globular cluster distribution

    Science.gov (United States)

    Cole, David R.; Dehnen, Walter; Read, Justin I.; Wilkinson, Mark I.

    2012-10-01

    Uniquely among the dwarf spheroidal (dSph) satellite galaxies of the Milky Way, Fornax hosts globular clusters. It remains a puzzle as to why dynamical friction has not yet dragged any of Fornax's five globular clusters to the centre, and also why there is no evidence that any similar star cluster has been in the past (for Fornax or any other tidally undisrupted dSph). We set up a suite of 2800 N-body simulations that sample the full range of globular cluster orbits and mass models consistent with all existing observational constraints for Fornax. In agreement with previous work, we find that if Fornax has a large dark matter core, then its globular clusters remain close to their currently observed locations for long times. Furthermore, we find previously unreported behaviour for clusters that start inside the core region. These are pushed out of the core and gain orbital energy, a process we call 'dynamical buoyancy'. Thus, a cored mass distribution in Fornax will naturally lead to a shell-like globular cluster distribution near the core radius, independent of the initial conditions. By contrast, cold dark matter-type cusped mass distributions lead to the rapid infall of at least one cluster within Δt = 1-2 Gyr, except when picking unlikely initial conditions for the cluster orbits (˜2 per cent probability), and almost all clusters within Δt = 10 Gyr. Alternatively, if Fornax has only a weakly cusped mass distribution, then dynamical friction is much reduced. While over Δt = 10 Gyr this still leads to the infall of one to four clusters from their present orbits, the infall of any cluster within Δt = 1-2 Gyr is much less likely (with probability 0-70 per cent, depending on Δt and the strength of the cusp). Such a solution to the timing problem requires (in addition to a shallow dark matter cusp) that in the past the globular clusters were somewhat further from Fornax than today; they most likely did not form within Fornax, but were accreted.

  18. Globular cluster systems in low-luminosity early-type galaxies near the Fornax Cluster centre

    CERN Document Server

    Bassino, L P; Dirsch, B; Bassino, Lilia P.; Richtler, Tom; Dirsch, Boris

    2006-01-01

    We present a photometric study of the globular cluster systems of the Fornax cluster galaxies NGC 1374, NGC 1379, and NGC 1387. The data consists of images from the wide-field MOSAIC Imager of the CTIO 4-m telescope, obtained with Washington C and Kron-Cousins R filters. The images cover a field of 36 x 36 arcmin, corresponding to 200 x 200 kpc at the Fornax distance. Two of the galaxies, NGC 1374 and NGC 1379, are low-luminosity ellipticals while NGC 1387 is a low-luminosity lenticular. Their cluster systems are still embedded in the cluster system of NGC 1399. Therefore the use of a large field is crucial and some differences to previous work can be explained by this. The colour distributions of all globular cluster systems are bimodal. NGC 1387 presents a particularly distinct separation between red and blue clusters and an overproportionally large population of red clusters. The radial distribution is different for blue and red clusters, red clusters being more concentrated towards the respective galaxies...

  19. The old globular cluster system of the dIrr galaxy NGC1427A in the Fornax cluster

    CERN Document Server

    Georgiev, I Y; Goudfrooij, P; Hilker, M; Infante, L; Mieske, S; Puzia, T; Reisenegger, A; Chaname, Julio; Georgiev, Iskren Y.; Goudfrooij, Paul; Hilker, Michael; Mieske, Steffen; Puzia, Thomas H.; Reisenegger, Andreas

    2006-01-01

    We present a study of the old globular cluster (GC) population of the dwarf irregular galaxy NGC 1427A using multi-wavelength VLT observations in U, B, V, I, H_alpha, J, H, and Ks bands under excellent observing conditions. We applied color and size selection criteria to select old GC candidates and made use of archival ACS images taken with the Hubble Space Telescope to reject contaminating background sources and blended objects from the GC candidates' list. The H_alpha observations were used to check for contamination due to compact, highly reddened young star clusters whose colors and sizes could mimic those of old GCs. After accounting for contamination we obtain a total number of 38+/-8 GC candidates with colors consistent with an old (~10 Gyr) and metal-poor (Z < 0.4xZ_solar) population as judged by simple stellar population models. Our contamination analysis indicates that the density distribution of GCs in the outskirts of the Fornax central cD galaxy NGC1399 may not be spherically symmetric. We de...

  20. Nitrogen abundances and multiple stellar populations in the globular clusters of the Fornax dSph

    CERN Document Server

    Larsen, S S; Grundahl, F; Strader, J

    2014-01-01

    We use measurements of nitrogen abundances in red giants to search for multiple stellar populations in the four most metal-poor globular clusters (GCs) in the Fornax dwarf spheroidal galaxy (Fornax 1, 2, 3, and 5). New imaging in the F343N filter, obtained with the Wide Field Camera 3 on the Hubble Space Telescope, is combined with archival F555W and F814W observations to determine the strength of the NH band near 3370 AA. After accounting for observational errors, the spread in the F343N-F555W colors of red giants in the Fornax GCs is similar to that in M15 and corresponds to an abundance range of Delta([N/Fe])=2 dex, as observed also in several Galactic GCs. The spread in F555W-F814W is, instead, fully accounted for by observational errors. The stars with the reddest F343N-F555W colors (indicative of N-enhanced composition) have more centrally concentrated radial distributions in all four clusters, although the difference is not highly statistically significant within any individual cluster. From double-Gau...

  1. Globular clusters as tracers of the host galaxy mass distribution: the Fornax dSph test case

    CERN Document Server

    Arca-Sedda, Manuel

    2016-01-01

    The Fornax dwarf spheroidal galaxy is the most massive satellites of the Milky Way, claimed to be embedded in a huge dark matter halo, and the only among the Milky Way satellites hosting five globular clusters. Interestingly, their estimated masses, ages and positions seem hardly compatible with the presence of a significant dark matter component, as expected in the $\\Lambda$ CDM scheme. Indeed, if Fornax would have a CDM halo with a standard density profile, all its globular clusters should have sunk to the galactic centre many Gyr ago due to dynamical friction. Due to this, some authors proposed that the most massive clusters may have formed out of Fornax and later tidally captured. In this paper we investigate the past evolution of the Fornax GC system by using both a recently developed, semi-analytical treatment of dynamical friction and direct $N$-body simulations of the orbital evolution of the globular clusters within Fornax and of Fornax galaxy around the Milky Way. Our results suggest that an "in-sit...

  2. Globular Clusters at the Centre of the Fornax Cluster: Tracing Interactions Between Galaxies

    CERN Document Server

    Bassino, L P; Faifer, F R; Forte, J C; Dirsch, B; Geisler, D; Schuberth, Y

    2006-01-01

    We present the combined results of two investigations: a large-scale study of the globular cluster system (GCS) around NGC 1399, the central galaxy of the Fornax cluster, and a study of the GCSs around NGC 1374, NGC 1379 and NGC 1387, three low-luminosity early-type galaxies located close to the centre of the same cluster. In both cases, the data consist of images from the wide-field MOSAIC Imager of the CTIO 4-m telescope, obtained with Washington C and Kron-Cousins R filters, which provide good metallicity resolution. The colour distributions and radial projected densities of the GCSs are analyzed. We focus on the properties of the GCSs that trace possible interaction processes between the galaxies, such as tidal stripping of globular clusters. For the blue globular clusters, we find tails between NGC 1399 and neighbouring galaxies in the azimuthal projected distribution, and the three low-luminosity galaxies show low specific frequencies and a low proportion of blue GCs.

  3. The Photometric Study of Globular Cluster Systems in the Coma, Fornax, and Virgo Clusters of Galaxies with the HST WFC3/IR

    Science.gov (United States)

    Cho, Hyejeon; Blakeslee, John P.; Lee, Young-Wook

    2017-01-01

    We present new HST WFC3/IR observations of a cD galaxy NGC 4874 in the Coma and 16 early-type galaxies spanning a wide range of luminosities and colors in the Fornax and Virgo clusters of galaxies. Combining these NIR data with new HST ACS optical photometry for NGC 4874 and existing ACS globular cluster (GC) catalogs from the ACS Fornax and Virgo Cluster Surveys, we have examined for the first time the GC systems in a statistically significant sample of galaxies using high-resolution WFC3/IR and ACS data. A primary goal of this dissertation is to explore empirically whether the distributions of purely optical and hybrid optical-NIR color indices for GCs have different forms and whether the relations between these color indices are nonlinear, indicating that they behave differently with underlying metallicity. We find that some GC systems of large galaxies in our sample show color bimodalities that differ between the optical and optical-NIR colors, in the sense that they have disparate ratios of red and blue GCs, as well as differing ratios in their color dispersions. Consistent with these results, we find empirically that the dependence of hybrid optical-NIR color on purely optical color is nonlinear, with an inflection at intermediate metallicities. These findings show the importance of understanding the nature of variations in the GC color distributions and color—color relations as a function of galaxy properties, as well as the exact forms of the color—metallicity transformations, in interpreting the observational data on GC color bimodality. Finally, we discuss the very steep color—magnitude trend, or “blue tilt”, for the blue GCs in NGC 4874 and the spatial offset of the center of its GC distribution from the galaxy’s luminosity center.

  4. Large-scale study of the NGC 1399 globular cluster system in Fornax

    CERN Document Server

    Bassino, L P; Forte, J C; Dirsch, B; Richtler, T; Geisler, D; Schuberth, Y

    2006-01-01

    We present a Washington C and Kron-Cousins R photometric study of the globular cluster system of NGC 1399, the central galaxy of the Fornax cluster. A large areal coverage of 1 square degree around NGC 1399 is achieved with three adjoining fields of the MOSAIC II Imager at the CTIO 4-m telescope. Working on such a large field, we can perform the first indicative determination of the total size of the NGC 1399 globular cluster system. The estimated angular extent, measured from the NGC 1399 centre and up to a limiting radius where the areal density of blue globular clusters falls to 30 per cent of the background level, is 45 +/- 5 arcmin, which corresponds to 220 - 275 kpc at the Fornax distance. The bimodal colour distribution of this globular cluster system, as well as the different radial distribution of blue and red clusters, up to these large distances from the parent galaxy, are confirmed. The azimuthal globular cluster distribution exhibits asymmetries that might be understood in terms of tidal strippin...

  5. Globular clusters as tracers of the host galaxy mass distribution: the Fornax dSph test case

    Science.gov (United States)

    Arca-Sedda, M.; Capuzzo-Dolcetta, R.

    2016-10-01

    The Fornax dwarf spheroidal galaxy is the most massive satellites of the Milky Way, claimed to be embedded in a huge dark matter halo, and the only among the Milky Way satellites hosting five globular clusters. Interestingly, their estimated masses, ages and positions seem hardly compatible with the presence of a significant dark matter component, as expected in the ΛCDM scheme. Indeed, if Fornax would have a CDM halo with a standard density profile, all its globular clusters should have sunk to the galactic centre many Gyr ago due to dynamical friction. Due to this, some authors proposed that the most massive clusters may have formed out of Fornax and later tidally captured. In this paper, we investigate the past evolution of the Fornax GC system by using both a recently developed, semi-analytical treatment of dynamical friction and direct N-body simulations of the orbital evolution of the globular clusters within Fornax and of Fornax galaxy around the Milky Way. Our results suggest that an `in situ' origin for all the clusters is likely if their observed positions are close to their spatial ones and their orbits are almost circular. Moreover, the Milky Way seems to accelerate the GC decay reducing the decay time of 15 per cent. Nevertheless, our results indicate that the GCs survival probability exceeds 50 per cent, even in the case of cuspy density profiles. We conclude that more detailed data are required to shed light on the Fornax dark matter content, to distinguish between a cuspy or a cored profile.

  6. First results from SAPAC: towards a 3D-picture of the Fornax cluster core

    CERN Document Server

    Jerjen, L P D H

    2006-01-01

    A sophisticated SBF analysis package has been developed, designed to measure distances of early-type galaxies by means of surface brightness fluctuations of unresolved stars. This suite of programs called SAPAC is made readily available to the astronomical community for extensive testing with the long-term goal to provide the necessary tools for systematic distance surveys of early-type galaxies using modern optical/NIR telescopes equipped with wide-field cameras. We discuss the technical and scientific concepts of SAPAC and demonstrate its capabilities by analysing deep B and R-band CCD images of 10 dwarf elliptical (dE) galaxy candidates in the Fornax cluster obtained with FORS1 at the VLT. All candidates are confirmed as cluster members. We then turn our attention to the innermost region of the Fornax cluster. A total of 29 early-type galaxies closer than three cluster core radii (2 degrees) from the central galaxy NGC1399 have radial velocities and SBF distances. Their Hubble diagram exhibits a pronounced...

  7. Compact Stellar Systems in the Fornax Cluster Super-massive Star Clusters or Extremely Compact Dwarf Galaxies?

    CERN Document Server

    Drinkwater, M J; Gregg, M D; Phillipps, S

    2000-01-01

    We describe a population of compact objects in the centre of the Fornax Cluster which were discovered as part of our 2dF Fornax Spectroscopic Survey. These objects have spectra typical of old stellar systems, but are unresolved on photographic sky survey plates. They have absolute magnitudes -13clusters, but fainter than any known compact dwarf galaxies. These objects are all within 30 arcminutes of the central galaxy of the cluster, NGC 1399, but are distributed over larger radii than the globular cluster system of that galaxy. We suggest that these objects are either super-massive star clusters (intra-cluster globular clusters or tidally stripped nuclei of dwarf galaxies) or a new type of low-luminosity compact elliptical dwarf (M32-type) galaxy. The best way to test these hypotheses will be to obtain high resolution imaging and high-dispersion spectroscopy to determine their structures and mass-to-light ratios. This will allow us ...

  8. Surface Brightness Profiles for a sample of LMC, SMC and Fornax galaxy Globular Clusters

    CERN Document Server

    Noyola, Eva

    2007-01-01

    We use Hubble Space Telescope archival images to measure central surface brightness profiles of globular clusters around satellite galaxies of the Milky Way. We report results for 21 clusters around the LMC, 5 around the SMC, and 4 around the Fornax dwarf galaxy. The profiles are obtained using a recently developed technique based on measuring integrated light, which is tested on an extensive simulated dataset. Our results show that for 70% of the sample, the central photometric points of our profiles are brighter than previous measurements using star counts with deviations as large as 2 mag/arcsec^2. About 40% of the objects have central profiles deviating from a flat central core, with central logarithmic slopes continuously distributed between -0.2 and -1.2. These results are compared with those found for a sample of Galactic clusters using the same method. We confirm the known correlation in which younger clusters tend to have smaller core radii, and we find that they also have brighter central surface br...

  9. Suzaku and XMM-Newton Observations of the Fornax cluster: Temperature and Metallicity Distribution

    CERN Document Server

    Murakami, Hideyoshi; Matsushita, Kyoko; Nagino, Ryo; Sato, Takuya; Sato, Kosuke; Kawaharada, Madoka; Nakazawa, Kazuhiro; Ohashi, Takaya; Takei, Yoh

    2011-01-01

    Suzaku observed a central region and five offset regions within 0.2 r180 in the Fornax cluster, a nearby poor cluster, and XMM-Newton mapped the cluster with 15 pointings out to 0.3 r180. The distributions of O, Mg, Si, S, and Fe in the intracluster medium (ICM) were studied with Suzaku, and those of Fe and temperature were studied with XMM. The temperature of the ICM gradually decreases with radius from 1.3 keV at 0.04 r180 to 1 keV at 0.2-0.3 r180. If the new solar abundances of Lodders et al. (2003) and a single-temperature plasma model are adopted, O, Mg, Si, S, and Fe show similar abundances: 0.4-0.6 solar within 0.02-0.2 r180. This Fe abundance is similar to those at 0.1-0.2 r180 in rich clusters and other groups of galaxies. At 0.2-0.3 r180, the Fe abundance becomes 0.2-0.3 solar. A two-temperature plasma model yields ICM abundances that are higher by a factor of 1.2-1.5, but gives similar abundance ratios among O, Mg, Si, S, and Fe. The northern region has a lower ICM temperature and higher brightness...

  10. Stellar population gradients in Fornax Cluster S0 galaxies: connecting bulge and disk evolution

    CERN Document Server

    Bedregal, A G; Aragón-Salamanca, A; Merrifield, M R

    2011-01-01

    We present absorption-line index gradients for a sample of S0 galaxies in the Fornax Cluster. The sample has been selected to span a wide range in galaxy mass, and the deep VLT-FORS2 spectroscopy allows us to explore the stellar populations all the way to the outer disk-dominated regions of these galaxies. We find that globally, in both bulges and disks, star formation ceased earliest in the most massive systems, as a further manifestation of downsizing. However, within many galaxies, we find an age gradient which indicates that star formation ended first in the outermost regions. Metallicity gradients, when detected, are always negative such that the galaxy centres are more metal-rich. This finding fits with a picture in which star formation continued in the central regions, with enriched material, after it had stopped in the outskirts. Age and metallicity gradients are correlated, suggesting that large differences in star formation history between the inner and outer parts of S0 galaxies yield large differe...

  11. The Stellar Populations of Nuclei, Globular Clusters, and Stars in dE Galaxies in Virgo and Fornax

    Science.gov (United States)

    Whitfield Miller, Bryan; Hyazinth Puzia, Thomas; Hilker, Michael; Sanchez-Janssen, Ruben; Kissler-Patig, Markus

    2015-08-01

    We present ages and metallicities for globular clusters, nuclei, and underlying stars in nucleated dwarf elliptical galaxies (dE,N) in the Virgo and Fornax Cluster based on Lick/IDS index measurements and SSP models. Gemini/GMOS spectroscopy shows that the globular clusters are mostly old and metal-poor, very similar to the globular clusters in the Milky Way halo. The nuclei and underlying stars tend to be more metal-rich than the globular clusters and have a wide range of ages. The [α/Fe] ratios for both the globular clusters and nuclei range between 0.0 and 0.3. Formation scenarios for globular clusters and nuclei will be discussed.

  12. Evidence for a chemical enrichment coupling of globular clusters and field stars in the Fornax dSph

    CERN Document Server

    Hendricks, Benjamin; Johnson, Christian I; Frank, Matthias J; Koch, Andreas; Mateo, Mario; Bailey, John I

    2016-01-01

    The globular cluster H4, located in the center of the Fornax dwarf spheroidal galaxy, is crucial for understanding the formation and chemical evolution of star clusters in low-mass galactic environments. H4 is peculiar because the cluster is significantly more metal-rich than the galaxy's other clusters, is located near the galaxy center, and may also be the youngest cluster in the galaxy. In this study, we present detailed chemical abundances derived from high-resolution (R~28000) spectroscopy of an isolated H4 member star for comparison with a sample of 22 nearby Fornax field stars. We find the H4 member to be depleted in the alpha-elements Si, Ca, and Ti with [Si/Fe]=-0.35+-0.34, [Ca/Fe]=+0.05+-0.08, and [Ti/Fe]=-0.27+-0.23, resulting in an average [alpha/Fe]=-0.19+-0.14. If this result is representative of the average cluster properties, H4 is the only known system with a low [alpha/Fe] ratio and a moderately low metallicity embedded in an intact birth environment. For the field stars we find a clear sequ...

  13. Search for Dark Matter Annihilation Signals from the Fornax Galaxy Cluster with H.E.S.S

    CERN Document Server

    Abramowski, A; Aharonian, F; Akhperjanian, A G; Anton, G; Balzer, A; Barnacka, A; de Almeida, U Barres; Becherini, Y; Becker, J; Behera, B; Bernlöhr, K; Birsin, E; Biteau, J; Bochow, A; Boisson, C; Bolmont, J; Bordas, P; Brucker, J; Brun, F; Brun, P; Bulik, T; Büsching, I; Carrigan, S; Casanova, S; Cerruti, M; Chadwick, P M; Charbonnier, A; Chaves, R C G; Cheesebrough, A; Clapson, A C; Coignet, G; Cologna, G; Conrad, J; Dalton, M; Daniel, M K; Davids, I D; Degrange, B; Deil, C; Dickinson, H J; Djannati-Ataï, A; Domainko, W; Drury, L O'C; Dubus, G; Dutson, K; Dyks, J; Dyrda, M; Egberts, K; Eger, P; Espigat, P; Fallon, L; Farnier, C; Fegan, S; Feinstein, F; Fernandes, M V; Fiasson, A; Fontaine, G; Förster, A; Füßling, M; Gallant, Y A; Gast, H; Gérard, L; Gerbig, D; Giebels, B; Glicenstein, J F; Glück, B; Goret, P; Göring, D; Häffner, S; Hague, J D; Hampf, D; Hauser, M; Heinz, S; Heinzelmann, G; Henri, G; Hermann, G; Hinton, J A; Hoffmann, A; Hofmann, W; Hofverberg, P; Holler, M; Horns, D; Jacholkowska, A; de Jager, O C; Jahn, C; Jamrozy, M; Jung, I; Kastendieck, M A; Katarzyński, K; Katz, U; Kaufmann, S; Keogh, D; Khangulyan, D; Khélifi, B; Klochkov, D; Kluźniak, W; Kneiske, T; Komin, Nu; Kosack, K; Kossakowski, R; Laffon, H; Lamanna, G; Lennarz, D; Lohse, T; Lopatin, A; Lu, C -C; Marandon, V; Marcowith, A; Masbou, J; Maurin, D; Maxted, N; Mayer, M; McComb, T J L; Medina, M C; Méhault, J; Moderski, R; Moulin, E; Naumann, C L; Naumann-Godo, M; de Naurois, M; Nedbal, D; Nekrassov, D; Nguyen, N; Nicholas, B; Niemiec, J; Nolan, S J; Ohm, S; Wilhelmi, E de Oña; Opitz, B; Ostrowski, M; Oya, I; Panter, M; Arribas, M Paz; Pedaletti1, G; Pelletier, G; Petrucci, P -O; Pita, S; Pühlhofer, G; Punch, M; Quirrenbach, A; Raue, M; Rayner, S M; Reimer, A; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Ripken, J; Rob, L; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Ruppel, J; Sahakian, V; Sanchez, D A; Santangelo, A; Schlickeiser, R; Schöck, F M; Schulz, A; Schwanke, U; Schwarzburg, S; Schwemmer, S; Sheidaei, F; Skilton, J L; Sol, H; Spengler, G; Stawarz, Ł; Steenkamp, R; Stegmann, C; Stinzing, F; Stycz, K; Sushch, I; Szostek, A; Tavernet, J -P; Terrier, R; Tluczykont, M; Valerius, K; van Eldik, C; Vasileiadis, G; Venter, C; Vialle, J P; Viana, A; Vincent, P; Völk, H J; Volpe, F; Vorobiov, S; Vorster, M; Wagner, S J; Ward, M; White, R; Wierzcholska, A; Zacharias, M; Zajczyk, A; Zdziarski, A A; Zech, A; Zechlin, H -S

    2012-01-01

    The Fornax galaxy cluster was observed with the High Energy Stereoscopic System (H.E.S.S.) for a total live time of 14.5 hours, searching for very-high-energy (VHE, E>100 GeV) gamma-rays from dark matter (DM) annihilation. No significant signal was found in searches for point-like and extended emissions. Using several models of the DM density distribution, upper limits on the DM velocity-weighted annihilation cross-section as a function of the DM particle mass are derived. Constraints are derived for different DM particle models, such as those arising from Kaluza-Klein and supersymmetric models. Various annihilation final states are considered. Possible enhancements of the DM annihilation gamma-ray flux, due to DM substructures of the DM host halo, or from the Sommerfeld effect, are studied. Additional gamma-ray contributions from internal bremsstrahlung and inverse Compton radiation are also discussed. For a DM particle mass of 1 TeV, the exclusion limits at 95% of confidence level reach values of ~ 10^-23...

  14. Fermi-LAT constraints on dark matter annihilation cross section from observations of the Fornax cluster

    NARCIS (Netherlands)

    Ando, S.; Nagai, D.

    2012-01-01

    We analyze 2.8-yr data of 1-100 GeV photons for clusters of galaxies, collected with the Large Area Telescope onboard the Fermi satellite. By analyzing 49 nearby massive clusters located at high Galactic latitudes, we find no excess gamma-ray emission towards directions of the galaxy clusters. Using

  15. Search for Dark Matter Annihilation Signals from the Fornax Galaxy Cluster with H.E.S.S.

    Science.gov (United States)

    Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Balzer, A.; Barnacka, A.; Barres de Almeida, U.; Becherini, Y.; Becker, J.; Behera, B.; Bernlöhr, K.; Birsin, E.; Biteau, J.; Bochow, A.; Boisson, C.; Bolmont, J.; Bordas, P.; Brucker, J.; Brun, F.; Brun, P.; Bulik, T.; Büsching, I.; Carrigan, S.; Casanova, S.; Cerruti, M.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Clapson, A. C.; Coignet, G.; Cologna, G.; Conrad, J.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; Drury, L. O'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Füßling, M.; Gallant, Y. A.; Gast, H.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Häffner, S.; Hague, J. D.; Hampf, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holler, M.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jamrozy, M.; Jung, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Keogh, D.; Khangulyan, D.; Khélifi, B.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Laffon, H.; Lamanna, G.; Lennarz, D.; Lohse, T.; Lopatin, A.; Lu, C.-C.; Marandon, V.; Marcowith, A.; Masbou, J.; Maurin, D.; Maxted, N.; Mayer, M.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann, C. L.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nguyen, N.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; de Oña Wilhelmi, E.; Opitz, B.; Ostrowski, M.; Oya, I.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raue, M.; Rayner, S. M.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Sanchez, D. A.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schulz, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Sheidaei, F.; Skilton, J. L.; Sol, H.; Spengler, G.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Szostek, A.; Tavernet, J.-P.; Terrier, R.; Tluczykont, M.; Valerius, K.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Vialle, J. P.; Viana, A.; Vincent, P.; Völk, H. J.; Volpe, F.; Vorobiov, S.; Vorster, M.; Wagner, S. J.; Ward, M.; White, R.; Wierzcholska, A.; Zacharias, M.; Zajczyk, A.; Zdziarski, A. A.; Zech, A.; Zechlin, H.-S.; H. E. S. S. Collaboration

    2012-05-01

    The Fornax galaxy cluster was observed with the High Energy Stereoscopic System for a total live time of 14.5 hr, searching for very high energy (VHE; E > 100GeV) γ-rays from dark matter (DM) annihilation. No significant signal was found in searches for point-like and extended emissions. Using several models of the DM density distribution, upper limits on the DM velocity-weighted annihilation cross-section langσvrang as a function of the DM particle mass are derived. Constraints are derived for different DM particle models, such as those arising from Kaluza-Klein and supersymmetric models. Various annihilation final states are considered. Possible enhancements of the DM annihilation γ-ray flux, due to DM substructures of the DM host halo, or from the Sommerfeld effect, are studied. Additional γ-ray contributions from internal bremsstrahlung and inverse Compton radiation are also discussed. For a DM particle mass of 1 TeV, the exclusion limits at 95% of confidence level reach values of langσvrang95% C.L. ~ 10-23 cm3 s-1, depending on the DM particle model and halo properties. Additional contribution from DM substructures can improve the upper limits on langσvrang by more than two orders of magnitude. At masses around 4.5 TeV, the enhancement by substructures and the Sommerfeld resonance effect results in a velocity-weighted annihilation cross-section upper limit at the level of langσvrang95% C.L. ~10-26 cm3 s-1.

  16. The supermassive black hole of Fornax A

    CERN Document Server

    Nowak, N; Thomas, J; Bender, R; Davies, R I; Gebhardt, K

    2008-01-01

    The radio galaxy Fornax A (NGC 1316) is a prominent merger remnant in the outskirts of the Fornax cluster. Its giant radio lobes suggest the presence of a powerful AGN and thus a central supermassive black hole (SMBH). We present high-resolution adaptive optics assisted integral-field data of Fornax A, taken with SINFONI at the Very Large Telescope in the K band. We use axisymmetric orbit models to determine the mass of the SMBH in the centre of Fornax A. The three-dimensional nature of our data provides the possibility to directly test the consistency of the data with axisymmetry by modelling each of the four quadrants separately. According to our dynamical models, consistent SMBH masses and dynamical Ks band mass-to-light ratios are obtained for all quadrants, with =1.3x10^8 M_\\odot (rms(M_BH)=0.4x10^8 Msun) and =0.68 (rms(M/L)=0.03), confirming the assumption of axisymmetry. For the folded and averaged data we find M_BH=(1.5+0.75-0.8)x10^8 Msun and M/L=(0.65+0.075-0.05) (3-sigma errors). Thus the black-hol...

  17. Distance scale and variable stars in Local Group Galaxies LMC and Fornax

    CERN Document Server

    Maio, M; Clementini, G; Greco, C; Gullieuszik, M; Held, E V; Poretti, E; Rizzi, L; Bragaglia, A; Carretta, E; Fabrizio, L D; Gratton, R; Taribello, E

    2003-01-01

    We briefly review our photometric and spectroscopic study of RR Lyrae variable stars in the bar of the Large Magellanic Cloud (LMC), that allowed us to reconcile the so-called "short" and "long" distance moduli of the LMC on the value mod_LMC=18.51 +/- 0.085 mag. Then we present preliminary results from the photometric study of a 33' x 34' area in the Fornax dwarf spheroidal galaxy containing the stellar clusters Fornax 3 (NGC 1049) and 6. We identified about 1000 candidate variables in this field of Fornax, and report the first detection and measure of about 60 RR Lyrae variable stars in the globular cluster Fornax 3.

  18. Modelado de la luz difusa en el cúmulo de Fornax

    Science.gov (United States)

    Cifuentes Cárdenas, A.; Cellone, S. A.; Forte, J. C.

    Studies of the globular cluster system of the elliptical galaxy NGC 1399, the central galaxy in the Fornax cluster, suggest that many globulars may be associated with the cluster of galaxies potential, and not being bound to any single galaxy. However, the galaxies are diffuse objects and without a defined edge; this raises a question: is there a true "intergalactic medium?". The goal of this work is to quantify the contribution to "intergalactic" surface brightness due to the outermost zones of each galaxy in the Fornax cluster and also quantify the surface density of globular clusters associated to this diffuse component.

  19. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    CERN Document Server

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M

    1997-01-01

    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  20. ACS photometry of the globular cluster B514

    CERN Document Server

    Galleti, S; Bellazzini, M; Buzzoni, A; Pecci, F F

    2006-01-01

    We present deep F606W, F814W ACS photometry of the recently discovered globular cluster B514, the outermost known globular in the M31 galaxy. The cluster appears quite extended and member stars are unequivocally identified out to ~200 pc from the center. The Color Magnitude Diagram reveals a steep Red Giant Branch (RGB), and a Horizontal Branch (HB) extending blue ward of the instability strip, indicating that B514 is a classical old metal-poor globular cluster. The RGB locus and the position of the RGB Bump are both consistent with a metallicity [Fe/H] ~ -1.8, in excellent agreement with spectroscopic estimates. A preliminary estimate of the integrated absolute V magnitude (M_V< -9.1) suggests that B514 is among the brightest globulars of M31.

  1. Unveiling a Rich System of Faint Dwarf Galaxies in the Next Generation Fornax Survey

    CERN Document Server

    Munoz, Roberto P; Puzia, Thomas H; Taylor, Matthew A; Ordenes-Briceno, Yasna; Alamo-Martinez, Karla; Ribbeck, Karen X; Angel, Simon; Capaccioli, Massimo; Cote, Patrick; Ferrarese, Laura; Galaz, Gaspar; Hempel, Maren; Hilker, Michael; Jordan, Andres; Lancon, Ariane; Mieske, Steffen; Paolillo, Maurizio; Richtler, Tom; Sanchez-Janssen, Ruben; Zhang, Hongxin

    2015-01-01

    We report the discovery of 158 previously undetected dwarf galaxies in the Fornax cluster central regions using a deep coadded $u, g$ and $i$-band image obtained with the DECam wide-field camera mounted on the 4-meter Blanco telescope at the Cerro Tololo Interamerican Observatory as part of the {\\it Next Generation Fornax Survey} (NGFS). The new dwarf galaxies have quasi-exponential light profiles, effective radii $0.1\\!\\!75\\%$ at luminosities brighter than $M_i\\!\\simeq\\!-15.0$ mag to $0\\%$ at luminosities fainter than $M_i\\!\\simeq\\!-10.0$ mag. The two-point correlation function analysis of the NGFS dwarf sample shows an excess on length scales below $\\sim\\!100$ kpc, pointing to the clustering of dwarf galaxies in the Fornax cluster core.

  2. The Fornax-Leo-Sculptor stream revisited

    Science.gov (United States)

    Majewski, Steven R.

    1994-08-01

    Lynden-Bell first demonstrated that the satellites of the Milky Way appear situated along two great 'streams' in the sky: the 'Magellanic stream' and the 'Fornax-Leo-Sculptor (FLS) stream.' Further exploration of the three-dimensional distribution of Galactic satellites reveals that the recently discovered Sextans and Phoenix dwarf spheroidal galaxies also lie near the plane defined by the FLS galaxies, and therefore strengthens the evidence in favor of the FLS stream. Moreover, a specific group of globular clusters -- those exhibiting the reddest horizontal branches (HBs) among those identified as 'young halo' by Zinn -- appear to populate the FLS stream. As previously demonstrated by Zinn, the spatial distribution of old halo globulars appears to be flattened toward the Galactic plane, and therefore the old halo clusters are typically anti-correlated to the nearly orthogonal FLS stream. A scenario is postulated wherein the Galactic satellites of the FLS stream and the red HB, young halo globular clusters share a common origin in the accretion of a formerly larger, parent satellite galaxy or Searle & Zinn 'fragment.'

  3. The ACS Virgo Cluster Survey. I. Introduction to the Survey

    CERN Document Server

    Côté, P; Ferrarese, L; Jordan, A; Mei, S; Merritt, D; Milosavljevic, M; Peng, E W; Tonry, J L; West, M J; Cote, Patrick; Blakeslee, John P.; Ferrarese, Laura; Jordan, Andres; Mei, Simona; Merritt, David; Milosavljevic, Milos; Peng, Eric W.; Tonry, John L.; West, Michael J.

    2004-01-01

    The Virgo Cluster is the dominant mass concentration in the Local Supercluster and the largest collection of elliptical and lenticular galaxies in the nearby universe. In this paper, we present an introduction to the ACS Virgo Cluster Survey: a program to image, in the F475W and F850LP bandpasses (Sloan g and z), 100 early-type galaxies in the Virgo Cluster using the Advanced Camera for Surveys on the Hubble Space Telescope. We describe the selection of the program galaxies and their ensemble properties, the choice of filters, the field placement and orientation, the limiting magnitudes of the survey, coordinated parallel observations of 100 "intergalactic" fields with WFPC2, and supporting ground-based spectroscopic observations of the program galaxies. In terms of depth, spatial resolution, sample size and homogeneity, this represents the most comprehensive imaging survey to date of early-type galaxies in a cluster environment. We briefly describe the main scientific goals of the survey which include the me...

  4. Cluster emission in the radioactive decay of 223Ac

    CERN Document Server

    Steyn, G F; Faccio, D; Bonetti, R; Tretyakova, S P; Shishkin, S V; Ogloblin, A A; Pik-Pichak, G A; Vermeulen, C; van der Meulen, N P; van der Walt, T N; McGee, D

    2010-01-01

    The branching ratio of 223Ac decay by spontaneous 14C emission was measured and a search for 15N clusters was performed. After exposure of a hemispherical array of solid-state nuclear track detectors, 347 14C events were identified and no 15N events. B(14C) = λ(14C)/λ(α) = (3.2 ± 1.0) x 10-11 is consistent with a favoured ground state to ground state transition. As no nitrogen tracks were found, only an upper limit could be inferred for 15N emission, B(15N) = λ(15N)/λ(α) ≤ 2.2 x 10-13 (confidence limit 90%), consistent with an unfavoured transition. Intense 227Pa sources were produced for this study, using the reaction 232Th(p,6n)227Pa. This offered an opportunity to compare the measured source strength with predictions based on published excitation function data.

  5. The Chemical Enrichment History of the Fornax Dwarf Spheroidal Galaxy from the Infrared Calcium Triplet

    CERN Document Server

    Pont, F; Gallart, C; Hardy, E; Winnick, R A; Pont, Frederic; Zinn, Robert; Gallart, Carme; Hardy, Eduardo; Winnick, Rebeccah

    2004-01-01

    Near infrared spectra were obtained for 117 red giants in the Fornax dwarf spheroidal galaxy with the FORS1 spectrograph on the VLT, in order to study the metallicity distribution of the stars and to lift the age-metallicity degeneracy of the red giant branch (RGB) in the color-magnitude diagram (CMD). Metallicities are derived from the equivalent widths of the infrared Calcium triplet lines at 8498, 8542, and 8662 A, calibrated with data from globular clusters, the open cluster M67 and the LMC. For a substantial portion of the sample, the strength of the Calcium triplet is unexpectedly high, clearly indicating that the main stellar population of Fornax is significantly more metal-rich than could be inferred from the position of its RGB in the CMD. We show that the relative narrowness of the RGB in Fornax is caused by the superposition of stars of very different ages and metallicities. The metallicity distribution in Fornax is centered at [Fe/H]= -0.9, with a metal-poor tail extending to [Fe/H] ~= -2. While t...

  6. The ACS Virgo Cluster Survey. XII. The Luminosity Function of Globular Clusters in Early Type Galaxies

    CERN Document Server

    Jordan, A; Côté, P; Ferrarese, L; Peng, E W; Mei, S; Villegas, D; Merritt, D; Tonry, J L; West, M J; Jordan, Andres; Laughlin, Dean E. Mc; Cote, Patrick; Ferrarese, Laura; Peng, Eric W.; Mei, Simona; Villegas, Daniela; Merritt, David; Tonry, John L.; West, Michael J.

    2007-01-01

    We analyze the luminosity function of the globular clusters (GCs) belonging to the early-type galaxies observed in the ACS Virgo Cluster Survey. We have obtained estimates for a Gaussian representation of the GC luminosity function (GCLF) for 89 galaxies. We have also fit the GCLFs with an "evolved Schechter function", which is meant to reflect the preferential depletion of low-mass GCs, primarily by evaporation due to two-body relaxation, from an initial Schechter mass function similar to that of young massive clusters. We find a significant trend of the GCLF dispersion with galaxy luminosity, in the sense that smaller galaxies have narrower GCLFs. We show that this narrowing of the GCLF in a Gaussian description is driven by a steepening of the GC mass function above the turnover mass, as one moves to smaller host galaxies. We argue that this behavior at the high-mass end of the GC mass function is most likely a consequence of systematic variations of the initial cluster mass function. The GCLF turnover mas...

  7. The HST/ACS Coma Cluster Survey : II. Data Description and Source Catalogs

    NARCIS (Netherlands)

    Hammer, Derek; Kleijn, Gijs Verdoes; Hoyos, Carlos; den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Peletier, Reynier F.; Smith, Russell J.; Graham, Alister W.; Trentham, Neil; Peng, Eric; Puzia, Thomas H.; Lucey, John R.; Jogee, Shardha; Aguerri, Alfonso L.; Batcheldor, Dan; Bridges, Terry J.; Chiboucas, Kristin; Davies, Jonathan I.; del Burgo, Carlos; Erwin, Peter; Hornschemeier, Ann; Hudson, Michael J.; Huxor, Avon; Jenkins, Leigh; Karick, Arna; Khosroshahi, Habib; Kourkchi, Ehsan; Komiyama, Yutaka; Lotz, Jennifer; Marzke, Ronald O.; Marinova, Irina; Matkovic, Ana; Merritt, David; Miller, Bryan W.; Miller, Neal A.; Mobasher, Bahram; Mouhcine, Mustapha; Okamura, Sadanori; Percival, Sue; Phillipps, Steven; Poggianti, Bianca M.; Price, James; Sharples, Ray M.; Tully, R. Brent; Valentijn, Edwin

    2010-01-01

    The Coma cluster, Abell 1656, was the target of an HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially completed survey still covers ~50% of the core high-density region in

  8. The HST/ACS Coma Cluster Survey. II. Data Description and Source Catalogs

    NARCIS (Netherlands)

    Hammer, Derek; Verdoes Kleijn, Gijs; Hoyos, Carlos; den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzmán, Rafael; Peletier, Reynier F.; Smith, Russell J.; Graham, Alister W.; Trentham, Neil; Peng, Eric; Puzia, Thomas H.; Lucey, John R.; Jogee, Shardha; Aguerri, Alfonso L.; Batcheldor, Dan; Bridges, Terry J.; Chiboucas, Kristin; Davies, Jonathan I.; del Burgo, Carlos; Erwin, Peter; Hornschemeier, Ann; Hudson, Michael J.; Huxor, Avon; Jenkins, Leigh; Karick, Arna; Khosroshahi, Habib; Kourkchi, Ehsan; Komiyama, Yutaka; Lotz, Jennifer; Marzke, Ronald O.; Marinova, Irina; Matkovic, Ana; Merritt, David; Miller, Bryan W.; Miller, Neal A.; Mobasher, Bahram; Mouhcine, Mustapha; Okamura, Sadanori; Percival, Sue; Phillipps, Steven; Poggianti, Bianca M.; Price, James; Sharples, Ray M.; Tully, R. Brent; Valentijn, Edwin

    2010-01-01

    The Coma cluster, Abell 1656, was the target of an HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially completed survey still covers ~50% of the core high-density region in

  9. Ac hopping conduction at extreme disorder takes place on the percolating cluster

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, J. C.

    2008-01-01

    Simulations of the random barrier model show that ac currents at extreme disorder are carried almost entirely by the percolating cluster slightly above threshold; thus contributions from isolated low activation-energy clusters are negligible. The effective medium approximation in conjunction with...

  10. Fornax compact object survey FCOS: On the nature of Ultra Compact Dwarf galaxies

    CERN Document Server

    Mieske, S; Infante, L

    2004-01-01

    The results of the Fornax Compact Object Survey (FCOS) are presented. The FCOS aims at investigating the nature of the Ultra Compact Dwarf galaxies (UCDs) recently discovered in the center of the Fornax cluster (Drinkwater et al. 2000). 280 unresolved objects in the magnitude space covering UCDs and bright globular clusters (1820 mag) at 96% confidence. The mean velocity of the bright compact objects is consistent with that of the dwarf galaxy population in Fornax, but inconsistent with that of NGC 1399's globular cluster system at 93.5% confidence. The compact objects follow a colour magnitude relation with a slope very similar to that of normal dEs, but shifted about 0.2 mag redwards. The magnitude distribution of compact objects shows a fluent transition between UCDs and GCs with an overpopulation of 8 +/- 4 objects for V<20 mag with respect to the extrapolation of NGC 1399's GC luminosity function. The spatial distribution of bright compact objects is in comparison to the faint ones more extended at 88...

  11. HST/ACS colour-magnitude diagrams of M31 globular clusters

    CERN Document Server

    Perina, Sibilla; Bellazzini, Michele; Cacciari, Carla; Pecci, Flavio Fusi; Galleti, Silvia

    2009-01-01

    With the aim of increasing the sample of M31 clusters for which a colour magnitude diagram is available, we searched the HST archive for ACS images containing objects included in the Revised Bologna Catalogue of M31 globular clusters. Sixty-three such objects were found. We used the ACS images to confirm or revise their classification and we obtained useful CMDs for 11 old globular clusters and 6 luminous young clusters. We obtained simultaneous estimates of the distance, reddening, and metallicity of old clusters by comparing their observed field-decontaminated CMDs with a grid of template clusters of the Milky Way. We estimated the age of the young clusters by fitting with theoretical isochrones. For the old clusters, we found metallicities in the range -0.410 Gyr. All six candidate young clusters are found to have ages <1Gyr. With the present work the total number of M31 GCs with reliable optical CMD increases from 35 to 44 for the old clusters, and from 7 to 11 for the young ones. The old clusters show...

  12. Probable alpha and $14$^C cluster emission from hyper Ac nuclei

    CERN Document Server

    Santhosh, K P

    2013-01-01

    A systematic study on the probability for the emission of 4^He and 14^C cluster from hyper ${207-234}^$Ac and non-strange normal ${207-234}^$Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper ${207-234}^$Ac nuclei are unstable against 4^He emission and 14^C emission from hyper ${217-228}^$Ac are favorable for measurement. Our study also show that hyper ${207-234}^$Ac are stable against hyper 4^He and 14^C emission. The role of neutron shell closure (N=126) in hyper 214^Fr daughter and role of proton/ neutron shell closure (Z =82, N =126) in hyper 210^Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4^He and 14^C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14^C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process.

  13. Probable alpha and {sup 14}C cluster emission from hyper Ac nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Santhosh, K.P. [Kannur University, Swami Anandatheertha Campus, School of Pure and Applied Physics, Payyanur (India)

    2013-10-15

    A systematic study on the probability for the emission of {sup 4}He and {sup 14}C cluster from hyper {sub {Lambda}}{sup 207-234}Ac and non-strange normal {sup 207-234}Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper {sub {Lambda}}{sup 207-234}Ac nuclei are unstable against {sup 4}He emission and {sup 14}C emission from hyper {sub {Lambda}}{sup 217-228}Ac are favorable for measurement. Our study also show that hyper {sub {Lambda}}{sup 207-234}Ac are stable against hyper {sub {Lambda}}{sup 4}He and {sub {Lambda}}{sup 14}C emission. The role of neutron shell closure (N = 126) in hyper {sub {Lambda}}{sup 214}Fr daughter and role of proton/neutron shell closure (Z {approx} 82, N = 126) in hyper {sub {Lambda}}{sup 210}Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for {sup 4}He and {sup 14}C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and {sup 14}C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)

  14. Fornax A's Western Radio Lobe Composition

    Science.gov (United States)

    Kong, Jason J.; Nulsen, P. E. J.; Kraft, R. P.

    2011-01-01

    We present an analysis of the western radio lobe of Fornax A based on an XMM-Newton observation. We find little evidence for the inverse-Compton scattering of the cosmic microwave background as reported previously. The spectra in the energy range of 0.5-5 keV are well fitted by a thermal plus power law model for every spectral region we extracted. With a fixed photon index of 1.68, the X-ray flux density at 1 keV from the power law fit was measured to be cool gas extends from the central galaxy in the direction of the radio lobe of Fornax A. Spectral fits give a temperature of kT=0.76 keV over the radio lobe and kT=0.32 keV for the cool filament. The thermal emission from the radio lobe region is best explained as emission from a thin shell of shocked gas swept up by the rapidly expanding lobe. This work is supported in part by the NSF REU and DOD ASSURE programs under NSF grant no. 0754568 and by the Smithsonian Institution.

  15. Rotating stellar populations in the Fornax dSph galaxy

    CERN Document Server

    del Pino, Andrés; Hidalgo, Sebastian L; Lokas, Ewa L

    2016-01-01

    We present a novel analysis of the internal kinematics of the Fornax dwarf spheroidal galaxy. Our results are based on the largest sample of spectroscopic data for Fornax stars presently available ($> 2500$ stars), for which we have chemical and kinematic information. We introduce new software, Beacon, designed to detect chemo-kinematic patterns among stars of different stellar populations using their metallicity and velocity along the line of sight. Applying Beacon to Fornax we have detected non-negligible rotation signals around main optical axes of the galaxy, characteristic for a triaxial system partially supported by rotation. The dominant rotation pattern is relatively strong ($\\sim 12$ km s$^{-1}$), but the galaxy also shows additional weaker albeit complex rotation patterns. Using the information available from the star formation history of Fornax we have also derived the average age of the different chemo-kinematic components found by Beacon, which has allowed us to obtain its kinematic history. Our ...

  16. VizieR Online Data Catalog: HST/ACS Coma Cluster Survey. X. (den Brok+, 2014)

    NARCIS (Netherlands)

    den Brok, M.; Peletier, R. F.; Seth, A.; Balcells, M.; Dominguez, L.; Graham, A. W.; Carter, D.; Erwin, P.; Ferguson, H. C.; Goudfrooij, P.; Guzman, R.; Hoyos, C.; Jogee, S.; Lucey, J.; Phillipps, S.; Puzia, T.; Valentijn, E.; Kleijn, G. V.; Weinzirl, T.

    2014-01-01

    The Coma ACS Survey (Carter et al., 2008ApJS..176..424C) provides data in two passbands for 25 fields pointed at the core of the Coma cluster and at the outskirts. The exposure times in the two passbands, F814W and F475W (which are roughly equivalent to the IC and g band) were ~1400 and ~2600s. The

  17. The SLUGGS Survey: HST/ACS Mosaic Imaging of the NGC 3115 Globular Cluster System

    CERN Document Server

    Jennings, Zachary G; Romanowsky, Aaron J; Brodie, Jean P; Arnold, Jacob A; Lin, Dacheng; Irwin, Jimmy A; Sivakoff, Gregory R; Wong, Ka-Wah

    2014-01-01

    We present HST/ACS $g$ and $z$ photometry and half-light radii $R_{\\rm h}$ measurements of 360 globular cluster (GC) candidates around the nearby S0 galaxy NGC 3115. We also include Subaru/Suprime-Cam $g$, $r$, and $i$ photometry of 421 additional candidates. The well-established color bimodality of the GC system is obvious in the HST/ACS photometry. We find evidence for a "blue tilt" in the blue GCs, wherein the blue GCs get redder as luminosity increases, indicative of a mass-metallicity relationship. We find a color gradient in both the red and blue subpopulations, with each group of clusters becoming bluer at larger distances from NGC 3115. The gradient is of similar strength in both subpopulations, but is monotonic and more significant for the blue clusters. On average, the blue clusters have ~10% larger $R_{\\rm h}$ than the red clusters. This average difference is less than is typically observed for early-type galaxies but does match that measured in the literature for M104, suggesting that morphology a...

  18. ACS imaging of star clusters in M51. I. Identification and radius distribution

    CERN Document Server

    Scheepmaker, R A; Gieles, M; Bastian, N; Larsen, S S; Lamers, Henny J G L M

    2007-01-01

    We use HST/ACS observations of the spiral galaxy M51 in F435W, F555W and F814W to select a large sample of star clusters with accurate effective radius measurements in an area covering the complete disc of M51. We present the dataset and study the radius distribution and relations between radius, colour, arm/interarm region, galactocentric distance, mass and age. We select a sample of 7698 (F435W), 6846 (F555W) and 5024 (F814W) slightly resolved clusters and derive their effective radii by fitting the spatial profiles with analytical models convolved with the point spread function. The radii of 1284 clusters are studied in detail. We find cluster radii between 0.5 and ~10 pc, and one exceptionally large cluster candidate with a radius of 21.6 pc. The median radius is 2.1 pc. We find 70 clusters in our sample which have colours consistent with being old GC candidates and we find 6 new "faint fuzzy" clusters in, or projected onto, the disc of M51. The radius distribution can not be fitted with a power law, but ...

  19. The ACS survey of globular clusters. XIII. Photometric calibration in comparison with Stetson standards

    CERN Document Server

    Hempel, Maren; Anderson, Jay; Aparicio, Antonio; Bedin, Luigi R; Chaboyer, Brian; Majewski, Steven R; Marín-Franch, Antonio; Milone, Antonino; Paust, Nathaniel E Q; Piotto, Giampaolo; Reid, I Neill; Rosenberg, Alfred; Siegel, Michael

    2013-01-01

    In this study we compare the photometric data of 34 Milky Way globular clusters, observed within the ACS Treasury Program (PI: Ata Sarajedini) with the corresponding ground-based data, provided by the Photometric Standard Field Catalogs of Stetson (2000, 2005). We focus on the transformation between the HST/ACS F606W to V-band and F814W to I-band only. The goal is to assess the validity of the filter transformation equations by Sirianni et al.(2005) with respect to their dependence on metallicity, Horizontal Branch morphology, mass and integrated (V-I) colour of the various globular clusters. Such a dependence is expected due to the fact that the transformation equations are based on the observations of only one globular cluster, i.e., NGC 2419. Surprisingly, the correlation between offset and metallicity is found to be weak, with a low level significance. The correlation between offset and Horizontal Branch structure, as well as total cluster mass is still weaker. Based on the available data we do not find t...

  20. ACS imaging of star clusters in M 51. I. Identification and radius distribution

    Science.gov (United States)

    Scheepmaker, R. A.; Haas, M. R.; Gieles, M.; Bastian, N.; Larsen, S. S.; Lamers, H. J. G. L. M.

    2007-07-01

    Context: Size measurements of young star clusters are valuable tools to put constraints on the formation and early dynamical evolution of star clusters. Aims: We use HST/ACS observations of the spiral galaxy M 51 in F435W, F555W and F814W to select a large sample of star clusters with accurate effective radius measurements in an area covering the complete disc of M 51. We present the dataset and study the radius distribution and relations between radius, colour, arm/interarm region, galactocentric distance, mass and age. Methods: We select a sample of 7698 (F435W), 6846 (F555W) and 5024 (F814W) slightly resolved clusters and derive their effective radii (R_eff) by fitting the spatial profiles with analytical models convolved with the point spread function. The radii of 1284 clusters are studied in detail. Results: We find cluster radii between 0.5 and ~10 pc, and one exceptionally large cluster candidate with R_eff = 21.6 pc. The median R_eff is 2.1 pc. We find 70 clusters in our sample which have colours consistent with being old GC candidates and we find 6 new “faint fuzzy” clusters in, or projected onto, the disc of M 51. The radius distribution can not be fitted with a power law similar to the one for star-forming clouds. We find an increase in R_eff with colour as well as a higher fraction of clusters with B-V ⪆ 0.05 in the interarm regions. We find a correlation between R_eff and galactocentric distance (RG) of the form R_eff∝ RG0.12±0.02, which is considerably weaker than the observed correlation for old Milky Way GCs. We find weak relations between cluster luminosity and radius: R_eff∝ L0.15±0.02 for the interarm regions and R_eff∝ L-0.11±0.01 for the spiral arm regions, but we do not observe a correlation between cluster mass and radius. Conclusions: The observed radius distribution indicates that shortly after the formation of the clusters from a fractal gas, the radii of the clusters have changed in a non-uniform way. We find tentative

  1. Deep ACS Imaging in the Globular Cluster NGC 6397: The Cluster Color Magnitude Diagram and Luminosity Function

    CERN Document Server

    Richer, Harvey B; Hurley, Jarrod; Anderson, Jay; King, Ivan; Davis, Saul; Fahlman, Gregory G; Hansen, Brad M S; Kalirai, Jason; Paust, Nathaniel; Rich, R Michael; Shara, Michael M

    2007-01-01

    We present the CMD from deep HST imaging in the globular cluster NGC 6397. The ACS was used for 126 orbits to image a single field in two colors (F814W, F606W) 5 arcmin SE of the cluster center. The field observed overlaps that of archival WFPC2 data from 1994 and 1997 which were used to proper motion (PM) clean the data. Applying the PM corrections produces a remarkably clean CMD which reveals a number of features never seen before in a globular cluster CMD. In our field, the main sequence stars appeared to terminate close to the location in the CMD of the hydrogen-burning limit predicted by two independent sets of stellar evolution models. The faintest observed main sequence stars are about a magnitude fainter than the least luminous metal-poor field halo stars known, suggesting that the lowest luminosity halo stars still await discovery. At the bright end the data extend beyond the main sequence turnoff to well up the giant branch. A populous white dwarf cooling sequence is also seen in the cluster CMD. Th...

  2. The HST/ACS Coma Cluster Survey : X. Nuclear star clusters in low-mass early-type galaxies: scaling relations

    NARCIS (Netherlands)

    Brok, Mark den; Peletier, Reynier F.; Seth, Anil; Balcells, Marc; Dominguez, Lilian; Graham, Alister W.; Carter, David; Erwin, Peter; Ferguson, Henry C.; Goudfrooij, Paul; Guzman, Rafael; Hoyos, Carlos; Jogee, Shardha; Lucey, John; Phillipps, Steven; Puzia, Thomas; Valentijn, Edwin; Verdoes Kleijn, Gijsbert; Weinzirl, Tim

    2014-01-01

    We present scaling relations between structural properties of nuclear star clusters and their host galaxies for a sample of early-type dwarf galaxies observed as part of the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) Coma Cluster Survey. We have analysed the light profiles of 200

  3. The HST/ACS Coma Cluster Survey - X. Nuclear star clusters in low-mass early-type galaxies : scaling relations

    NARCIS (Netherlands)

    den Brok, Mark; Peletier, Reynier F.; Seth, Anil; Balcells, Marc; Dominguez, Lilian; Graham, Alister W.; Carter, David; Erwin, Peter; Ferguson, Henry C.; Goudfrooij, Paul; Guzman, Rafael; Hoyos, Carlos; Jogee, Shardha; Lucey, John; Phillipps, Steven; Puzia, Thomas; Valentijn, Edwin; Kleijn, Gijs Verdoes; Weinzirl, Tim

    2014-01-01

    We present scaling relations between structural properties of nuclear star clusters and their host galaxies for a sample of early-type dwarf galaxies observed as part of the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) Coma Cluster Survey. We have analysed the light profiles of 200

  4. Rotating stellar populations in the Fornax dSph galaxy

    Science.gov (United States)

    del Pino, Andrés; Aparicio, Antonio; Hidalgo, Sebastian L.; Łokas, Ewa L.

    2017-03-01

    We present a novel analysis of the internal kinematics of the Fornax dwarf spheroidal galaxy. Our results are based on the largest sample of spectroscopic data for Fornax stars presently available (>2500 stars), for which we have chemical and kinematic information. We introduce new software, BEACON, designed to detect chemo-kinematic patterns among stars of different stellar populations using their metallicity and velocity along the line of sight. Applying BEACON to Fornax, we have detected non-negligible rotation signals around main optical axes of the galaxy, characteristic for a triaxial system partially supported by rotation. The dominant rotation pattern is relatively strong (∼12 km s-1), but the galaxy also shows additional weaker albeit complex rotation patterns. Using the information available from the star formation history of Fornax, we have also derived the average age of the different chemo-kinematic components found by BEACON, which has allowed us to obtain its kinematic history. Our results point to a possible major merger suffered by Fornax at redshift z ∼ 1, in agreement with the previous works.

  5. The HST/ACS Coma Cluster Survey. VIII. Barred Disk Galaxies in the Core of the Coma Cluster

    CERN Document Server

    Marinova, Irina; Weinzirl, Tim; Erwin, Peter; Trentham, Neil; Ferguson, Henry C; Hammer, Derek; Brok, Mark den; Graham, Alister W; Carter, David; Balcells, Marc; Goudfrooij, Paul; Guzman, Rafael; Hoyos, Carlos; Mobasher, Bahram; Mouhcine, Mustapha; Peletier, Reynier F; Peng, Eric; Kleijn, Gijs Verdoes

    2012-01-01

    (ABRIDGED) We use high resolution (~0.1") F814W ACS images from the HST ACS Treasury survey of the Coma cluster at z~0.02 to study bars in massive disk galaxies (S0s), and in dwarf galaxies in the Coma core. Our study helps constrain the evolution of bars and disks in dense environments and provides a comparison point for studies in lower density environments and at higher redshifts. (1) We characterize the fraction and properties of bars in a sample of 32 bright (M_V 10^9.5 M_sun) S0 galaxies, which dominate the population of massive disk galaxies in the Coma core. Measuring the S0 bar fraction must be handled carefully, as the results depend on the method used: the bar fraction for bright S0s in the Coma core is 50%+/-11%, 65%+/-11%, and 60%+/-11% for three methods of bar detection: strict ellipse fit criteria, relaxed ellipse fit criteria, and visual classification. (2) We compare the S0 bar fraction across different environments (Coma core, A901/902, Virgo). We find that the bar fraction among bright S0 ...

  6. The structure and dynamics of the AC114 galaxy cluster revisited

    CERN Document Server

    Proust, Dominique; Saviane, Ivo; Ivanov, Valentin D; Bresolin, Fabio; Salzer, John J; Capelato, Hugo V

    2015-01-01

    We present a dynamical analysis of the galaxy cluster AC114 based on a catalogue of 524 velocities. Of these, 169 (32%) are newly obtained at ESO (Chile) with the VLT and the VIMOS spectrograph. Data on individual galaxies are presented and the accuracy of the measured velocities is discussed. Dynamical properties of the cluster are derived. We obtain an improved mean redshift value z= 0.31665 +/- 0.0008 and velocity dispersion \\sigma= 1893+73-82 \\kms. A large velocity dispersion within the core radius and the shape of the infall pattern suggests that this part of the cluster is in a radial phase of relaxation with a very elongated radial filament spanning 12000 \\kms. A radial foreground structure is detected within the central 0.5/h Mpc radius, recognizable as a redshift group at the same central redshift value. We analyze the color distribution for this archetype Butcher-Oemler galaxy cluster and identify the separate red and blue galaxy sequences. The latter subset contains 44% of confirmed members of the ...

  7. THE ACS VIRGO CLUSTER SURVEY. XVII. THE SPATIAL ALIGNMENT OF GLOBULAR CLUSTER SYSTEMS WITH EARLY-TYPE HOST GALAXIES

    Energy Technology Data Exchange (ETDEWEB)

    Wang Qiushi; Peng, Eric W. [Department of Astronomy, Peking University, Beijing 100871 (China); Blakeslee, John P.; Cote, Patrick; Ferrarese, Laura [Herzberg Institute of Astrophysics, National Research Council of Canada, 5071 West Saanich Road, Victoria, BC V9E 2E7 (Canada); Jordan, Andres [Departamento de Astronomia y Astrofisica, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile); Mei, Simona [University of Paris 7 Denis Diderot, F-75205 Paris Cedex 13 (France); West, Michael J., E-mail: peng@pku.edu.cn [Maria Mitchell Observatory, 4 Vestal Street, Nantucket, MA 02554 (United States)

    2013-06-01

    We study the azimuthal distribution of globular clusters (GCs) in early-type galaxies and compare them to their host galaxies using data from the ACS Virgo Cluster Survey. We find that in host galaxies with visible elongation ({epsilon} > 0.2) and intermediate to high luminosities (M{sub z} < -19), the GCs are preferentially aligned along the major axis of the stellar light. The red (metal-rich) GC subpopulations show strong alignment with the major axis of the host galaxy, which supports the notion that these GCs are associated with metal-rich field stars. The metal-rich GCs in lenticular galaxies show signs of being more strongly associated with disks rather than bulges. Surprisingly, we also find that the blue (metal-poor) GCs can also show the same correlation. If the metal-poor GCs are part of the early formation of the halo and built up through mergers, then our results support a picture where halo formation and merging occur anisotropically, and that the present-day major axis is an indicator of the preferred merging axis.

  8. The distance to NGC1316 (Fornax A): yet another curious case

    CERN Document Server

    Cantiello, Michele; Blakeslee, John P; Di Rico, Gianluca; Limatola, Luca; Brocato, Enzo; Della Valle, Massimo; Gilmozzi, Roberto

    2013-01-01

    The distance of NGC1316, the brightest galaxy in Fornax, is an interesting test for the cosmological distance scale. First, because Fornax is the 2nd largest cluster of galaxies at <~25 Mpc after Virgo and, in contrast to Virgo, has a small line-of-sight depth; and second, because NGC1316 is the galaxy with the largest number of detected SNeIa, giving the opportunity to test the consistency of SNeIa distances internally and against other indicators. We measure SBF mags in NGC1316 from ground and space-based imaging data, providing a homogeneous set of measurements over a wide wavelength interval. The SBF, coupled with empirical and theoretical calibrations, are used to estimate the distance to the galaxy. We present the first B-band SBF measurements of NGC1316 and use them together with the optical and near-IR SBF data to analyze the properties of field stars. Our distance modulus m-M=31.59 +-0.05(stat) +-0.14(sys), when placed in a consistent Cepheid distance scale, agrees with the results from other indi...

  9. The HST/ACS Coma Cluster Survey. II. Data Description and Source Catalogs

    Science.gov (United States)

    Hammer, Derek; Kleijn, Gijs Verdoes; Hoyos, Carlos; Den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Peletier, Reynier F.; Smith, Russell J.; Graham, Alister W.; Trentham, Neil; Peng, Eric; Puzia, Thomas H.; Lucey, John R.; Jogee, Shardha; Aguerri, Alfonso L.; Batcheldor, Dan; Bridges, Terry J.; Davies, Jonathan I.; Del Burgo, Carlos; Erwin, Peter; Hornschemeier, Ann; Hudson, Michael J.

    2010-01-01

    The Coma cluster, Abell 1656, was the target of a HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially-completed survey still covers approximately 50% of the core high density region in Coma. Observations were performed for twenty-five fields with a total coverage area of 274 aremin(sup 2), and extend over a wide range of cluster-centric radii (approximately 1.75 Mpe or 1 deg). The majority of the fields are located near the core region of Coma (19/25 pointings) with six additional fields in the south-west region of the cluster. In this paper we present SEXTRACTOR source catalogs generated from the processed images, including a detailed description of the methodology used for object detection and photometry, the subtraction of bright galaxies to measure faint underlying objects, and the use of simulations to assess the photometric accuracy and completeness of our catalogs. We also use simulations to perform aperture corrections for the SEXTRACTOR Kron magnitudes based only on the measured source flux and its half-light radius. We have performed photometry for 76,000 objects that consist of roughly equal numbers of extended galaxies and unresolved objects. Approximately two-thirds of all detections are brighter than F814W=26.5 mag (AB), which corresponds to the 10sigma, point-source detection limit. We estimate that Coma members are 5-10% of the source detections, including a large population of compact objects (primarily GCs, but also cEs and UCDs), and a wide variety of extended galaxies from cD galaxies to dwarf low surface brightness galaxies. The initial data release for the HST-ACS Coma Treasury program was made available to the public in August 2008. The images and catalogs described in this study relate to our second data release.

  10. ACS Photometry of the Remote M31 Globular Cluster B514

    Science.gov (United States)

    Galleti, S.; Federici, L.; Bellazzini, M.; Buzzoni, A.; Pecci, F. Fusi

    2006-10-01

    We present deep F606W, F814W ACS photometry of the recently discovered globular cluster B514, the outermost known globular in the M31 galaxy. The cluster appears quite extended, and member stars are unequivocally identified out to ~200 pc from the center. The color-magnitude diagram reveals a steep red giant branch (RGB), and a horizontal branch extending blueward of the instability strip, indicating that B514 is a classical old metal-poor globular cluster. The RGB locus and the position of the RGB bump are both consistent with a metallicity [Fe/H]~-1.8, in excellent agreement with spectroscopic estimates. A preliminary estimate of the integrated absolute V magnitude (MV<~-9.1) suggests that B514 is among the brightest globulars of M31. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute (STScI), which is operated by AURA, Inc., under NASA contract NAS 5-26555.

  11. The ACS Virgo Cluster Survey IV: Data Reduction Procedures for Surface Brightness Fluctuation Measurements with the Advanced Camera for Surveys

    CERN Document Server

    Mei, S; Tonry, J L; Jordan, A; Peng, E W; Côté, P; Ferrarese, L; Merritt, D; Milosavljevic, M; West, M J; Mei, Simona; Blakeslee, John P.; Tonry, John L.; Jordan, Andres; Peng, Eric W.; Cote, Patrick; Ferrarese, Laura; Merritt, David; Milosavljevic, Milos; West, Michael J.

    2005-01-01

    The Advanced Camera for Surveys (ACS) Virgo Cluster Survey is a large program to image 100 early-type Virgo galaxies using the F475W and F850LP bandpasses of the Wide Field Channel of the ACS instrument on the Hubble Space Telescope (HST). The scientific goals of this survey include an exploration of the three-dimensional structure of the Virgo Cluster and a critical examination of the usefulness of the globular cluster luminosity function as a distance indicator. Both of these issues require accurate distances for the full sample of 100 program galaxies. In this paper, we describe our data reduction procedures and examine the feasibility of accurate distance measurements using the method of surface brightness fluctuations (SBF) applied to the ACS Virgo Cluster Survey F850LP imaging. The ACS exhibits significant geometrical distortions due to its off-axis location in the HST focal plane; correcting for these distortions by resampling the pixel values onto an undistorted frame results in pixel correlations tha...

  12. The HST/ACS Coma Cluster Survey. IV. Intergalactic Globular Clusters and the Massive Globular Cluster System at the Core of the Coma Galaxy Cluster

    NARCIS (Netherlands)

    Peng, Eric W.; Ferguson, Henry C.; Goudfrooij, Paul; Hammer, Derek; Lucey, John R.; Marzke, Ronald O.; Puzia, Thomas H.; Carter, David; Balcells, Marc; Bridges, Terry; Chiboucas, Kristin; del Burgo, Carlos; Graham, Alister W.; Guzmán, Rafael; Hudson, Michael J.; Matković, Ana; Merritt, David; Miller, Bryan W.; Mouhcine, Mustapha; Phillipps, Steven; Sharples, Ray; Smith, Russell J.; Tully, Brent; Verdoes Kleijn, Gijs

    2011-01-01

    Intracluster stellar populations are a natural result of tidal interactions in galaxy clusters. Measuring these populations is difficult, but important for understanding the assembly of the most massive galaxies. The Coma cluster of galaxies is one of the nearest truly massive galaxy clusters and is

  13. The HST/ACS Coma Cluster Survey : IV. Intergalactic Globular Clusters and the Massive Globular Cluster System at the Core of the Coma Galaxy Cluster

    NARCIS (Netherlands)

    Peng, Eric W.; Ferguson, Henry C.; Goudfrooij, Paul; Hammer, Derek; Lucey, John R.; Marzke, Ronald O.; Puzia, Thomas H.; Carter, David; Balcells, Marc; Bridges, Terry; Chiboucas, Kristin; del Burgo, Carlos; Graham, Alister W.; Guzman, Rafael; Hudson, Michael J.; Matkovic, Ana; Merritt, David; Miller, Bryan W.; Mouhcine, Mustapha; Phillipps, Steven; Sharples, Ray; Smith, Russell J.; Tully, Brent; Kleijn, Gijs Verdoes

    2011-01-01

    Intracluster stellar populations are a natural result of tidal interactions in galaxy clusters. Measuring these populations is difficult, but important for understanding the assembly of the most massive galaxies. The Coma cluster of galaxies is one of the nearest truly massive galaxy clusters and is

  14. Dark Matter Cores in the Fornax and Sculptor Dwarf Galaxies

    DEFF Research Database (Denmark)

    C. Amorisco, Nicola; Zavala Franco, Jesus; J. L. de Boer, Thomas

    2014-01-01

    We combine the detailed Star Formation Histories of the Fornax and Sculptor dwarf Spheroidals with the mass assembly history of their dark matter halo progenitors to estimate if the energy deposited by Supernova type II (SNeII) is sufficient to create a substantial dark matter core. Assuming...... the efficiency of energy injection of the SNeII into dark matter particles is \\epsilon=0.05, we find that a single early episode, z...

  15. The effect of tides on the Fornax dwarf spheroidal galaxy

    CERN Document Server

    Battaglia, Giuseppina; Nipoti, Carlo

    2015-01-01

    Estimates of the mass distribution and dark-matter (DM) content of dwarf spheroidal galaxies (dSphs) are usually derived under the assumption that the effect of the tidal field of the host galaxy is negligible over the radial extent probed by kinematic data-sets. We assess the implications of this assumption in the specific case of the Fornax dSph by means of N-body simulations of a satellite orbiting around the Milky Way. We consider observationally-motivated orbits and we tailor the initial distributions of the satellite's stars and DM to match, at the end of the simulations, the observed structure and kinematics of Fornax. In all our simulations the present-day observable properties of Fornax are not significantly influenced by tidal effects. The DM component is altered by the interaction with the Galactic field (up to 20% of the DM mass within 1.6 kpc is lost), but the structure and kinematics of the stellar component are only mildly affected even in the more eccentric orbit (more than 99% of the stellar ...

  16. A Chemical Evolution Model for the Fornax Dwarf Spheroidal Galaxy

    CERN Document Server

    Yuan, Zhen; Jing, Y P

    2015-01-01

    Fornax is the brightest Milky Way (MW) dwarf spheroidal galaxy and its star formation history (SFH) has been derived from observations. We estimate the time evolution of its gas mass and net inflow and outflow rates from the SFH using a simple star formation law that relates the star formation rate to the gas mass. We present a chemical evolution model on a 2D mass grid with supernovae (SNe) as sources of metal enrichment. We find that a key parameter controlling the enrichment is the mass M_x of the gas to mix with the ejecta from each SN. The choice of M_x depends on the evolution of SN remnants and on the global gas dynamics. It differs between the two types of SNe involved and between the periods before and after Fornax became an MW satellite at time t = t_sat . Our results indicate that due to the global gas outflow at t > t_sat , part of the ejecta from each SN may directly escape from Fornax. Sample results from our model are presented and compared with data.

  17. A Chemical Evolution Model for the Fornax Dwarf Spheroidal Galaxy

    Directory of Open Access Journals (Sweden)

    Yuan Zhen

    2016-01-01

    Full Text Available Fornax is the brightest Milky Way (MW dwarf spheroidal galaxy and its star formation history (SFH has been derived from observations. We estimate the time evolution of its gas mass and net inflow and outflow rates from the SFH usinga simple star formation law that relates the star formation rate to the gas mass. We present a chemical evolution model on a 2D mass grid with supernovae (SNe as sources of metal enrichment. We find that a key parameter controlling the enrichment is the mass Mx of the gas to mix with the ejecta from each SN. The choice of Mx depends on the evolution of SN remnants and on the global gas dynamics. It differs between the two types of SNe involved and between the periods before and after Fornax became an MW satellite at time t = tsat. Our results indicate that due to the global gas outflow at t > tsat, part of the ejecta from each SN may directly escape from Fornax. Sample results from our model are presented and compared with data.

  18. The HST/ACS Coma Cluster Survey. X. Nuclear star clusters in low-mass early-type galaxies: scaling relations

    CERN Document Server

    Brok, Mark den; Seth, Anil; Balcells, Marc; Dominguez, Lilian; Graham, Alister W; Carter, David; Erwin, Peter; Ferguson, Henry C; Goudfrooij, Paul; Guzman, Rafael; Hoyos, Carlos; Jogee, Shardha; Lucey, John; Phillipps, Steven; Puzia, Thomas; Valentijn, Edwin; Kleijn, Gijs Verdoes; Weinzirl, Tim

    2014-01-01

    We present scaling relations between structural properties of nuclear star clusters and their host galaxies for a sample of early-type dwarf galaxies observed as part of the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) Coma Cluster Survey. We have analysed the light profiles of 200 early-type dwarf galaxies in the magnitude range $16.0 < m_{F814W} < 22.6 $ mag, corresponding to $-19.0 < M_{F814W} < -12.4 $ mag. Nuclear star clusters are detected in 80% of the galaxies, thus doubling the sample of HST-observed early-type dwarf galaxies with nuclear star clusters. \\changed{We confirm that the} nuclear star cluster detection fraction decreases strongly toward faint magnitudes. The luminosities of nuclear star clusters do not scale linearly with host galaxy luminosity. A linear fit yields L$_{nuc} \\sim $L$_{gal}^{0.57\\pm0.05}$. The nuclear star cluster-host galaxy luminosity scaling relation for low-mass early-type dwarf galaxies is consistent with formation by globular cluster accre...

  19. Ultra-Compact Dwarfs in the Coma Cluster

    CERN Document Server

    Chiboucas, Kristin; Marzke, Ronald O; Phillipps, Steve; Price, James; Peng, Eric; Trentham, Neil; Carter, David; Hammer, Derek

    2011-01-01

    We have undertaken a spectroscopic search for ultra compact dwarf galaxies (UCDs) in the dense core of the dynamically evolved, massive Coma cluster as part of the HST/ACS Coma Cluster Treasury Survey. UCD candidates were initially chosen based on color, magnitude, degree of resolution within the ACS images, and the known properties of Fornax and Virgo UCDs. Follow-up spectroscopy with Keck/LRIS confirmed 27 candidates as members of the Coma Cluster, a success rate > 60% for targeted objects brighter than M_R = -12. Another 14 candidates may also prove to be Coma members, but low signal-to-noise spectra prevent definitive conclusions. An investigation of the properties and distribution of the Coma UCDs finds these objects to be very similar to UCDs discovered in other environments. The Coma UCDs tend to be clustered around giant galaxies in the cluster core and have colors/metallicity that correlate with the host galaxy. With properties and a distribution similar to that of the Coma cluster globular cluster p...

  20. The Luminosity Functions of the Galaxy Cluster MS1054-0321 at z=0.83 based on ACS Photometry

    OpenAIRE

    Goto, Tomotsugu; Postman, Marc; Cross, Nicholas J. G.; Illingworth, G. D.; Tran, K.; Magee, D.; Franx, M.; Benitez, N.; Bouwens, R J; Demarco, R.; Ford, H.C.; Homeier, N. L.; Martel, A. R.; Menanteau, F.; Clampin, M.

    2004-01-01

    We present new measurements of the galaxy luminosity function (LF) and its dependence on local galaxy density, color, morphology, and clustocentric radius for the massive z=0.83 cluster MS1054-0321. Our analyses are based on imaging performed with the ACS onboard the HST in the F606W, F775W and F850LP passbands and extensive spectroscopic data obtained with the Keck LRIS. Our main results are based on a spectroscopically selected sample of 143 cluster members with morphological classification...

  1. The Luminosity Functions of the Galaxy Cluster MS1054-0321 at z=0.83 based on ACS Photometry

    CERN Document Server

    Goto, T; Cross, N J G; Illingworth, G D; Tran, K; Magee, D; Franx, M; Benítez, N; Bouwens, R J; Demarco, R; Ford, H C; Homeier, N L; Martel, A R; Menanteau, F; Clampin, M; Hartig, G F; Ardila, D R; Bartko, F; Blakeslee, J P; Bradley, L D; Broadhurst, T J; Brown, R A; Burrows, C J; Cheng, E S; Feldman, P D; Golimowski, D A; Gronwall, C; Holden, B; Infante, L; Jee, M J; Krist, J E; Lesser, M P; Mei, S; Meurer, G R; Miley, G K; Motta, V; Overzier, R; Rosati, P; Sirianni, M; Sparks, W B; Tran, H D; Tsvetanov, Z I; White, R L; Zheng, W; Zirm, A W; Goto, Tomotsugu; Postman, Marc; Cross, Nicholas J.G.

    2004-01-01

    We present new measurements of the galaxy luminosity function (LF) and its dependence on local galaxy density, color, morphology, and clustocentric radius for the massive $z=0.83$ cluster MS1054-0321. Our analyses are based on imaging performed with the ACS onboard the HST in the F606W, F775W and F850LP passbands and extensive spectroscopic data obtained with the Keck LRIS. Our main results are based on a spectroscopically selected sample of 143 cluster members with morphological classifications derived from the ACS observations. Our three primary findings are (1) the faint-end slope of the LF is steepest in the bluest filter, (2) the LF in the inner part of the cluster (or highest density regions) has a flatter faint-end slope, and (3) the fraction of early-type galaxies is higher at the bright end of the LF, and gradually decreases toward fainter magnitudes. These characteristics are consistent with those in local galaxy clusters, indicating that, at least in massive clusters, the common characteristics of ...

  2. The Large Scale Distribution of Neutral Hydrogen in the Fornax Region

    CERN Document Server

    Waugh, M; Webster, R L; Staveley-Smith, L; Kilborn, V A; Barnes, D G; Bhathal, R; De Blok, W J G; Boyce, P J; Disney, M J; Ekers, R D; Freeman, K C; Gibson, B K; Henning, P A; Jerjen, H; Knezek, P M; Koribalski, B S; Marquarding, M; Minchin, R F; Price, R M; Putman, M E; Ryder, S D; Sadler, E M; Stootman, F; Zwaan, M A; Waugh, Meryl

    2002-01-01

    Using HIPASS data, we have searched for HI in a ~25x25 sq.deg. region centred on the Fornax cluster. Within a velocity search range of 300 - 3700 km/s and a lower flux limit of ~40 mJy, 110 galaxies with HI emission were detected, one of which is previously uncatalogued. None of the detections has early-type morphology. Previously unknown velocities for 14 galaxies have been determined, with a further 4 velocity measurements being significantly dissimilar to published values. Identification of an optical counterpart is relatively unambiguous for more than ~90% of our HI galaxies. The galaxies appear to be embedded in a sheet at the cluster velocity which extends for more than 30 deg across the search area. At the nominal cluster distance of ~20 Mpc, this corresponds to an elongated structure more than 10 Mpc in extent. A velocity gradient across the structure is detected, with radial velocities increasing by \\~500 km/s from SE to NW. The clustering of galaxies evident in optical surveys is only weakly suggest...

  3. The Fornax Deep Survey with VST. I. The extended and diffuse stellar halo of NGC~1399 out to 192 kpc

    CERN Document Server

    Iodice, E; Grado, A; Limatola, L; Spavone, M; Napolitano, N R; Paolillo, M; Peletier, R F; Cantiello, M; Lisker, T; Wittmann, C; Venhola, A; Hilker, M; D'Abrusco, R; Pota, V; Schipani, P

    2016-01-01

    [Abrigded] We have started a new deep, multi-imaging survey of the Fornax cluster, dubbed Fornax Deep Survey (FDS), at the VLT Survey Telescope. In this paper we present the deep photometry inside two square degrees around the bright galaxy NGC1399 in the core of the cluster. We found a very extended and diffuse envelope surrounding the luminous galaxy NGC1399: we map the surface brightness out to 33 arcmin (~ 192 kpc) from the galaxy center and down to about 31 mag/arcsec^2 in the g band. The deep photometry allows us to detect a faint stellar bridge in the intracluster region between NGC1399 and NGC1387. By analyzing the integrated colors of this feature, we argue that it could be due to the ongoing interaction between the two galaxies, where the outer envelope of NGC1387 on its east side is stripped away. By fitting the light profile, we found that it exists a physical break radius in the total light distribution at R=10 arcmin (~58 kpc) that sets the transition region between the bright central galaxy and...

  4. Multi-wavelength observations of a rich galaxy cluster at z ~ 1: the HST/ACS colour-magnitude diagram

    CERN Document Server

    Santos, Joana S; Gobat, Raphael; Lidman, Chris; Dawson, Kyle; Perlmutter, Saul; Boehringer, Hans; Balestra, Italo; Mullis, Chris R; Fassbender, Rene; Kohnert, Jan; Lamer, Georg; Rettura, Alessandro; Rite, Charles; Schwope, Axel

    2009-01-01

    XMMU J1229+0151 is a rich galaxy cluster with redshift z=0.975, that was serendipitously detected in X-rays within the scope of the XMM-Newton Distant Cluster Project. HST/ACS observations in the i775 and z850 passbands, as well as VLT/FORS2 spectroscopy were further obtained, in addition to follow-up Near-Infrared (NIR) imaging in J- and Ks-bands with NTT/SOFI. We investigate the photometric, structural and spectral properties of the early-type galaxies in the high-redshift cluster XMMU J1229+0151. Source detection and aperture photometry are performed in the optical and NIR imaging. Galaxy morphology is inspected visually and by means of Sersic profile fitting to the 21 spectroscopically confirmed cluster members in the ACS field of view. The i775-z850 colour-magnitude relation (CMR) is derived with a method based on galaxy magnitudes obtained by fitting the surface brightness of the galaxies with Sersic models. The i775-z850 CMR of the spectroscopic members shows a very tight red-sequence with a zero point...

  5. Suzaku Detection of Thermal X-Ray Emission Associated with the Western Radio Lobe of Fornax A

    CERN Document Server

    Seta, Hiromi; Inoue, Susumu

    2013-01-01

    We present the results of X-ray mapping observations of the western radio lobe of the Fornax A galaxy, using the X-ray Imaging Spectrometer (XIS) onboard the Suzaku satellite with a total exposure time of 327 ks. The purpose of this study is to investigate the nature and spatial extent of the diffuse thermal emission around the lobe by exploiting the low and stable background of the XIS. The diffuse thermal emission had been consistently reported in all previous studies of this region, but its physical nature and relation to the radio lobe had not been examined in detail. Using the data set covering the entire western lobe and the central galaxy NGC 1316, as well as comparison sets in the vicinity, we find convincingly the presence of thermal plasma emission with a temperature of ~1 keV in excess of conceivable background and contaminating emission (cosmic X-ray background, Galactic halo, intra-cluster gas of Fornax, interstellar gas of NGC 1316, and the ensemble of point-like sources). Its surface brightness...

  6. VLT/FLAMES spectroscopy of red giant branch stars in the Fornax dwarf spheroidal galaxy

    CERN Document Server

    Lemasle, B; Hill, V; Tolstoy, E; Irwin, M; Jablonka, P; Venn, K; Battaglia, G; Starkenburg, E; Shetrone, M; Letarte, B; Francois, P; Helmi, A; Primas, F; Kaufer, A; Szeifert, T

    2014-01-01

    Fornax is one of the most massive dwarf spheroidal galaxies in the Local Group. The Fornax field star population is dominated by intermediate age stars but star formation was going on over almost its entire history. It has been proposed that Fornax experienced a minor merger event. Despite recent progress, only the high metallicity end of Fornax field stars ([Fe/H]>-1.2 dex) has been sampled in larger number via high resolution spectroscopy. We want to better understand the full chemical evolution of this galaxy by better sampling the whole metallicity range, including more metal poor stars. We use the VLT-FLAMES multi-fibre spectrograph in high-resolution mode to determine the abundances of several alpha, iron-peak and neutron-capture elements in a sample of 47 individual Red Giant Branch stars in the Fornax dwarf spheroidal galaxy. We combine these abundances with accurate age estimates derived from the age probability distribution from the colour-magnitude diagram of Fornax. Similar to other dwarf spheroid...

  7. The ACS Virgo Cluster Survey XV. The Formation Efficiencies of Globular Clusters in Early-Type Galaxies: The Effects of Mass and Environment

    CERN Document Server

    Peng, Eric W; Cote, Patrick; Takamiya, Marianne; West, Michael J; Blakeslee, John P; Chen, Chin-Wei; Ferrarese, Laura; Mei, Simona; Tonry, John L; West, Andrew A

    2008-01-01

    The fraction of stellar mass contained in globular clusters (GCs), also measured by number as the specific frequency, is a fundamental quantity that reflects both a galaxy's early star formation and its entire merging history. We present specific frequencies, luminosities, and mass fractions for the globular cluster systems of 100 early-type galaxies in the ACS Virgo Cluster Survey, the largest homogeneous catalog of its kind. We find that 1) GC mass fractions can be high in both giants and dwarfs, but are universally low in galaxies with intermediate luminosities. 2) The behavior of specific frequency across galaxy mass is dominated by the blue GCs. 3) The GC fractions of low-mass galaxies exhibit a dependence on environment. Nearly all dwarf galaxies with high GC fractions are within 1 Mpc of the cD galaxy M87, presenting the first strong evidence that GC formation in dwarfs is biased toward dense environments. 4) GC formation in central dwarfs is biased because their stars form earliest and most intensely....

  8. Dark matter inner slope and concentration in galaxies: from the Fornax dwarf to M87

    CERN Document Server

    Mamon, G A; Romanowsky, A J; Wojtak, R

    2014-01-01

    We apply two new state-of-the-art methods that model the distribution of observed tracers in projected phase space to lift the mass / velocity anisotropy (VA) degeneracy and deduce constraints on the mass profiles of galaxies, as well as their VA. We first show how a distribution function based method applied to the satellite kinematics of otherwise isolated SDSS galaxies shows convincing observational evidence of age matching: red galaxies have more concentrated dark matter (DM) halos than blue galaxies of the same stellar or halo mass. Then, applying the MAMPOSSt technique to M87 (traced by its red and blue globular clusters) we find that very cuspy DM is favored, unless we release priors on DM concentration or stellar mass (leading to unconstrained slope). For the Fornax dwarf spheroidal (traced by its metal-rich and metal-poor stars), the inner DM slope is unconstrained, with weak evidence for a core if the stellar mass is fixed. This highlights how priors are crucial for DM modeling. Finally, we find tha...

  9. Discovery of White Dwarfs in the Globular Clusters M13 and M22 Using HST ACS Photometric Data

    Science.gov (United States)

    Cho, Dong-Hwan; Yoon, Tae Seog; Lee, Sang-Gak; Sung, Hyun-Il

    2015-12-01

    A search for hot and bright white dwarfs (WDs) in the Milky Way globular clusters M13 (NGC 6205) and M22 (NGC 6656) is carried out using the deep and homogeneous VI photometric catalog of Anderson et al. and and Sarajedini et al., based on data taken with the ACS/WFC aboard the Hubble Space Telescope (HST). V versus V-I color-magnitude diagrams (CMDs) of M13 and M22 are constructed and numerous spurious detections are rejected according to their photometric quality parameters qfit(V) and qfit(I). In the case of M13, further radial restriction is applied to reject central stars with higher photometric errors due to central crowding. From each resultant V versus V-I CMD, sixteen and thirteen WD candidates are identified in M13 and M22, respectively. They are identified as stellar objects in the accompanying ACS/WFC images and are found to be randomly distributed across the central regions of M13 and M22. Their positions in the CMDs are in the bright part of the DA WD cooling sequences indicating that they are true WDs. In order to confirm their nature, follow-up spectroscopic observations are needed.

  10. Mass assembly history and infall time of the Fornax Dwarf Spheroidal Galaxy

    CERN Document Server

    Wang, Mei-Yu; Lovell, Mark R; Frenk, Carlos S; Zentner, Andrew R

    2015-01-01

    We use cosmological simulations to identify dark matter subhalo host candidates of the Fornax dwarf spheroidal galaxy using the stellar kinematic properties of Fornax. We consider cold dark matter (CDM), warm dark matter (WDM), and decaying dark matter (DDM) simulations for our models of structure formation. The subhalo candidates in CDM typically have smaller mass and higher concentrations at z = 0 than the corresponding candidates in WDM and DDM. We examine the formation histories of the ~ 100 Fornax candidate subhalos identified in CDM simulations and, using approximate luminosity-mass relationships for subhalos, we find two of these subhalos that are consistent with both the Fornax luminosity and kinematics. These two subhalos have a peak mass over ten times larger than their z = 0 mass. We suggest that in CDM the dark matter halo hosting Fornax must have been severely stripped of mass and that it had an infall time into the Milky Way of ~ 9 Gyr ago. In WDM, we find that candidate subhalos consistent with...

  11. Galaxy Clusters with Chandra

    CERN Document Server

    Forman, W; Markevitch, M L; Vikhlinin, A A; Churazov, E

    2002-01-01

    We discuss Chandra results related to 1) cluster mergers and cold fronts and 2) interactions between relativistic plasma and hot cluster atmospheres. We describe the properties of cold fronts using NGC1404 in the Fornax cluster and A3667 as examples. We discuss multiple surface brightness discontinuities in the cooling flow cluster ZW3146. We review the supersonic merger underway in CL0657. Finally, we summarize the interaction between plasma bubbles produced by AGN and hot gas using M87 and NGC507 as examples.

  12. Dynamical Evolution of Globular Cluster Systems formed in Galaxy Mergers: Deep HST/ACS Imaging of Old and Intermediate-Age Globular Clusters in NGC 3610

    CERN Document Server

    Goudfrooij, P; Gilmore, D; Whitmore, B C; Goudfrooij, Paul; Schweizer, Francois; Gilmore, Diane; Whitmore, Bradley C.

    2007-01-01

    (ABRIDGED) The ACS camera on board the Hubble Space Telescope has been used to obtain deep images of the giant elliptical galaxy NGC 3610, a well-established dissipative galaxy merger remnant. These observations supersede previous WFPC2 images which revealed the presence of a population of metal-rich globular clusters (GCs) of intermediate age (~1.5-4 Gyr). We detect a total of 580 GC candidates, 46% more than from the previous WFPC2 images. The new photometry strengthens the significance of the previously found bimodality of the color distribution of GCs. Peak colors in V-I are 0.93 +/-0.01 and 1.09 +/- 0.01 for the blue and red subpopulations, respectively. The luminosity function (LF) of the inner 50% of the metal-rich (`red') population of GCs differs markedly from that of the outer 50%. In particular, the LF of the inner 50% of the red GCs shows a flattening consistent with a turnover that is about 1.0 mag fainter than the turnover of the blue GC LF. This is consistent with predictions of recent models o...

  13. An Empirical Model for Halo Evolution and Global Gas Dynamics of the Fornax Dwarf Spheroidal Galaxy

    CERN Document Server

    Yuan, Zhen; Jing, Y P

    2015-01-01

    We present an empirical model for the halo evolution and global gas dynamics of Fornax, the brightest Milky Way (MW) dwarf spheroidal galaxy (dSph). Assuming a global star formation rate psi(t)=lambda_*[M_g(t)/M_sun]^alpha consistent with observations of star formation in nearby galaxies and using the data on Fornax's psi(t), we derive the evolution of the total mass M_g(t) for cold gas in Fornax's star-forming disk and the rate Delta F(t) of net gas flow to or from the disk. We identify the onset of the transition in Delta F(t) from a net inflow to a net outflow as the time t_sat at which the Fornax halo became an MW satellite and estimate the evolution of its total mass M_h(t) at t

  14. Model comparison of the dark matter profiles of Fornax, Sculptor, Carina and Sextans

    NARCIS (Netherlands)

    Breddels, Maarten A.; Helmi, Amina

    2013-01-01

    Aims: We compare dark matter profile models of four dwarf spheroidal galaxies satellites of the Milky Way using Bayesian evidence. Methods: We use orbit based dynamical models to fit the 2nd and 4th moments of the line of sight velocity distributions of the Fornax, Sculptor, Carina and Sextans dwarf

  15. Merger traces in the spatial distribution of stellar populations in the Fornax dSph galaxy

    CERN Document Server

    del Pino, Andrés; Hidalgo, Sebastial L

    2015-01-01

    We present a comprehensive and detailed study of the stellar populations of the Fornax dwarf spheroidal galaxy. We analyse their spatial distributions along the main body of the galaxy, obtaining their surface density maps, together with their radial density profiles. Results are based on the largest and most complete catalogue of stars in Fornax, with more than $3.5\\times10^{5}$ stars covering the main body of the galaxy up to $\\rm V \\sim 24$. We find a differentiated structure in Fornax depending on the stellar ages. Old stars ($\\gtrsim 10$ Gyr) follow an elliptical distribution well fitted by King profiles with relatively large core radius ($r_c = 760\\pm60$ pc). On another hand, young populations ($\\lesssim 3$ Gyr) concentrate in the central region of the galaxy ($r_c = 210\\pm10$ pc), and are better fitted by Sersic profiles with $0.8 < n < 1.2$, indicating some disky shape. These stars show strong asymmetries and substructures not aligned with the main optical axes of Fornax. This together with the ...

  16. Extremely metal-poor stars in classical dwarf spheroidal galaxies : Fornax, Sculptor, and Sextans

    NARCIS (Netherlands)

    Tafelmeyer, M.; Jablonka, P.; Hill, V.; Shetrone, M.; Tolstoy, E.; Irwin, M. J.; Battaglia, G.; Helmi, A.; Starkenburg, E.; Venn, K. A.; Abel, T.; Francois, P.; Kaufer, A.; North, P.; Primas, F.; Szeifert, T.

    2010-01-01

    We present the results of a dedicated search for extremely metal-poor stars in the Fornax, Sculptor, and Sextans dSphs. Five stars were selected from two earlier VLT/Giraffe and HET/HRS surveys and subsequently followed up at high spectroscopic resolution with VLT/UVES. All of them turned out to hav

  17. Globular clusters in the outer Galactic halo: new HST/ACS imaging of 6 globular clusters and the Galactic globular cluster age-metallicity relation

    CERN Document Server

    Dotter, Aaron; Anderson, Jay

    2011-01-01

    Color-magnitude diagrams (CMDs) derived from Hubble Space Telescope (HST) Advanced Camera for Surveys F606W,F814W photometry of 6 globular clusters (GCs) are presented. The six GCs form two loose groupings in Galactocentric distance (Rgc): IC 4499, NGC 6426, and Ruprecht 106 at ~15-20 kpc and NGC 7006, Palomar 15, and Pyxis at ~40 kpc. The CMDs allow the ages to be estimated from the main sequence turnoff in every case. In addition, the age of Palomar 5 (Rgc ~ 18 kpc) is estimated using archival HST Wide Field Planetary Camera 2 V,I photometry. The age analysis reveals the following: IC 4499, Ruprecht 106, and Pyxis are 1-2 Gyr younger than inner halo GCs with similar metallicities; NGC 7006 and Palomar 5 are marginally younger than their inner halo counterparts; NGC 6426 and Palomar 15, the two most metal-poor GCs in the sample, are coeval with all the other metal-poor GCs within the uncertainties. Combined with our previous efforts, the current sample provides strong evidence that the Galactic GC age-metall...

  18. Wide-Field Hubble Space Telescope Observations of the Globular Cluster System in NGC1399

    CERN Document Server

    Puzia, Thomas H; Goudfrooij, Paul; Maccarone, Thomas J; Fabbiano, Giuseppina; Angelini, Lorella

    2014-01-01

    We present a comprehensive high spatial-resolution imaging study of globular clusters (GCs) in NGC1399, the central giant elliptical cD galaxy in the Fornax galaxy cluster, conducted with HST/ACS. Using a novel technique to construct drizzled PSF libraries for HST/ACS data, we accurately determine the fidelity of GC structural parameter measurements from detailed artificial star cluster experiments. The measurement of rh for the major fraction of the NGC1399 GC system reveals a trend of increasing rh versus galactocentric distance, Rgal, out to about 10 kpc and a flat relation beyond. This trend is very similar for blue and red GCs which are found to have a mean size ratio of rh(red)/rh(blue)=0.82+/-0.11 at all galactocentric radii from the core regions of the galaxy out to ~40 kpc. This suggests that the size difference between blue and red GCs is due to internal mechanisms related to the evolution of their constituent stellar populations. Modeling the mass density profile of NGC1399 shows that additional ex...

  19. VizieR Online Data Catalog: HST/ACS color-magnitude diagrams of candidate intermediate-age M 31 globular clusters. The role of blue horizontal branches.

    Science.gov (United States)

    Perina, S.; Galleti, S.; Fusi Pecci, F.; Bellazzini, M.; Federici, L.; Buzzoni, A.

    2011-10-01

    Tables b058.dat, b292_531.dat, b350.dat, b336.dat, b337.dat present the photometry of the individual stars of six M31 globular clusters. The observations were carried out with the ACS on board of the HST, employing the WFC+F435W/F606W filters. The data reduction has been performed using the ACS module of DOLPHOT, a point spread function-fitting package specifically devoted to the photometry of HST data, that provides as output the magnitudes and the pixel positions of the detected sources, and a number of quality parameters for a suitable sample selection. The tables present, for the chip holding the cluster, all the stars with valid measurements in both passbands, global quality flag=1, crowding parameter <0.5, chi-square parameter <2.5 and sharpness parameter between -0.3 and 0.3. The x,y coordinates, the magnitudes in the Vegamag system, the errors on the magnitudes and the ACS_WFC chip number are listed for each of the selected stars. (6 data files).

  20. The DART Imaging And CaT Survey of the Fornax Dwarf Spheroidal Galaxy

    Energy Technology Data Exchange (ETDEWEB)

    Battaglia, Giuseppina; Tolstoy, E.; Helmi, A.; /Kapteyn Astron. Inst., Groningen; Irwin, M.J.; /Cambridge U., Inst. of Astron.; Letarte, B.; /Kapteyn Astron. Inst.,; Jablonka, P.; /LASTRO Observ.; Hill, V.; /Meudon Observ.; Venn, K.A.; /Victoria U.; Shetrone, M.D.; /Texas U., McDonald Observ.; Arimoto, N.; /Tokyo, Astron. Observ.; Primas,; /European Southern Observ.; Kaufer, A.; /European Southern Obs., Chile; Francois, P.; /Meudon Observ.; Szeifert, T.; /European Southern Obs., Chile; Abel, T.; /KIPAC, Menlo Park; Sadakane, K.; /Osaka Kyoiku U.

    2006-08-28

    As part of the DART project we have used the ESO/2.2m Wide Field Imager in conjunction with the VLT/FLAMES* GIRAFFE spectrograph to study the detailed properties of the resolved stellar population of the Fornax dwarf spheroidal galaxy out to and beyond its tidal radius. Fornax dSph has had a complicated evolution and contains significant numbers of young, intermediate age and old stars. We investigate the relation between these different components by studying their photometric, kinematic and abundance distributions. We re-derived the structural parameters of the Fornax dwarf spheroidal using our wide field imaging covering the galaxy out to its tidal radius, and analyzed the spatial distribution of the Fornax stars of different ages as selected from Colour-Magnitude Diagram analysis. We have obtained accurate velocities and metallicities from spectra in the Ca II triplet wavelength region for 562 Red Giant Branch stars which have velocities consistent with membership in Fornax dwarf spheroidal. We have found evidence for the presence of at least three distinct stellar components: a young population (few 100 Myr old) concentrated in the center of the galaxy, visible as a Main Sequence in the Colour-Magnitude Diagram; an intermediate age population (2-8 Gyr old); and an ancient population (> 10Gyr), which are distinguishable from each other kinematically, from the metallicity distribution and in the spatial distribution of stars found in the Colour-Magnitude Diagram. From our spectroscopic analysis we find that the ''metal rich'' stars ([Fe/H] > -1.3) show a less extended and more concentrated spatial distribution, and display a colder kinematics than the ''metal poor'' stars ([Fe/H] < -1.3). There is tentative evidence that the ancient stellar population in the center of Fornax does not exhibit equilibrium kinematics. This could be a sign of a relatively recent accretion of external material, such as the merger of another

  1. A cluster-glass magnetic state in R5Pd2 (R = Ho, Tb) compounds evidenced by AC-susceptibility and neutron scattering measurements.

    Science.gov (United States)

    Gubkin, A F; Sherstobitova, E A; Terentyev, P B; Hoser, A; Baranov, N V

    2013-06-12

    AC- and DC-susceptibility, high-field magnetization and neutron diffraction measurements have been performed in order to study the magnetic state of R5Pd2 (R = Ho, Tb) compounds. The results show that both compounds undergo cluster-glass freezing upon cooling below Tf. According to the neutron diffraction a long-range magnetic order is absent down to 2 K and magnetic clusters with short-range incommensurate antiferromagnetic correlations exist not only below Tf but also in a wide temperature range above the freezing temperature (at least up to 2Tf). A complex cluster-glass magnetic state existing in Ho5Pd2 and Tb5Pd2 down to low temperatures results in rather complicated magnetization behavior in DC and AC magnetic fields. Such an unusual magnetic state in compounds with a high rare-earth concentration may be associated with the layered type of their crystal structure and with substantial atomic disorder, which results in frustrations in the magnetic subsystem.

  2. Distribución en gran escala de los cúmulos globulares en Fornax

    Science.gov (United States)

    Ostrov, P. G.

    Para analizar los cúmulos globulares azules y rojos de NGC 1399 asociados con NGC 1399 en particular, o si los cúmulos azules representaban un sistema asociado con el cúmulo de Fornax en general, se obtuvieron imágenes CCD de gran formato con el telescopio de 4m del CTIO, en las bandas C y T1. Se describe el método empleado y lo encontrado.

  3. Two Populations of Old Star Clusters in the Spiral Galaxy M101 Based on HST/ACS Observations

    Science.gov (United States)

    Simanton, Lesley A.; Chandar, Rupali; Whitmore, Bradley C.

    2015-06-01

    We present a new photometric catalog of 326 candidate globular clusters (GCs) in the nearby spiral galaxy M101, selected from B, V, and I Hubble Space Telescope Advanced Camera for Surveys images. The luminosity function (LF) of these clusters has an unusually large number of faint sources compared with GCLFs in many other spiral galaxies. Accordingly, we separate and compare the properties of “bright” ({{M}V}\\lt -6.5) versus “faint” ({{M}V}\\gt -6.5; one magnitude fainter than the expected GC peak) clusters within our sample. The LF of the bright clusters is well fit by a peaked distribution similar to those observed in the Milky Way (MW) and other galaxies. These bright clusters also have similar size (reff) and spatial distributions as MW GCs. The LF of the faint clusters, on the other hand, is well described by a power law, dN({{L}V})/d{{L}V}\\propto LVα with α =-2.6+/- 0.3, similar to those observed for young and intermediate-age cluster systems in star forming galaxies. We find that the faint clusters have larger typical reff than the bright clusters, and have a flatter surface density profile, being more evenly distributed, as we would expect for clusters associated with the disk. We use the shape of the LF and predictions for mass-loss driven by two-body relaxation to constrain the ages of the faint clusters. Our results are consistent with two populations of old star clusters in M101: a bright population of halo clusters and a fainter, possibly younger, population of old disk clusters.

  4. Near-infrared spectroscopy of AGB star candidates in Fornax, Sculptor and NGC 6822

    CERN Document Server

    Groenewegen, M A T; Marescaux, M

    2009-01-01

    Context: The Asymptotic Giant Branch (AGB) phase is characterised by substantial mass loss that is accompanied by the formation of dust. In extreme cases this will make the star no longer visible in the optical. For a better understanding of AGB evolution it is important to identify and characterise these very red AGB stars. Aims: The first aim of this article is to improve the census of red AGB stars in three Local Group galaxies, based on near-IR spectroscopic observations of new candidates with red 2MASS (J-K) colours. The opportunity is taken to compare the near-IR spectra with those of Milky Way stars. Methods: We used ISAAC on the ESO VLT to take J and H-band spectra of 36 targets in Fornax, Sculptor and NGC 6822. Results: Twelve new C-stars are found in Fornax, and one is confirmed in Sculptor. All C-stars have (J-K) > 1.6, and are brighter than -3.55 in bolometric magnitude. Ten new oxygen-rich late-type giant stars are identified in Fornax, but none is extremely red or very luminous. Five luminous O-...

  5. Investigation of the Puzzling Abundance Pattern in the Stars of the Fornax Dwarf Spheroidal Galaxy

    CERN Document Server

    Li, Hongjie; Zhang, Bo

    2013-01-01

    Many works have found unusual characteristics of elemental abundances in nearby dwarf galaxies. This implies that there is a key factor of galactic evolution that is different from that of the Milky Way (MW). The chemical abundances of the stars in the Fornax dwarf spheroidal galaxy (Fornax dSph) provide excellent information for setting constraints on the models of the galactic chemical evolution. In this work, adopting the five-component approach, we fit the abundances of the Fornax dSph stars, including $\\alpha$ elements, iron group elements and neutron-capture elements. For most sample stars, the relative contributions from the various processes to the elemental abundances are not usually in the MW proportions. We find that the contributions from massive stars to the primary $\\alpha$ elements and iron group elements increase monotonously with increasing [Fe/H]. This means that the effect of the galactic wind is not strong enough to halt star formation and the contributions from massive stars to $\\alpha$ e...

  6. The HST/ACS Coma Cluster Survey : III. Structural parameters of galaxies using single Sersic fits star

    NARCIS (Netherlands)

    Hoyos, Carlos; den Brok, Mark; Verdoes Kleijn, Gijs; Carter, David; Balcells, Marc; Guzmán, Rafael; Peletier, Reynier; Ferguson, Henry C.; Goudfrooij, Paul; Graham, Alister W.; Hammer, Derek; Karick, Arna M.; Lucey, John R.; Matković, Ana; Merritt, David; Mouhcine, Mustapha; Valentijn, Edwin

    2011-01-01

    We present a catalogue of structural parameters for 8814 galaxies in the 25 fields of the Hubble Space Telescope/ACS Coma Treasury Survey. Parameters from Sersic fits to the two-dimensional surface brightness distributions are given for all galaxies from our published Coma photometric catalogue with

  7. The HST/ACS Coma Cluster Survey - III. Structural parameters of galaxies using single Sérsic fits

    NARCIS (Netherlands)

    Hoyos, Carlos; den Brok, Mark; Verdoes Kleijn, Gijs; Carter, David; Balcells, Marc; Guzmán, Rafael; Peletier, Reynier; Ferguson, Henry C.; Goudfrooij, Paul; Graham, Alister W.; Hammer, Derek; Karick, Arna M.; Lucey, John R.; Matković, Ana; Merritt, David; Mouhcine, Mustapha; Valentijn, Edwin

    2011-01-01

    We present a catalogue of structural parameters for 8814 galaxies in the 25 fields of the Hubble Space Telescope/ACS Coma Treasury Survey. Parameters from Sérsic fits to the two-dimensional surface brightness distributions are given for all galaxies from our published Coma photometric catalogue with

  8. The Color-Magnitude Relation for Metal-Poor Globular Clusters in M87: Confirmation From Deep HST/ACS Imaging

    CERN Document Server

    Peng, Eric W; Blakeslee, John P; Mieske, Steffen; Cote, Patrick; Ferrarese, Laura; Harris, William E; Madrid, Juan P; Meurer, Gerhardt R

    2009-01-01

    Metal-poor globular clusters (GCs) are our local link to the earliest epochs of star formation and galaxy building. Studies of extragalactic GC systems using deep, high-quality imaging have revealed a small but significant slope to the color-magnitude relation for metal-poor GCs in a number of galaxies. We present a study of the M87 GC system using deep, archival HST/ACS imaging with the F606W and F814W filters, in which we find a significant color-magnitude relation for the metal-poor GCs. The slope of this relation in the I vs. V-I color-magnitude diagram ($\\gamma_I=-0.024\\pm0.006$) is perfectly consistent with expectations based on previously published results using data from the ACS Virgo Cluster Survey. The relation is driven by the most luminous GCs, those with $M_I<-10$, and its significance is largest when fitting metal-poor GCs brighter than $M_I=-7.8$, a luminosity which is ~1 mag fainter than our fitted Gaussian mean for the luminosity function (LF) of blue, metal-poor GCs (~0.8 mag fainter than...

  9. VLT and ACS observations of RDCS J1252.9-2927: dynamical structure and galaxy populations in a massive cluster at z=1.237

    CERN Document Server

    Demarco, R; Lidman, C; Girardi, M; Nonino, M; Rettura, A; Strazzullo, V; Van der Wel, A; Ford, H C; Mainieri, V; Holden, B P; Stanford, S A; Blakeslee, J P; Gobat, R; Postman, M; Tozzi, P; Overzier, R A; Zirm, A W; Benítez, N; Homeier, N L; Illingworth, G D; Infante, L; Jee, M J; Mei, S; Menanteau, F; Motta, V; Zheng, W; Clampin, M; Hartig, G

    2007-01-01

    (Abridged) We present results from an extensive spectroscopic survey, carried out with FORS on the ESO VLT, and from an extensive multi-wavelength imaging data set from the ACS and ground based facilities of the cluster of galaxies RDCS J1252.9-2927. We have spectroscopically confirmed 38 cluster members in the redshift range 1.22 1, kinematic structure. The velocity distribution, which is not Gaussian at the 95% confidence level, is consistent with two groups that are also responsible for the projected elongation of the cluster in the East-West direction. The groups are composed of 26 and 12 galaxies with velocity dispersions of 486^{+47}_{-85} km s^-1 and 426^{+57}_{-105} km s^-1, respectively. The elongation is also seen in the intracluster gas and the dark matter distribution. This leads us to conclude that RDCS J1252.9-2927 has not yet reached a final virial state. We extend the analysis of the color-magnitude diagram of spectroscopic members to more than 1 Mpc from the cluster center. The scatter and s...

  10. Two Populations of Old Star Clusters in the Spiral Galaxy M101 Based on HST/ACS Observations

    CERN Document Server

    Simanton, Lesley A; Whitmore, Bradley C

    2015-01-01

    We present a new photometric catalog of 326 candidate globular clusters (GCs) in the nearby spiral galaxy M101, selected from B, V, and I Hubble Space Telescope Advanced Camera for Surveys images. The luminosity function (LF) of these clusters has an unusually large number of faint sources compared with GCLFs in many other spiral galaxies. Accordingly, we separate and compare the properties of "bright" (M_V -6.5; one magnitude fainter than the expected GC peak) clusters within our sample. The LF of the bright clusters is well fit by a peaked distribution similar to those observed in the Milky Way (MW) and other galaxies. These bright clusters also have similar size (r_{eff}) and spatial distributions as MW GCs. The LF of the faint clusters, on the other hand, is well described by a power law, dN(L_V)/dL_V proportional to L_V^alpha with alpha = -2.6 plus or minus 0.3, similar to those observed for young and intermediate-age cluster systems in star forming galaxies. We find that the faint clusters have larger ...

  11. The ACS Nearby Galaxy Survey Treasury. X. Quantifying the Star Cluster Formation Efficiency of Nearby Dwarf Galaxies

    CERN Document Server

    Cook, David O; Dale, Daniel A; Johnson, L Clifton; Weisz, Daniel R; Fouesneau, Morgan; Olsen, Knut A G; Engelbracht, Charles W; Dalcanton, Julianne J

    2012-01-01

    We study the relationship between the field star formation and cluster formation properties in a large sample of nearby dwarf galaxies. We use optical data from the Hubble Space Telescope and from ground-based telescopes to derive the ages and masses of the young (t_age < 100Myr) cluster sample. Our data provides the first constraints on two proposed relationships between the star formation rate of galaxies and the properties of their cluster systems in the low star formation rate regime. The data show broad agreement with these relationships, but significant galaxy-to-galaxy scatter exists. In part, this scatter can be accounted for by simulating the small number of clusters detected from stochastically sampling the cluster mass function. However, this stochasticity does not fully account for the observed scatter in our data suggesting there may be true variations in the fraction of stars formed in clusters in dwarf galaxies. Comparison of the cluster formation and the brightest cluster in our sample gala...

  12. No identifiable Hb1Ac or lifestyle change after a comprehensive diabetes programme including motivational interviewing: A cluster randomised trial

    NARCIS (Netherlands)

    Jansink, R.M.E.; Braspenning, J.C.C.; Keizer, E.; Weijden, T. van der; Elwyn, G.; Grol, R.P.T.M.

    2013-01-01

    Abstract Objective. To study the effectiveness of a comprehensive diabetes programme in general practice that integrates patient-centred lifestyle counselling into structured diabetes care. Design and setting. Cluster randomised trial in general practices. Intervention. Nurse-led structured diabetes

  13. The Mass Structure of the Galaxy Cluster Cl0024+1654 from a Full Lensing Analysis of Joint Subaru and ACS/NIC3 Observations

    CERN Document Server

    Umetsu, Keiichi; Broadhurst, Tom; Zitrin, Adi; Okabe, Nobuhiro; Hsieh, Bau-Ching; Molnar, Sandor M

    2009-01-01

    We derive an accurate mass distribution of the rich galaxy cluster Cl0024+1654 (z=0.395) based on deep Subaru BR_{c}z' imaging and our recent comprehensive strong lensing analysis of HST/ACS/NIC3 observations. We define an undiluted background population of red and blue galaxies by carefully combining all color and positional information. Unlike previous work, the weak and strong lensing are in excellent agreement where the data overlap. The joint mass profile continuously steepens out to the virial radius, 2300kpc/h, with only a minor contribution, \\sim 10% in the mass, from known subcluster at a projected distance of \\sim 700kpc/h. The projected mass distribution for the entire cluster is well fitted with a single Navarro-Frenk-White model with a virial mass, M_{vir} = (1.2 \\pm 0.2) \\times 10^{15} M_{sun}/h, and a concentration, c_{vir} = 9 \\pm 1. Careful examination and interpretation of X-ray and dynamical data, based on recent high-resolution cluster collision simulations, strongly suggest that this clus...

  14. The HST/ACS Coma Cluster Survey - VII. Structure and Assembly of Massive Galaxies in the Center of the Coma Cluster

    CERN Document Server

    Weinzirl, Tim; Neistein, Eyal; Khochfar, Sadegh; Kormendy, John; Marinova, Irina; Hoyos, Carlos; Balcells, Marc; Brok, Mark den; Hammer, Derek; Peletier, Reynier F; Kleijn, Gijs Verdoes; Carter, David; Goudfrooij, Paul; Mobasher, Bahram; Trentham, Neil; Erwin, Peter; Puzia, Thomas

    2013-01-01

    We constrain the assembly history of galaxies in the central 0.6 Mpc of the rich Coma cluster at z~0.02 based on the structure of 69 massive (M*>1e9 M_sun) galaxies using images from the HST Treasury Survey of Coma. Our findings are: (1) We make no a priori assumptions on the shape of the profile for outer and central structures, which can include disk-dominated components, bars, and classical bulges/ellipticals. After excluding the 2 cDs, we find that most (56%) of the galactic stellar mass resides in classical bulges/Es while (44%) resides in cold disk-dominated structures. This suggests that most of the stellar mass in Coma galaxies may have been assembled and shaped through the redistribution of stars during major mergers, and possibly minor mergers, but that gas-rich dissipative processes that build disk-dominated structures remain important even in the center of a rich cluster like Coma. (2) We see strong evidence of a morphology-density relation. In the central 0.6 Mpc of the Coma cluster, there are 2 ...

  15. Extremely metal-poor stars in classical dwarf spheroidal galaxies: Fornax, Sculptor and Sextans

    CERN Document Server

    Tafelmeyer, M; Hill, V; Shetrone, M; Tolstoy, E; Irwin, M J; Battaglia, G; Helmi, A; Starkenburg, E; Venn, K A; Abel, T; Francois, P; Kaufer, A; North, P; Primas, F; Szeifert, T

    2010-01-01

    We present the results of a dedicated search for extremely metal-poor stars in the Fornax, Sculptor and Sextans dSphs. Five stars were selected from two earlier VLT/Giraffe and HET/HRS surveys and subsequently followed up at high spectroscopic resolution with VLT/UVES. All of them turned out to have [Fe/H] <= -3 and three stars are below [Fe/H]~-3.5. This constitutes the first evidence that the classical dSphs Fornax and Sextans join Sculptor in containing extremely metal-poor stars and suggests that all of the classical dSphs contain extremely metal-poor stars. One giant in Sculptor at [Fe/H]=-3.96 +- 0.10 is the most metal-poor star ever observed in an external galaxy. We carried out a detailed analysis of the chemical abundances of the alpha, iron peak, and the heavy elements, and we performed a comparison with the Milky Way halo and the ultra faint dwarf stellar populations. Carbon, barium and strontium show distinct features characterized by the early stages of galaxy formation and can constrain the o...

  16. Variable stars in the Fornax dSph Galaxy. II. Pulsating stars below the horizontal branch

    CERN Document Server

    Poretti, Ennio; Held, Enrico V; Greco, Claudia; Mateo, Mario; Dell'Arciprete, Luca; Rizzi, Luca; Gullieuszik, Marco; Maio, Marcella

    2008-01-01

    We have carried out an intensive survey of the northern region of the Fornax dwarf spheroidal galaxy with the aim of detecting the galaxy's short--period pulsating stars (P<0.25 days). Observations collected over three consecutive nights with the Wide Field Imager of the 2.2m MPI telescope at ESO allowed us to detect 85 high-amplitude (0.20-1.00 mag in B-light) variable stars with periods in the range from 0.046 to 0.126 days, similar to SX Phoenicis stars in Galactic metal-poor stellar populations. The plots of the observed periods vs. the B and V magnitudes show a dispersion largely exceeding the observational errors. To disentangle the matter, we separated the first-overtone from the fundamental-mode pulsators and tentatively identified a group of subluminous variables, about 0.35 mag fainter than the others. Their nature as either metal-poor intermediate-age stars or stars formed by the merging of close binary systems is discussed. The rich sample of the Fornax variables also led us to reconstruct the ...

  17. Feedback and Brightest Cluster Galaxy Formation: ACS Observations of the Radio Galaxy TN J1338-1942 at z = 4.1

    Science.gov (United States)

    Zirm, Andrew W.; Overzier, R. A.; Miley, G. K.; Blakeslee, J. P.; Clampin, M.; De Breuck, C.; Demarco, R.; Ford, H. C.; Hartig, G. F.; Homeier, N.; Illingworth, G. D.; Martel, A. R.; Röttgering, H. J. A.; Venemans, B.; Ardila, D. R.; Bartko, F.; Benítez, N.; Bouwens, R. J.; Bradley, L. D.; Broadhurst, T. J.; Brown, R. A.; Burrows, C. J.; Cheng, E. S.; Cross, N. J. G.; Feldman, P. D.; Franx, M.; Golimowski, D. A.; Goto, T.; Gronwall, C.; Holden, B.; Infante, L.; Kimble, R. A.; Krist, J. E.; Lesser, M. P.; Mei, S.; Menanteau, F.; Meurer, G. R.; Motta, V.; Postman, M.; Rosati, P.; Sirianni, M.; Sparks, W. B.; Tran, H. D.; Tsvetanov, Z. I.; White, R. L.; Zheng, W.

    2005-09-01

    We present deep optical imaging of the z=4.1 radio galaxy TN J1338-1942, obtained using the Advanced Camera for Surveys (ACS) on board the Hubble Space Telescope, as well as ground-based near-infrared imaging data from the European Southern Observatory (ESO) Very Large Telescope (VLT). The radio galaxy is known to reside within a large galaxy overdensity (both in physical extent and density contrast). There is good evidence that this ``protocluster'' region is the progenitor of a present-day rich galaxy cluster. TN J1338 is the dominant galaxy in the protocluster in terms of size and luminosity (in both the optical and near-infrared) and therefore seems destined to evolve into the brightest cluster galaxy. The high spatial resolution ACS images reveal several kiloparsec-scale features within and around the radio galaxy. The continuum light is aligned with the radio axis and is resolved into two clumps in the i775 and z850 bands. These components have luminosities ~109 Lsolar and sizes of a few kpc. The estimated nebular continuum, scattered light, synchrotron- and inverse Compton-scattering contributions to the aligned continuum light are only a few percent of the observed total, indicating that the observed flux is likely dominated by forming stars. The estimated star formation rate for the whole radio galaxy is ~200 Msolar yr-1. A simple model in which the jet has triggered star formation in these continuum knots is consistent with the available data. A striking, but small, linear feature is evident in the z850 aligned light and may be indicative of a large-scale shock associated with the advance of the radio jet. The rest of the aligned light also seems morphologically consistent with star formation induced by shocks associated with the radio source, as seen in other high-z radio galaxies (e.g., 4C 41.17). An unusual feature is seen in Lyα emission. A wedge-shaped extension emanates from the radio galaxy perpendicularly to the radio axis. This ``wedge

  18. The HST/ACS Coma Cluster Survey III. Structural Parameters of Galaxies using single-S\\'ersic Fits

    CERN Document Server

    Hoyos, Carlos; Kleijn, Gijs Verdoes; Carter, David; Balcells, Marc; Guzman, Rafael; Peletier, Reynier; Ferguson, Henry C; Goudfrooij, Paul; Graham, Alister W; Hammer, Derek; Karick, Arna M; Lucey, John R; Matkovic, Ana; Merritt, David; Mouhcine, Mustapha; Valentijn, Edwin

    2010-01-01

    We present a catalogue of structural parameters for 8814 galaxies in the 25 fields of the HST/ACS Coma Treasury Survey. Parameters from S\\'ersic fits to the two-dimensional surface brightness distributions are given for all galaxies from our published Coma photometric catalogue with mean effective surface brightness brighter than 26.0 mag/sq. arcsec and brighter than 24.5 mag (equivalent to absolute magnitude - 10.5), as given by the fits, all in F814W(AB). The sample comprises a mixture of Coma members and background objects; 424 galaxies have redshifts and of these 163 are confirmed members. The fits were carried out using both the Gim2D and Galfit codes. We provide the following parameters: Galaxy ID, RA, DEC, the total corrected automatic magnitude from the photometric catalogue, the total magnitude of the model (F814W_AB), the geometric mean effective radius Re, the mean surface brightness within the effective radius _e, the S\\'ersic index n, the ellipticity and the source position angle. The selection l...

  19. The HST/ACS Coma Cluster Survey - III. Structural parameters of galaxies using single Sérsic fits

    Science.gov (United States)

    Hoyos, Carlos; den Brok, Mark; Verdoes Kleijn, Gijs; Carter, David; Balcells, Marc; Guzmán, Rafael; Peletier, Reynier; Ferguson, Henry C.; Goudfrooij, Paul; Graham, Alister W.; Hammer, Derek; Karick, Arna M.; Lucey, John R.; Matković, Ana; Merritt, David; Mouhcine, Mustapha; Valentijn, Edwin

    2011-03-01

    We present a catalogue of structural parameters for 8814 galaxies in the 25 fields of the Hubble Space Telescope/ACS Coma Treasury Survey. Parameters from Sérsic fits to the two-dimensional surface brightness distributions are given for all galaxies from our published Coma photometric catalogue with mean effective surface brightness brighter than 26.0 mag arcsec-2 and brighter than 24.5 mag (equivalent to absolute magnitude -10.5), as given by the fits, all in F814W(AB). The sample comprises a mixture of Coma members and background objects; 424 galaxies have redshifts and of these 163 are confirmed members. The fits were carried out using both the GIM2D and GALFIT codes. We provide the following parameters: galaxy ID, RA, Dec., the total corrected automatic magnitude from the photometric catalogue, the total magnitude of the model (F814WAB), the geometric mean effective radius Re, the mean surface brightness within the effective radius e, the Sérsic index n, the ellipticity and the source position angle. The selection limits of the catalogue and the errors listed for the Sérsic parameters come from extensive simulations of the fitting process using synthetic galaxy models. The agreement between GIM2D and GALFIT parameters is sensitive to details of the fitting procedure; for the settings employed here the agreement is excellent over the range of parameters covered in the catalogue. We define and present two goodness-of-fit indices which quantify the degree to which the image can be approximated by a Sérsic model with concentric, coaxial elliptical isophotes; such indices may be used to objectively select galaxies with more complex structures such as bulge-disc, bars or nuclear components. We make the catalogue available in electronic format at ASTRO-WISE and MAST. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy

  20. Dwarf galaxies in the Antlia Cluster: First results

    CERN Document Server

    Castelli, A V S; Cellone, S A; Richtler, T; Dirsch, B; Infante, L; Aruta, C; Gómez, M

    2006-01-01

    We present the first results of a project aimed to study the galaxy population of the Antlia cluster, the third nearest galaxy cluster after Virgo and Fornax. The observations for the Antlia project consist of Washington wide-field images taken with the MOSAIC camera mounted at the prime focus of the CTIO 4-m Blanco telescope. Our preliminary results correspond to the identification and classification of dwarf galaxies in the central cluster region, extending the list of Ferguson & Sandage (1990). The final aim of our project is to study the luminosity function, morphology and structural parameters of dwarf galaxies in the Antlia cluster with a more complete sample.

  1. Prospects of detecting gamma-ray emission from galaxy clusters: cosmic rays and dark matter annihilations

    CERN Document Server

    Pinzke, Anders; Bergstrom, Lars

    2011-01-01

    We study the possibility for detecting gamma-ray emission in galaxy clusters. We consider 1) cosmic ray (CR) induced pion decay which is thought to dominate the astrophysical signal from clusters, 2) different representative benchmark models of supersymmetric dark matter (DM), and 3) leptophilic models of DM annihilation that include a Sommerfeld enhancement (SFE). To model DM annihilation, we consider hadronization of annihilating neutralinos, internal bremsstrahlung, and inverse Compton emission from the cosmic microwave background as well as from a realistic spatial and spectral distribution of dust and stellar light. We predict the Virgo and Fornax clusters to be the brightest DM sources and find a particularly low CR induced background for Fornax. For a minimum substructure mass given by the DM free-streaming scale, we find a substructure boost factor of more than 1000. Since the annihilation flux of substructures is mostly contributed by the regions around the virial radius, the resulting surface bright...

  2. Hard X-Ray Spectrum from West Lobe of Radio Galaxy Fornax A Observed with Suzaku

    CERN Document Server

    Tashiro, Makoto S; Seta, Hiromi; Matsuta, Keiko; Yaji, Yuichi

    2009-01-01

    An observation of the West lobe of radio galaxy Fornax A (NGC 1316) with Suzaku is reported. Since Feigelson et al. (1995) and Kaneda et al. (1995) discovered the cosmic microwave background boosted inverse-Comptonized (IC) X-rays from the radio lobe, the magnetic field and electron energy density in the lobes have been estimated under the assumption that a single component of the relativistic electrons generates both the IC X-rays and the synchrotron radio emission. However, electrons generating the observed IC X-rays in the 1 -- 10 keV band do not possess sufficient energy to radiate the observed synchrotron radio emission under the estimated magnetic field of a few micro-G. On the basis of observations made with Suzaku, we show in the present paper that a 0.7 -- 20 keV spectrum is well described by a single power-law model with an energy index of 0.68 and a flux density of 0.12+/-0.01 nJy at 1 keV from the West lobe. The derived multiwavelength spectrum strongly suggests that a single electron energy distr...

  3. The metal-poor Knee in the Fornax Dwarf Spheroidal Galaxy

    CERN Document Server

    Hendricks, Benjamin; Lanfranchi, Gustavo A; Boeche, Corrado; Walker, Matthew; Johnson, Christian I; Penarrubia, Jorge; Gilmore, Gerard

    2014-01-01

    We present alpha-element abundances of Mg, Si, and Ti for a large sample of field stars in two outer fields of the Fornax dwarf spheroidal galaxy (dSph), obtained with VLT/GIRAFFE (R~16,000). Due to the large fraction of metal-poor stars in our sample, we are able to follow the alpha-element evolution from [Fe/H]=-2.5 continuously to [Fe/H]=-0.7 dex. For the first time we are able to resolve the turnover from the Type II supernovae (SNe) dominated, alpha-enhanced plateau down to subsolar [alpha/Fe] values due to the onset of SNe Ia, and thus to trace the chemical enrichment efficiency of the galaxy. Our data support the general concept of an alpha-enhanced plateau at early epochs, followed by a well-defined "knee", caused by the onset of SNe Ia, and finally a second plateau with sub-solar [alpha/Fe] values. We find the position of this knee to be at [Fe/H]=-1.9 and therefore significantly more metal-poor than expected from comparison with other dSphs and standard evolutionary models. Surprisingly, this value ...

  4. The Colors of Dwarf Elliptical Galaxy Globular Cluster Systems, Nuclei and Stellar Halos

    OpenAIRE

    Lotz, Jennifer M.; Miller, Bryan W.; Ferguson, Henry C.

    2004-01-01

    We present the results of a Hubble Space Telescope WFPC2 F555W and F814W survey of 69 dwarf elliptical galaxies (dEs) in the Virgo and Fornax Clusters and Leo Group. The $V-I$ colors of the dE globular clusters, nuclei, and underlying field star populations are used to trace the dE star-formation histories. We find that the dE globular cluster candidates are as blue as the metal-poor globular clusters of the Milky Way. The observed correlation of the dE globular cluster systems' $V-I$ color w...

  5. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  6. Insights from the Outskirts: Chemical and Dynamical Properties in the outer Parts of the Fornax Dwarf Spheroidal Galaxy

    CERN Document Server

    Hendricks, Benjamin; Walker, Matthew; Johnson, Christian I; Penarrubia, Jorge; Gilmore, Gerard

    2014-01-01

    We present radial velocities and [Fe/H] abundances for 340 stars in the Fornax dwarf spheroidal from R~16,000 spectra. The targets have been obtained in the outer parts of the galaxy, a region which has been poorly studied before. Our sample shows a wide range in [Fe/H], between -0.5 and -3.0 dex, in which we detect three subgroups. Removal of stars belonging to the most metal-rich population produces a truncated metallicity distribution function that is identical to Sculptor, indicating that these systems have shared a similar early evolution, only that Fornax experienced a late, intense period of star formation (SF). The derived age-metallicity relation shows a fast increase in [Fe/H] at early ages, after which the enrichment flattens significantly for stars younger than ~8 Gyr. Additionally, the data indicate a strong population of stars around 4 Gyr, followed by a second rapid enrichment in [Fe/H]. A leaky-box chemical enrichment model generally matches the observed relation but does not predict a signifi...

  7. VLT AND ACS OBSERVATIONS OF RDCS J1252.9-2927: DYNAMICAL STRUCTURE AND GALAXY POPULATIONS IN A MASSIVE CLUSTER AT Z=1.237*

    Energy Technology Data Exchange (ETDEWEB)

    Demarco, R; Rosati, P; Lidman, C; Girardi, M; Nonino, M; Rettura, A; Strazzullo, V; der Wel, A v; Ford, H C; Mainieri, V; Holden, B P; Stanford, S A; Blakeslee, J P; Gobat, R; Postman, M; Tozzi, P; Overzier, R A; Zirm, A W; Benitez, N; Homeier, N L; Illingworth, G D; Infante, L; Jee, M J; Mei, S; Menanteau, F; Motta, V; Zheng, W; Clampin, M; Hartig, G

    2007-03-23

    We present results from an extensive spectroscopic survey, carried out with FORS on the ESO Very Large Telescope, and from an extensive multi-wavelength imaging data set from the Advanced Camera for Surveys and ground based facilities of the cluster of galaxies RDCS J1252.9-2927. We have spectroscopically confirmed 38 cluster members in the redshift range 1.22 < z < 1.25. The distribution in velocity of these spectroscopic members yields a cluster median redshift of z = 1.237 and a rest-frame velocity dispersion of 747{sub -84}{sup +74} km s{sup -1}. Star-forming members are observed to mainly populate the outskirts of the cluster while passive galaxies dominate the central cluster region. Using the 38 confirmed redshifts, we were able to resolve, for the first time at z > 1, kinematic structure. The velocity distribution, which is not Gaussian at the 95% confidence level, is consistent with two groups that are also responsible for the projected elongation of the cluster in the East-West direction. The groups are composed of 26 and 12 galaxies and have velocity dispersions of 486{sub -85}{sup +47} km s{sup -1} and 426{sub -105}{sup +57} km s{sup -1}, respectively. The elongation is also seen in the intracluster gas (from X-ray observations) and the dark matter distribution (from a weak lensing analysis). This leads us to conclude that RDCS J1252.9-2927 has not yet reached a final virial state. We extend the analysis of the color-magnitude diagram of spectroscopic members to more than 1 Mpc from the cluster center. The scatter and slope of non-[OII]-emitting cluster members in the near-IR red sequence is similar to that seen in clusters at lower redshift. Furthermore, none of the galaxies with luminosities greater than {approx} K*{sub s} + 1.5 show any [OII] emission feature, indicating that these more luminous, redder galaxies have stopped forming stars earlier than the fainter, bluer galaxies. Our observations provide detailed dynamical and spectrophotometric

  8. Lack of nuclear clusters in dwarf spheroidal galaxies: implications for massive black holes formation and the cusp/core problem

    Science.gov (United States)

    Arca-Sedda, Manuel; Capuzzo-Dolcetta, Roberto

    2017-01-01

    One of the leading scenarios for the formation of nuclear star clusters in galaxies is related to the orbital decay of globular clusters (GCs) and their subsequent merging, though alternative theories are currently debated. The availability of high-quality data for structural and orbital parameters of GCs allows us to test different nuclear star cluster formation scenarios. The Fornax dwarf spheroidal (dSph) galaxy is the heaviest satellite of the Milky Way and it is the only known dSph hosting five GCs, whereas there are no clear signatures for the presence of a central massive black hole. For this reason, it represents a suited place to study the orbital decay process in dwarf galaxies. In this paper, we model the future evolution of the Fornax GCs simulating them and the host galaxy by means of direct N-body simulations. Our simulations also take into account the gravitational field generated by the Milky Way. We found that if the Fornax galaxy is embedded in a standard cold dark matter halo, the nuclear cluster formation would be significantly hampered by the high central galactic mass density. In this context, we discuss the possibility that infalling GCs drive the flattening of the galactic density profile, giving a possible alternative explanation to the so-called cusp/core problem. Moreover, we briefly discuss the link between GC infall process and the absence of massive black holes in the centre of dSphs.

  9. K2: A new method for the detection of galaxy clusters based on CFHTLS multicolor images

    CERN Document Server

    Thanjavur, Karun; Crampton, David

    2009-01-01

    We have developed a new method, K2, optimized for the detection of galaxy clusters in multicolor images. Based on the Red Sequence approach, K2 detects clusters using simultaneous enhancements in both colors and position. The detection significance is robustly determined through extensive Monte-Carlo simulations and through comparison with available cluster catalogs based on two different optical methods, and also on X-ray data. K2 also provides quantitative estimates of the candidate clusters' richness and photometric redshifts. Initially K2 was applied to 161 sq deg of two color gri images of the CFHTLS-Wide data. Our simulations show that the false detection rate, at our selected threshold, is only ~1%, and that the cluster catalogs are ~80% complete up to a redshift of 0.6 for Fornax-like and richer clusters and to z ~0.3 for poorer clusters. Based on Terapix T05 release gri photometric catalogs, 35 clusters/sq deg are detected, with 1-2 Fornax-like or richer clusters every two square degrees. Catalogs co...

  10. VizieR Online Data Catalog: Fornax dSph H4 globular cluster stars (Hendricks+, 2016)

    Science.gov (United States)

    Hendricks, B.; Boeche, C.; Johnson, C. I.; Frank, M. J.; Koch, A.; Mateo, M.; Bailey, J. I., III

    2016-03-01

    For this project, we used the Michigan/Magellan Fiber System (M2FS) and MSpec spectrograph, a fiber-fed spectrograph mounted on the Nasmyth-east port of the Magellan-Clay 6.5 m telescope at Las Campanas Observatory. For M2FS, we used the Bulge_GC1 setup and 125m slit, which allows a simultaneous observation of up to 48 targets at a resolving power of R~=28000 and a continuous wavelength coverage from 6140 to 6720Å. The observations have been carried out during three consecutive nights in December 2014. With 8 individual exposures, a total of 6.7h have been observed on target with typical seeing conditions around 0.8". (3 data files).

  11. Constraining ultra-compact dwarf galaxy formation with galaxy clusters in the local universe

    CERN Document Server

    Pfeffer, Joel; Baumgardt, Holger; Griffen, Brendan F

    2016-01-01

    We compare the predictions of a semi-analytic model for ultra-compact dwarf galaxy (UCD) formation by tidal stripping to the observed properties of globular clusters (GCs) and UCDs in the Fornax and Virgo clusters. For Fornax we find the predicted number of stripped nuclei agrees very well with the excess number of GCs$+$UCDs above the GC luminosity function. GCs$+$UCDs with masses $>10^{7.3}$ M$_\\odot$ are consistent with being entirely formed by tidal stripping. Stripped nuclei can also account for Virgo UCDs with masses $>10^{7.3}$ M$_\\odot$ where numbers are complete by mass. For both Fornax and Virgo, the predicted velocity dispersions and radial distributions of stripped nuclei are consistent with that of UCDs within $\\sim$50-100 kpc but disagree at larger distances where dispersions are too high and radial distributions too extended. Stripped nuclei are predicted to have radially biased anisotropies at all radii, agreeing with Virgo UCDs at clustercentric distances larger than 50 kpc. However, ongoing ...

  12. Cluster-cluster clustering

    Science.gov (United States)

    Barnes, J.; Dekel, A.; Efstathiou, G.; Frenk, C. S.

    1985-01-01

    The cluster correlation function xi sub c(r) is compared with the particle correlation function, xi(r) in cosmological N-body simulations with a wide range of initial conditions. The experiments include scale-free initial conditions, pancake models with a coherence length in the initial density field, and hybrid models. Three N-body techniques and two cluster-finding algorithms are used. In scale-free models with white noise initial conditions, xi sub c and xi are essentially identical. In scale-free models with more power on large scales, it is found that the amplitude of xi sub c increases with cluster richness; in this case the clusters give a biased estimate of the particle correlations. In the pancake and hybrid models (with n = 0 or 1), xi sub c is steeper than xi, but the cluster correlation length exceeds that of the points by less than a factor of 2, independent of cluster richness. Thus the high amplitude of xi sub c found in studies of rich clusters of galaxies is inconsistent with white noise and pancake models and may indicate a primordial fluctuation spectrum with substantial power on large scales.

  13. Cluster-cluster clustering

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, J.; Dekel, A.; Efstathiou, G.; Frenk, C.S.

    1985-08-01

    The cluster correlation function xi sub c(r) is compared with the particle correlation function, xi(r) in cosmological N-body simulations with a wide range of initial conditions. The experiments include scale-free initial conditions, pancake models with a coherence length in the initial density field, and hybrid models. Three N-body techniques and two cluster-finding algorithms are used. In scale-free models with white noise initial conditions, xi sub c and xi are essentially identical. In scale-free models with more power on large scales, it is found that the amplitude of xi sub c increases with cluster richness; in this case the clusters give a biased estimate of the particle correlations. In the pancake and hybrid models (with n = 0 or 1), xi sub c is steeper than xi, but the cluster correlation length exceeds that of the points by less than a factor of 2, independent of cluster richness. Thus the high amplitude of xi sub c found in studies of rich clusters of galaxies is inconsistent with white noise and pancake models and may indicate a primordial fluctuation spectrum with substantial power on large scales. 30 references.

  14. HST/ACS color-magnitude diagrams of candidate intermediate-age M 31 globular clusters. The role of blue horizontal branches

    CERN Document Server

    Perina, S; Pecci, F Fusi; Bellazzini, M; Federici, L; Buzzoni, A

    2011-01-01

    We present deep (V ~ 28.0) BV photometry obtained with the wide field channel of the Advanced Camera for Surveys on board HST for four M31 globular clusters that were identified as candidate intermediate-age (age ~ 1-9 Gyr) by various authors, based on their integrated spectra and/or broad/intermediate-band colors. Two of them (B292 and B350) display an obvious blue horizontal branch, indicating that they are as old as the oldest Galactic globulars. On the other hand, for the other two (B058 and B337), which display red horizontal branches, it was not possible either to confirm or disconfirm the age estimate from integrated spectra. The analysis of the distribution in the spectral indices Mg2 and H_beta of the M31 and Milky Way clusters whose horizontal branch can be classified as red or blue based on existing CMDs, strongly suggests that classical age diagnostics from integrated spectra may be significantly influenced by the HB morphology of the clusters and can lead to erroneous age-classifications. We also...

  15. Lack of nuclear clusters in dwarf sferoidal galaxies: implications for massive black holes formation and the cusp/core problem

    CERN Document Server

    Arca-Sedda, Manuel

    2016-01-01

    One of the leading scenarios for the formation of nuclear star clusters in galaxies is related to the orbital decay of globular clusters (GCs) and their subsequent merging, though alternative theories are currently debated. The availability of high-quality data for GCs structural and orbital parameters allow to test different nuclear star cluster formation scenarios. The Fornax dwarf spheroidal (dSph) galaxy is the heaviest satellite of the Milky Way and it is the only known dwarf spheroidal hosting 5 GCs, whereas there are no clear signatures for the presence of a central massive black hole. For this reason, it represents a suited place to study the orbital decay process in dwarf galaxies. In this paper we model the future evolution of the Fornax GCs simulating them and the host galaxy by means of direct $N$-body simulations. Our simulations take in account also the gravitational field generated by the Milky Way. We found that if the Fornax galaxy is embedded in a standard Cold Dark Matter Halo, the nuclear ...

  16. The Globular Cluster System of the Coma cD Galaxy NGC 4874 from Hubble Space Telescope ACS and WFC3/IR Imaging

    Science.gov (United States)

    Cho, Hyejeon; Blakeslee, John P.; Chies-Santos, Ana L.; Jee, M. James; Jensen, Joseph B.; Peng, Eric W.; Lee, Young-Wook

    2016-05-01

    We present new Hubble Space Telescope (HST) optical and near-infrared (NIR) photometry of the rich globular cluster (GC) system NGC 4874, the cD galaxy in the core of the Coma cluster (Abell 1656). NGC 4874 was observed with the HST Advanced Camera for Surveys in the F475W (g 475) and F814W (I 814) passbands and with the Wide Field Camera 3 IR Channel in F160W (H 160). The GCs in this field exhibit a bimodal optical color distribution with more than half of the GCs falling on the red side at g 475-I 814 > 1. Bimodality is also present, though less conspicuously, in the optical-NIR I 814-H 160 color. Consistent with past work, we find evidence for nonlinearity in the g 475-I 814 versus I 814-H 160 color-color relation. Our results thus underscore the need for understanding the detailed form of the color-metallicity relations in interpreting observational data on GC bimodality. We also find a very strong color-magnitude trend, or “blue tilt,” for the blue component of the optical color distribution of the NGC 4874 GC system. A similarly strong trend is present for the overall mean I 814-H 160 color as a function of magnitude; for M 814 law and becomes much weaker at lower masses. As in other similar systems, the spatial distribution of the blue GCs is more extended than that of the red GCs, partly because of blue GCs associated with surrounding cluster galaxies. In addition, the center of the GC system is displaced by 4 ± 1 kpc toward the southwest from the luminosity center of NGC 4874, in the direction of NGC 4872. Finally, we remark on a dwarf elliptical galaxy with a noticeably asymmetrical GC distribution. Interestingly, this dwarf has a velocity of nearly -3000 km s-1 with respect to NGC 4874; we suggest it is on its first infall into the cluster core and is undergoing stripping of its GC system by the cluster potential. Based on observations with the NASA/ESA Hubble Space Telescope, obtained from the Space Telescope Science Institute (STScI), which is

  17. HST/ACS color-magnitude diagrams of candidate intermediate-age M 31 globular clusters. The role of blue horizontal branches

    Science.gov (United States)

    Perina, S.; Galleti, S.; Fusi Pecci, F.; Bellazzini, M.; Federici, L.; Buzzoni, A.

    2011-07-01

    We present deep (V ≃ 28.0) BV photometry obtained with the wide field channel of the Advanced Camera for Surveys on board HST for four M 31 globular clusters that were identified as candidate intermediate-age (age ~ 1-9 Gyr) by various authors, based on their integrated spectra and/or broad/intermediate-band colors. Two of them (B292 and B350) display an obvious blue horizontal branch, indicating that they are as old as the oldest Galactic globulars. On the other hand, for the other two (B058 and B337), which display red horizontal branches, it was not possible either to confirm or disconfirm the age estimate from integrated spectra. The analysis of the distribution in the spectral indices Mg2 and Hβ of the M 31 and Milky Way clusters whose horizontal branch can be classified as red or blue based on existing CMDs, strongly suggests that classical age diagnostics from integrated spectra may be significantly influenced by the HB morphology of the clusters and can lead to erroneous age-classifications. We also provide the CMD for another two clusters that fall into the field of the main targets, B336, an old and metal-poor globular with a significant population of RR Lyrae variables, and the newly discovered B531, a cluster with a very red red giant branch. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained from the data archive at the Space Telescope Science Institute. STScI is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with program GO-10631 [P.I.: T. Puzia].Photometric catalogs are available at the CDS via anonymous ftp to cdsarc.u-strasbg.fr (130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/531/A155 and at http://www.bo.astro.it/M31/hstcatalog/

  18. Modelling of the Spectral Energy Distribution of Fornax A: Leptonic and Hadronic Production of High Energy Emission from the Radio Lobes

    CERN Document Server

    McKinley, B; López-Caniego, M; Briggs, F; Hurley-Walker, N; Wayth, R B; Offringa, A R; Crocker, R; Bernardi, G; Procopio, P; Gaensler, B M; Tingay, S J; Johnston-Hollitt, M; McDonald, M; Bell, M; Bhat, N D R; Bowman, J D; Cappallo, R J; Corey, B E; Deshpande, A A; Emrich, D; Ewall-Wice, A; Feng, L; Goeke, R; Greenhill, L J; Hazelton, B J; Hewitt, J N; Hindson, L; Jacobs, D; Kaplan, D L; Kasper, J C; Kratzenberg, E; Kudryavtseva, N; Lenc, E; Lonsdale, C J; Lynch, M J; McWhirter, S R; Mitchell, D A; Morales, M F; Morgan, E; Oberoi, D; Ord, S M; Pindor, B; Prabu, T; Riding, J; Rogers, A E E; Roshi, D A; Shankar, N Udaya; Srivani, K S; Subrahmanyan, R; Waterson, M; Webster, R L; Whitney, A R; Williams, A; Williams, C L

    2014-01-01

    We present new low-frequency observations of the nearby radio galaxy Fornax A at 154 MHz with the Murchison Widefield Array, microwave flux-density measurements obtained from WMAP and Planck data, and gamma-ray flux densities obtained from Fermi data. We also compile a comprehensive list of previously published images and flux-density measurements at radio, microwave and X-ray energies. A detailed analysis of the spectrum of Fornax A between 154 MHz and 1510 MHz reveals that both radio lobes have a similar spatially-averaged spectral index, and that there exists a steep-spectrum bridge of diffuse emission between the lobes. Taking the spectral index of both lobes to be the same, we model the spectral energy distribution of Fornax A across an energy range spanning eighteen orders of magnitude, to investigate the origin of the X-ray and gamma-ray emission. A standard leptonic model for the production of both the X-rays and gamma-rays by inverse-Compton scattering does not fit the multi-wavelength observations. ...

  19. The Globular Cluster System of the Coma cD Galaxy NGC 4874 from Hubble Space Telescope ACS and WFC3/IR Imaging

    CERN Document Server

    Cho, Hyejeon; Chies-Santos, Ana L; Jee, M James; Jensen, Joseph B; Peng, Eric W; Lee, Young-Wook

    2016-01-01

    We present new HST optical and near-infrared (NIR) photometry of the rich globular cluster (GC) system of NGC 4874, the cD galaxy in the core of the Coma cluster (Abell 1656). NGC 4874 was observed with the HST Advanced Camera for Surveys in the F475W (g) and F814W (I) passbands and the Wide Field Camera 3 IR Channel in F160W (H). The GCs in this field exhibit a bimodal optical color distribution with more than half of the GCs falling on the red side at g-I > 1. Bimodality is also present, though less conspicuously, in the optical-NIR I-H color. Consistent with past work, we find evidence for nonlinearity in the g-I versus I-H color-color relation. Our results thus underscore the need for understanding the detailed form of the color-metallicity relations in interpreting observational data on GC bimodality. We also find a very strong color-magnitude trend, or "blue tilt," for the blue component of the optical color distribution of the NGC 4874 GC system. A similarly strong trend is present for the overall mean...

  20. Mid-infrared dust in two nearby radio galaxies, NGC 1316 (Fornax A) and NGC 612 (PKS 0131-36)

    CERN Document Server

    Asabere, B Duah; Jarrett, T; Winkler, H

    2016-01-01

    Most radio galaxies are hosted by giant gas-poor ellipticals, but some contain significant amounts of dust, which is likely to be of external origin. In order to characterize the mid-IR properties of two of the most nearby and brightest merger-remnant radio galaxies of the Southern hemisphere, NGC 1316 (Fornax A) and NGC 612 (PKS 0131-36), we used observations with the Wide-field Infrared Survey Explorer (WISE) at wavelengths of 3.4, 4.6, 12 and 22 micron and Spitzer mid-infrared spectra. By applying a resolution-enhancement technique, new WISE images were produced at angular resolutions ranging from 2.6" to 5.5". Global measurements were performed in the four WISE bands, and stellar masses and star-formation rates were estimated using published scaling relations. Two methods were used to uncover the distribution of dust, one relying on two-dimensional fits to the 3.4 micron images to model the starlight, and the other one using a simple scaling and subtraction of the 3.4 micron images to estimate the stellar...

  1. Fermi Large Area Telescope Detection of Extended Gamma-Ray Emission from the Radio Galaxy Fornax A

    CERN Document Server

    ,

    2016-01-01

    We report the Fermi Large Area Telescope detection of extended gamma-ray emission from the lobes of the radio galaxy Fornax A using 6.1 years of Pass 8 data. After Centaurus A, this is now the second example of an extended gamma-ray source attributed to a radio galaxy. Both an extended flat disk morphology and a morphology following the extended radio lobes were preferred over a point-source description, and the core contribution was constrained to be 100 MeV gamma-ray emission established, we model the source broadband emission considering currently available total lobe radio and millimeter flux measurements, as well as X-ray detections attributed to inverse Compton (IC) emission off the cosmic microwave background (CMB). Unlike the Centaurus A case, we find that a leptonic model involving IC scattering of CMB and extragalactic background light (EBL) photons underpredicts the gamma-ray fluxes by factors of about ~ 2 - 3, depending on the EBL model adopted. An additional gamma-ray spectral component is thus ...

  2. AC 410 AC410 AC410 Unit 7 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

    AC 410 AC410 AC410 Unit 7 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-7-homework-assignment/    Questions Requiring Analysis 14-30   Early in your first audit of Star Corporation, you notice that sales and year-end inventory are almost unchanged from the prior year. However, cost of goods sold is less than in the preceding year, and accounts payable also are down substantially. Gross profit has increased, but this increase has not c...

  3. Wide-Field Hubble Space Telescope Observations of the Globular Cluster System in NGC 1399*

    Science.gov (United States)

    Puzia, Thomas H.; Paolillo, Maurizio; Goudfrooij, Paul; Maccarone, Thomas J.; Fabbiano, Giuseppina; Angelini, Lorella

    2014-01-01

    We present a comprehensive high spatial resolution imaging study of globular clusters (GCs) in NGC 1399, thecentral giant elliptical cD galaxy in the Fornax galaxy cluster, conducted with the Advanced Camera for Surveys(ACS) aboard theHubble Space Telescope(HST).Using a novel technique to construct drizzled point-spreadfunction libraries for HSTACS data, we accurately determine the fidelity of GC structural parameter measurementsfrom detailed artificial star cluster experiments and show the superior robustness of the GC half-light radius,rh,compared with other GC structural parameters, such as King core and tidal radius. The measurement ofrhfor themajor fraction of the NGC 1399 GC system reveals a trend of increasingrhversus galactocentric distance,Rgal,out to about 10 kpc and a flat relation beyond. This trend is very similar for blue and red GCs, which are found tohave a mean size ratio ofrh,redrh,blue0.820.11 at all galactocentric radii from the core regions of the galaxyout to40 kpc. This suggests that the size difference between blue and red GCs is due to internal mechanismsrelated to the evolution of their constituent stellar populations. Modeling the mass density profile of NGC 1399shows that additional external dynamical mechanisms are required to limit the GC size in the galaxy halo regionstorh2 pc. We suggest that this may be realized by an exotic GC orbit distribution function, an extended darkmatter halo, andor tidal stress induced by the increased stochasticity in the dwarf halo substructure at largergalactocentric distances. We compare our results with the GCrhdistribution functions in various galaxies and findthat the fraction of extended GCs withrh5 pc is systematically larger in late-type galaxies compared with GCsystems in early-type galaxies. This is likely due to the dynamically more violent evolution of early-type galaxies.We match our GCrhmeasurements with radial velocity data from the literature and split the resulting sample at

  4. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  5. VizieR Online Data Catalog: Cool carbon stars in the halo and Fornax dSph (Mauron+, 2014)

    Science.gov (United States)

    Mauron, N.; Gigoyan, K. S.; Berlioz-Arthaud, P.; Klotz, A.

    2014-03-01

    Spectroscopy of halo candidate C stars was achieved at ESO (La Silla) on 17-18 October 2009 at the NTT telescope equipped with the EFOSC2 instrument in the spectral range 5200-9300Å. We were able to secure the spectra of 25 candidates with exposure times of generally a few minutes, and eventually, eight were found to be C-rich. We also observed three carbon stars in the Carina dwarf galaxy because they were erroneously believed to be in the halo, and for comparison APM 2225-1401, a C star from the list of Totten and Irwin (1998MNRAS.294....1T). We found spectra that covered the Hα region for four halo stars in the Byurakan Astrophysical Observatory archive. They were obtained with the BAO 2.6m telescope and the ByuFOSC2 spectrograph. These spectra were taken on 28 March 1999, 12 June 2002, 11 May 2000, and 11 June 2000 with a resolution ~8Å. Concerning Fornax, spectra of C stars were found in the ESO Archive (program 70.D-0203, P.I. Marc Azzopardi). They were obtained on 5 November 2002 with the ESO 3.6m telescope and the EFOSC instrument with a resolution ~23Å and a spectral coverage from 4000Å to 7950Å. Sixteen C stars were monitored with the ground-based 25cm diameter TAROT telescopes. This monitoring took place irregularly at ESO La Silla and Observatoire de la Cote d'Azur (France) beginning in 2010. Thanks to the recently released Catalina and LINEAR databases, we were able to examine the light curves of 143 halo C stars and found 66 new periodic (Mira or SRa-type) variables among them. (5 data files).

  6. The binuclear nickel center in the A-cluster of acetyl-CoA synthase (ACS) and two biomimetic dinickel complexes studied by X-ray absorption and emission spectroscopy

    Science.gov (United States)

    Schrapers, P.; Mebs, S.; Ilina, Y.; Warner, D. S.; Wörmann, C.; Schuth, N.; Kositzki, R.; Dau, H.; Limberg, C.; Dobbek, H.; Haumann, M.

    2016-05-01

    Acetyl-CoA synthase (ACS) is involved in the bacterial carbon oxide conversion pathway. The binuclear nickel sites in ACS enzyme and two biomimetic synthetic compounds containing a Ni(II)Ni(II) unit (1 and 2) were compared using XAS/XES. EXAFS analysis of ACS proteins revealed similar Ni-N/O/S bond lengths and Ni-Ni/Fe distances as in the crystal structure in oxidized ACS, but elongated Ni-ligand bonds in reduced ACS, suggesting more reduced nickel species. The XANES spectra of ACS and the dinickel complexes showed overall similar shapes, but less resolved pre-edge and edge features in ACS, attributed to more distorted square-planar nickel sites in particular in reduced ACS. DFT calculation of pre-edge absorption and Kβ2,5 emission features reproduced the experimental spectra of the synthetic complexes, was sensitive even to the small geometry differences in 1 and 2, and indicated low-spin Ni(II) sites. Comparison of nickel sites in proteins and biomimetic compounds is valuable for deducing structural and electronic differences in response to ligation and redox changes.

  7. R-clustering for egocentric video segmentation

    NARCIS (Netherlands)

    Talavera Martínez, Estefanía

    2015-01-01

    In this paper, we present a new method for egocentric video temporal segmentation based on integrating a statistical mean change detector and agglomerative clustering(AC) within an energy-minimization framework. Given the tendency of most AC methods to oversegment video sequences when clustering the

  8. Constraints on mass loss of globular clusters in dwarf galaxies

    CERN Document Server

    Larsen, S S; Brodie, J P

    2013-01-01

    The Fornax dwarf spheroidal galaxy is well known for its very high globular cluster specific frequency, SN=26. Furthermore, while the field star metallicity distribution peaks at [Fe/H]=-1, four of the five GCs have [Fe/H]<-2. Only about 5 percent of the field stars have such low metallicities. Hence, a very large fraction of about 1/5-1/4 of the most metal-poor stars belong to the four most metal-poor GCs. This implies that these clusters could, at most, have been a factor of 4-5 more massive initially. A second, even more extreme case may be the IKN dwarf galaxy where SN=124. Although metallicities are not accurately known, the GCs account for about 13 percent of the total V-band luminosity of IKN.

  9. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  10. Chandra Observations of the Components of Clusters, Groups, and Galaxies and their Interactions

    CERN Document Server

    Forman, W; Markevitch, M L; Vikhlinin, A A; Churazov, E

    2001-01-01

    We discuss two themes from Chandra observations of galaxies, groups, and clusters. First, we review the merging process as seen through the high angular resolution of Chandra. We present examples of sharp, edge-like surface brightness structures ``cold fronts'', the boundaries of the remaining cores of merger components and the Chandra observations of CL0657, the first clear example of a strong cluster merger shock. In addition to reviewing already published work, we present observations of the cold front around the elliptical galaxy NGC1404 which is infalling into the Fornax cluster and we discuss multiple ``edges'' in ZW3146. Second, we review the effects of relativistic, radio-emitting plasmas or ``bubbles'', inflated by active galactic nuclei, on the hot X-ray emitting gaseous atmospheres in galaxies and clusters. We review published work and also discuss the unusual X-ray structures surrounding the galaxies NGC4636 and NGC507.

  11. K2: A New Method for the Detection of Galaxy Clusters Based on Canada-France-Hawaii Telescope Legacy Survey Multicolor Images

    Science.gov (United States)

    Thanjavur, Karun; Willis, Jon; Crampton, David

    2009-11-01

    We have developed a new method, K2, optimized for the detection of galaxy clusters in multicolor images. Based on the Red Sequence approach, K2 detects clusters using simultaneous enhancements in both colors and position. The detection significance is robustly determined through extensive Monte Carlo simulations and through comparison with available cluster catalogs based on two different optical methods, and also on X-ray data. K2 also provides quantitative estimates of the candidate clusters' richness and photometric redshifts. Initially, K2 was applied to the two color (gri) 161 deg2 images of the Canada-France-Hawaii Telescope Legacy Survey Wide (CFHTLS-W) data. Our simulations show that the false detection rate for these data, at our selected threshold, is only ~1%, and that the cluster catalogs are ~80% complete up to a redshift of z = 0.6 for Fornax-like and richer clusters and to z ~ 0.3 for poorer clusters. Based on the g-, r-, and i-band photometric catalogs of the Terapix T05 release, 35 clusters/deg2 are detected, with 1-2 Fornax-like or richer clusters every 2 deg2. Catalogs containing data for 6144 galaxy clusters have been prepared, of which 239 are rich clusters. These clusters, especially the latter, are being searched for gravitational lenses—one of our chief motivations for cluster detection in CFHTLS. The K2 method can be easily extended to use additional color information and thus improve overall cluster detection to higher redshifts. The complete set of K2 cluster catalogs, along with the supplementary catalogs for the member galaxies, are available on request from the authors.

  12. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  13. Binary populations in Milky Way satellite galaxies: Constraints from multi-epoch data in the Carina, Fornax, Sculptor, and Sextans dwarf spheroidal galaxies

    Energy Technology Data Exchange (ETDEWEB)

    Minor, Quinn E. [Department of Science, Borough of Manhattan Community College, City University of New York, New York, NY 10007 (United States); Department of Astrophysics, American Museum of Natural History, New York, NY 10024 (United States)

    2013-12-20

    We introduce a likelihood analysis of multi-epoch stellar line-of-sight velocities to constrain the binary fractions and binary period distributions of dwarf spheroidal galaxies. This method is applied to multi-epoch data from the Magellan/MMFS survey of the Carina, Fornax, Sculptor, and Sextans dSph galaxies, after applying a model for the measurement errors that accounts for binary orbital motion. We find that the Fornax, Sculptor, and Sextans dSphs are consistent with having binary populations similar to that of Milky Way field binaries to within 68% confidence limits, whereas the Carina dSph is remarkably deficient in binaries with periods less than ∼10 yr. If Carina is assumed to have a period distribution identical to that of the Milky Way field, its best-fit binary fraction is 0.14{sub −0.05}{sup +0.28}, and is constrained to be less than 0.5 at the 90% confidence level; thus it is unlikely to host a binary population identical to that of the Milky Way field. By contrast, the best-fit binary fraction of the combined sample of all four galaxies is 0.46{sub −0.09}{sup +0.13}, consistent with that of Milky Way field binaries. More generally, we infer probability distributions in binary fraction, mean orbital period, and dispersion of periods for each galaxy in the sample. Looking ahead to future surveys, we show that the allowed parameter space of binary fraction and period distribution parameters in dSphs will be narrowed significantly by a large multi-epoch survey. However, there is a degeneracy between the parameters that is unlikely to be broken unless the measurement error is of order ∼0.1 km s{sup –1} or smaller, presently attainable only by a high-resolution spectrograph.

  14. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  15. Massive Star Clusters in Dwarf Galaxies

    CERN Document Server

    Larsen, Soeren S

    2015-01-01

    Dwarf galaxies can have very high globular cluster specific frequencies, and the GCs are in general significantly more metal-poor than the bulk of the field stars. In some dwarfs, such as Fornax, WLM, and IKN, the fraction of metal-poor stars that belong to GCs can be as high as 20%-25%, an order of magnitude higher than the 1%-2% typical of GCs in halos of larger galaxies. Given that chemical abundance anomalies appear to be present also in GCs in dwarf galaxies, this implies severe difficulties for self-enrichment scenarios that require GCs to have lost a large fraction of their initial masses. More generally, the number of metal-poor field stars in these galaxies is today less than what would originally have been present in the form of low-mass clusters if the initial cluster mass function was a power-law extending down to low masses. This may imply that the initial GC mass function in these dwarf galaxies was significantly more top-heavy than typically observed in present-day star forming environments.

  16. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  17. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  18. The globular cluster system of NGC 1399. V. dynamics of the cluster system out to 80 kpc

    Science.gov (United States)

    Schuberth, Y.; Richtler, T.; Hilker, M.; Dirsch, B.; Bassino, L. P.; Romanowsky, A. J.; Infante, L.

    2010-04-01

    Globular clusters (GCs) are tracers of the gravitational potential of their host galaxies. Moreover, their kinematic properties may provide clues for understanding the formation of GC systems and their host galaxies. We use the largest set of GC velocities obtained so far of any elliptical galaxy to revise and extend the previous investigations (Richtler et al. 2004) of the dynamics of NGC 1399, the central dominant galaxy of the nearby Fornax cluster of galaxies. The GC velocities are used to study the kinematics, their relation with population properties, and the dark matter halo of NGC 1399. We have obtained 477 new medium-resolution spectra (of these, 292 are spectra from 265 individual GCs, 241 of which are not in the previous data set). with the VLT FORS 2 and Gemini South GMOS multi-object spectrographs. We revise velocities for the old spectra and measure velocities for the new spectra, using the same templates to obtain an homogeneously treated data set. Our entire sample now comprises velocities for almost 700 GCs with projected galactocentric radii between 6 and 100 kpc. In addition, we use velocities of GCs at larger distances published elsewhere. Combining the kinematic data with wide-field photometric Washington data, we study the kinematics of the metal-poor and metal-rich subpopulations. We discuss in detail the velocity dispersions of subsamples and perform spherical Jeans modelling. The most important results are: the red GCs resemble the stellar field population of NGC 1399 in the region of overlap. The blue GCs behave kinematically more erratic. Both subpopulations are kinematically distinct and do not show a smooth transition. It is not possible to find a common dark halo which reproduces simultaneously the properties of both red and blue GCs. Some velocities of blue GCs are only to be explained by orbits with very large apogalactic distances, thus indicating a contamination with GCs which belong to the entire Fornax cluster rather than to NGC

  19. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  20. From Beamline to Scanner with 225Ac

    Science.gov (United States)

    Robertson, Andrew K. H.; Ramogida, Caterina F.; Kunz, Peter; Rodriguez-Rodriguez, Cristina; Schaffer, Paul; Sossi, Vesna

    2016-09-01

    Due to the high linear energy transfer and short range of alpha-radiation, targeted radiation therapy using alpha-emitting pharmaceuticals that successfully target small disease clusters will kill target cells with limited harm to healthy tissue, potentially treating the most aggressive forms of cancer. As the parent of a decay chain with four alpha- and two beta-decays, 225Ac is a promising candidate for such a treatment. However, this requires retention of the entire decay chain at the target site, preventing the creation of freely circulating alpha-emitters that reduce therapeutic effect and increase toxicity to non-target tissues. Two major challenges to 225Ac pharmaceutical development exist: insufficient global supply, and the difficulty of preventing toxicity by retaining the entire decay chain at the target site. While TRIUMF works towards large-scale (C i amounts) production of 225Ac, we already use our Isotope Separation On-Line facility to provide small (overview of this research program and the journey of 225Ac from the beamline to the scanner. This research is funded by the Natural Sciences and Engineering Research Council of Canada.

  1. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  2. Globular Cluster Abundances from High-Resolution, Integrated-Light Spectroscopy. II. Expanding the Metallicity Range for Old Clusters and Updated Analysis Techniques

    CERN Document Server

    Colucci, J E; McWilliam, A

    2016-01-01

    We present abundances of globular clusters in the Milky Way and Fornax from integrated light spectra. Our goal is to evaluate the consistency of the integrated light analysis relative to standard abundance analysis for individual stars in those same clusters. This sample includes an updated analysis of 7 clusters from our previous publications and results for 5 new clusters that expand the metallicity range over which our technique has been tested. We find that the [Fe/H] measured from integrated light spectra agrees to $\\sim$0.1 dex for globular clusters with metallicities as high as [Fe/H]=$-0.3$, but the abundances measured for more metal rich clusters may be underestimated. In addition we systematically evaluate the accuracy of abundance ratios, [X/Fe], for Na I, Mg I, Al I, Si I, Ca I, Ti I, Ti II, Sc II, V I, Cr I, Mn I, Co I, Ni I, Cu I, Y II, Zr I, Ba II, La II, Nd II, and Eu II. The elements for which the integrated light analysis gives results that are most similar to analysis of individual stellar ...

  3. Featured Image: A Galaxy Plunges Into a Cluster Core

    Science.gov (United States)

    Kohler, Susanna

    2015-10-01

    The galaxy that takes up most of the frame in this stunning image (click for the full view!) is NGC 1427A. This is a dwarf irregular galaxy (unlike the fortuitously-located background spiral galaxy in the lower right corner of the image), and its currently in the process of plunging into the center of the Fornax galaxy cluster. Marcelo Mora (Pontifical Catholic University of Chile) and collaborators have analyzed observations of this galaxy made by both the Very Large Telescope in Chile and the Hubble Advanced Camera for Surveys, which produced the image shown here as a color composite in three channels. The team worked to characterize the clusters of star formation within NGC 1427A identifiable in the image as bright knots within the galaxy and determine how the interactions of this galaxy with its cluster environment affect the star formation within it. For more information and the original image, see the paper below.Citation:Marcelo D. Mora et al 2015 AJ 150 93. doi:10.1088/0004-6256/150/3/93

  4. The globular cluster system of NGC1316. III. Kinematic complexity

    CERN Document Server

    Richtler, Tom; Kumar, Brijesh; Bassino, Lilia P; Gomez, Matias; Dirsch, Boris

    2014-01-01

    The merger remnant NGC 1316 (Fornax A) is one of the most important objects regarding the investigation of merger-related processes. We use kinematical data of globular clusters (GCs) and the diffuse stellar light to investigate the global structure of NGC 1316 and to constrain the dark matter content. We perform multi-object-spectroscopy with VLT/FORS2 and MXU. Out of 562 slits, we extract radial velocities for 177 GCs. Moreover, we measure radial velocities of the integrated galaxy light, using slits with a sufficiently bright "sky". To these data, we add 20 cluster velocities from Goudfrooij et al. (2001). In an appendix, we identify new morphological features of NGC 1316 and its companion galaxy NGC 1317. The GC sample based on radial velocities confirms the colour peaks already found in our photometric study. The bright clusters, which probably have their origin in a 2 Gyr-old starburst and younger star formation events, avoid the systemic velocity. A Gaussian velocity distribution is found only for clus...

  5. Cluster headache

    Science.gov (United States)

    Histamine headache; Headache - histamine; Migrainous neuralgia; Headache - cluster; Horton's headache; Vascular headache - cluster ... A cluster headache begins as a severe, sudden headache. The headache commonly strikes 2 to 3 hours after you fall ...

  6. Cluster Forests

    CERN Document Server

    Yan, Donghui; Jordan, Michael I

    2011-01-01

    Inspired by Random Forests (RF) in the context of classification, we propose a new clustering ensemble method---Cluster Forests (CF). Geometrically, CF randomly probes a high-dimensional data cloud to obtain "good local clusterings" and then aggregates via spectral clustering to obtain cluster assignments for the whole dataset. The search for good local clusterings is guided by a cluster quality measure $\\kappa$. CF progressively improves each local clustering in a fashion that resembles the tree growth in RF. Empirical studies on several real-world datasets under two different performance metrics show that CF compares favorably to its competitors. Theoretical analysis shows that the $\\kappa$ criterion is shown to grow each local clustering in a desirable way---it is "noise-resistant." A closed-form expression is obtained for the mis-clustering rate of spectral clustering under a perturbation model, which yields new insights into some aspects of spectral clustering.

  7. Star Clusters

    OpenAIRE

    Gieles, M.

    1993-01-01

    Star clusters are observed in almost every galaxy. In this thesis we address several fundamental problems concerning the formation, evolution and disruption of star clusters. From observations of (young) star clusters in the interacting galaxy M51, we found that clusters are formed in complexes of stars and star clusters. These complexes share similar properties with giant molecular clouds, from which they are formed. Many (70%) of the young clusters will not survive the fist 10 Myr, due to t...

  8. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  9. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  10. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  11. The globular cluster system of NGC 1399 V. dynamics of the cluster system out to 80 kpc

    CERN Document Server

    Schuberth, Y; Hilker, M; Dirsch, B; Bassino, L P; Romanowsky, A J; Infante, L

    2009-01-01

    (Abridged) We use the largest set of globular cluster velocities obtained so far of any elliptical galaxy to revise and extend the previous investigations of the dynamics of NGC 1399, the central dominant galaxy of the nearby Fornax cluster of galaxies. Our sample now comprises velocities for almost 700 GCs with projected galactocentric radii between 6 and 100 kpc. In addition, we use velocities published by Bergond et al. (2007). We study the kinematics of the metal-poor and metal-rich subpopulations and perform spherical Jeans modelling. The most important results are: The metal-rich (red) GCs resemble the stellar field population of NGC 1399 in the region of overlap. Both subpopulations are kinematically distinct and do not show a smooth transition. It is not possible to find a common dark halo which reproduces simultaneously the properties of both subpopulations. Some velocities of blue GCs are only to be explained by orbits with very large apogalactic distances, thus indicating a contamination with GCs w...

  12. Globular cluster clustering and tidal features around ultra compact dwarf galaxies in the halo of NGC1399

    CERN Document Server

    Voggel, Karina; Richtler, Tom

    2015-01-01

    We present a novel approach to constrain the formation channels of Ultra-Compact Dwarf Galaxies (UCDs). This inhomogeneous class of objects of remnants of tidally stripped dwarf elliptical galaxies and high mass globular clusters. We use three methods to unravel their nature: 1) we analysed their surface brightness profiles, 2) we carried out a direct search for tidal features around UCDs and 3) we compared the spatial distribution of GCs and UCDs in the halo of their host galaxy. Based on FORS2 observations, we have studied the detailed structural composition of a large sample of 97 UCDs in the halo of NGC1399, the central galaxy of the Fornax cluster, by analysing theirsurface brightness profiles. We derived the structural parameters of 13 extended UCDs modelling them with a single Sersic function and decomposing them into composite King and Sersic profiles. We find evidence for faint stellar envelopes at mu=~26 mag\\arcsec^-2 surrounding the UCDs up to an extension of 90pc in radius. We also show new eviden...

  13. Chemical composition and constraints on mass loss for globular clusters in dwarf galaxies: WLM and IKN

    Science.gov (United States)

    Larsen, Søren S.; Brodie, Jean P.; Forbes, Duncan A.; Strader, Jay

    2014-05-01

    Aims: We determine the metallicities of globular clusters (GCs) in the WLM and IKN dwarf galaxies, using VLT/UVES and Keck/ESI spectroscopy. These measurements are combined with literature data for field stars to constrain GC formation scenarios. For the WLM GC, we also measure detailed abundance ratios for a number of light, α, Fe-peak, and n-capture elements, which are compared with literature data for the Fornax dSph and the Milky Way. Methods: The abundances are derived by computing synthetic integrated-light model spectra and adjusting the input composition until the best fits to the observed spectra are obtained. Results: We find low metallicities of [Fe/H] = -2.0 and -2.1 for the WLM GC and the GC IKN-5, respectively. We estimate that 17%-31% of the stars with [Fe/H] ≤ -2 in WLM belong to the GC, and IKN-5 may even contain a similar number of metal-poor stars as the whole of the IKN dwarf itself. While these fractions are much higher than in the Milky Way halo, we have previously found a similarly high ratio of metal-poor GCs to field stars in the Fornax dSph. The overall abundance patterns in the WLM GC are similar to those observed for GCs in the Fornax dSph: the [Ca/Fe] and [Ti/Fe] ratios are super-Solar at about +0.3 dex, while [Mg/Fe] is less elevated than [Ca/Fe] and [Ti/Fe]. The [Na/Fe] ratio is similar to the averaged [Na/Fe] ratios in Milky Way GCs, but higher (by ~2σ) than those of Milky Way halo stars. Iron-peak (Mn, Sc, Cr) and heavy elements (Ba, Y, La) generally follow the trends seen in the Milky Way halo. Conclusions: The GCs in the WLM and IKN dwarf galaxies resemble those in the Fornax dSph by being significantly more metal-poor than a typical halo GC in the Milky Way and other large galaxies. They are also substantially more metal-poor than the bulk of the field stars in their parent galaxies. It appears that only a small fraction of the Milky Way GC system could have been accreted from galaxies similar to these dwarfs. The relatively

  14. Searching for star-forming dwarf galaxies in the Antlia cluster

    CERN Document Server

    Vaduvescu, O; Bassino, L P; Castelli, A V Smith; Calderon, J P

    2014-01-01

    The formation and evolution of dwarf galaxies in clusters need to be understood, and this requires large aperture telescopes. In this sense, we selected the Antlia cluster to continue our previous work in the Virgo, Fornax, and Hydra clusters and in the Local Volume (LV). Because of the scarce available literature data, we selected a small sample of five blue compact dwarf (BCD) candidates in Antlia for observation. Using the Gemini South and GMOS camera, we acquired the Halpha imaging needed to detect star-forming regions in this sample. With the long-slit spectroscopic data of the brightest seven knots detected in three BCD candidates, we derived their basic chemical properties. Using archival VISTA VHS survey images, we derived K_S magnitudes and surface brightness profile fits for the whole sample to assess basic physical properties. FS90-98, FS90-106, and FS90-147 are confirmed as BCDs and cluster members, based on their morphology, K_S surface photometry, oxygen abundance, and velocity redshift. FS90-15...

  15. Meaningful Clusters

    Energy Technology Data Exchange (ETDEWEB)

    Sanfilippo, Antonio P.; Calapristi, Augustin J.; Crow, Vernon L.; Hetzler, Elizabeth G.; Turner, Alan E.

    2004-05-26

    We present an approach to the disambiguation of cluster labels that capitalizes on the notion of semantic similarity to assign WordNet senses to cluster labels. The approach provides interesting insights on how document clustering can provide the basis for developing a novel approach to word sense disambiguation.

  16. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  17. Cascading failures in ac electricity grids

    Science.gov (United States)

    Rohden, Martin; Jung, Daniel; Tamrakar, Samyak; Kettemann, Stefan

    2016-09-01

    Sudden failure of a single transmission element in a power grid can induce a domino effect of cascading failures, which can lead to the isolation of a large number of consumers or even to the failure of the entire grid. Here we present results of the simulation of cascading failures in power grids, using an alternating current (AC) model. We first apply this model to a regular square grid topology. For a random placement of consumers and generators on the grid, the probability to find more than a certain number of unsupplied consumers decays as a power law and obeys a scaling law with respect to system size. Varying the transmitted power threshold above which a transmission line fails does not seem to change the power-law exponent q ≈1.6 . Furthermore, we study the influence of the placement of generators and consumers on the number of affected consumers and demonstrate that large clusters of generators and consumers are especially vulnerable to cascading failures. As a real-world topology, we consider the German high-voltage transmission grid. Applying the dynamic AC model and considering a random placement of consumers, we find that the probability to disconnect more than a certain number of consumers depends strongly on the threshold. For large thresholds the decay is clearly exponential, while for small ones the decay is slow, indicating a power-law decay.

  18. Weighted Clustering

    DEFF Research Database (Denmark)

    Ackerman, Margareta; Ben-David, Shai; Branzei, Simina

    2012-01-01

    We investigate a natural generalization of the classical clustering problem, considering clustering tasks in which different instances may have different weights.We conduct the first extensive theoretical analysis on the influence of weighted data on standard clustering algorithms in both...... the partitional and hierarchical settings, characterizing the conditions under which algorithms react to weights. Extending a recent framework for clustering algorithm selection, we propose intuitive properties that would allow users to choose between clustering algorithms in the weighted setting and classify...... algorithms accordingly....

  19. Cluster Lenses

    CERN Document Server

    Kneib, Jean-Paul; 10.1007/s00159-011-0047-3

    2012-01-01

    Clusters of galaxies are the most recently assembled, massive, bound structures in the Universe. As predicted by General Relativity, given their masses, clusters strongly deform space-time in their vicinity. Clusters act as some of the most powerful gravitational lenses in the Universe. Light rays traversing through clusters from distant sources are hence deflected, and the resulting images of these distant objects therefore appear distorted and magnified. Lensing by clusters occurs in two regimes, each with unique observational signatures. The strong lensing regime is characterized by effects readily seen by eye, namely, the production of giant arcs, multiple-images, and arclets. The weak lensing regime is characterized by small deformations in the shapes of background galaxies only detectable statistically. Cluster lenses have been exploited successfully to address several important current questions in cosmology: (i) the study of the lens(es) - understanding cluster mass distributions and issues pertaining...

  20. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  1. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  2. Data Clustering

    Science.gov (United States)

    Wagstaff, Kiri L.

    2012-03-01

    On obtaining a new data set, the researcher is immediately faced with the challenge of obtaining a high-level understanding from the observations. What does a typical item look like? What are the dominant trends? How many distinct groups are included in the data set, and how is each one characterized? Which observable values are common, and which rarely occur? Which items stand out as anomalies or outliers from the rest of the data? This challenge is exacerbated by the steady growth in data set size [11] as new instruments push into new frontiers of parameter space, via improvements in temporal, spatial, and spectral resolution, or by the desire to "fuse" observations from different modalities and instruments into a larger-picture understanding of the same underlying phenomenon. Data clustering algorithms provide a variety of solutions for this task. They can generate summaries, locate outliers, compress data, identify dense or sparse regions of feature space, and build data models. It is useful to note up front that "clusters" in this context refer to groups of items within some descriptive feature space, not (necessarily) to "galaxy clusters" which are dense regions in physical space. The goal of this chapter is to survey a variety of data clustering methods, with an eye toward their applicability to astronomical data analysis. In addition to improving the individual researcher’s understanding of a given data set, clustering has led directly to scientific advances, such as the discovery of new subclasses of stars [14] and gamma-ray bursts (GRBs) [38]. All clustering algorithms seek to identify groups within a data set that reflect some observed, quantifiable structure. Clustering is traditionally an unsupervised approach to data analysis, in the sense that it operates without any direct guidance about which items should be assigned to which clusters. There has been a recent trend in the clustering literature toward supporting semisupervised or constrained

  3. The star cluster system of the 3 Gyr old merger remnant NGC 1316 Clues from optical and near-infrared photometry

    CERN Document Server

    Goudfrooij, P; Maraston, C; Minniti, D; Goudfrooij, Paul; Maraston, Claudia; Minniti, Dante

    2001-01-01

    The giant merger remnant galaxy NGC 1316 (Fornax A) is an ideal probe for studying the long-term effects of a past major merger on star cluster systems, given its spectroscopically derived merger age of ~3 Gyr which we reported in a recent paper. Here we present new ground-based, large-area optical and near-IR imaging of star clusters in NGC 1316, complemented with deep HST/WFPC2 imaging. We find that the optical-near-IR colours and luminosities of the brightest ~10 clusters in NGC 1316 are consistent with those of intermediate-age (2-3 Gyr) populations. Unlike `normal' giant ellipticals, the B-I colour distribution of clusters in NGC 1316 is not clearly bimodal. However, the luminosity functions (LFs) of the blue and red parts of the cluster colour distribution are different: The red cluster LF is well represented by a power law with index -1.2 +/- 0.3, extending to about 1.5 mag brighter (in B) than those of typical giant ellipticals. In contrast, the shape of the blue cluster LF is consistent with that of ...

  4. Cluster Chemistry

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    @@ Cansisting of eight scientists from the State Key Laboratory of Physical Chemistry of Solid Surfaces and Xiamen University, this creative research group is devoted to the research of cluster chemistry and creation of nanomaterials.After three-year hard work, the group scored a series of encouraging progresses in synthesis of clusters with special structures, including novel fullerenes, fullerene-like metal cluster compounds as well as other related nanomaterials, and their properties study.

  5. Globular Cluster Abundances from High-resolution, Integrated-light Spectroscopy. II. Expanding the Metallicity Range for Old Clusters and Updated Analysis Techniques

    Science.gov (United States)

    Colucci, Janet E.; Bernstein, Rebecca A.; McWilliam, Andrew

    2017-01-01

    We present abundances of globular clusters (GCs) in the Milky Way and Fornax from integrated-light (IL) spectra. Our goal is to evaluate the consistency of the IL analysis relative to standard abundance analysis for individual stars in those same clusters. This sample includes an updated analysis of seven clusters from our previous publications and results for five new clusters that expand the metallicity range over which our technique has been tested. We find that the [Fe/H] measured from IL spectra agrees to ∼0.1 dex for GCs with metallicities as high as [Fe/H] = ‑0.3, but the abundances measured for more metal-rich clusters may be underestimated. In addition we systematically evaluate the accuracy of abundance ratios, [X/Fe], for Na i, Mg i, Al i, Si i, Ca i, Ti i, Ti ii, Sc ii, V i, Cr i, Mn i, Co i, Ni i, Cu i, Y ii, Zr i, Ba ii, La ii, Nd ii, and Eu ii. The elements for which the IL analysis gives results that are most similar to analysis of individual stellar spectra are Fe i, Ca i, Si i, Ni i, and Ba ii. The elements that show the greatest differences include Mg i and Zr i. Some elements show good agreement only over a limited range in metallicity. More stellar abundance data in these clusters would enable more complete evaluation of the IL results for other important elements. This paper includes data gathered with the 6.5 m Magellan Telescopes located at Las Campanas Observatory, Chile.

  6. Carbon in Red Giants in Globular Clusters and Dwarf Spheroidal Galaxies

    CERN Document Server

    Kirby, Evan N; Zhang, Andrew J; Deng, Michelle; Cohen, Judith G; Guhathakurta, Puragra; Shetrone, Matthew D; Lee, Young Sun; Rizzi, Luca

    2015-01-01

    We present carbon abundances of red giants in Milky Way globular clusters and dwarf spheroidal galaxies (dSphs). Our sample includes measurements of carbon abundances for 154 giants in the clusters NGC 2419, M68, and M15 and 398 giants in the dSphs Sculptor, Fornax, Ursa Minor, and Draco. This sample doubles the number of dSph stars with measurements of [C/Fe]. The [C/Fe] ratio in the clusters decreases with increasing luminosity above log(L/L_sun) ~= 1.6, which can be explained by deep mixing in evolved giants. The same decrease is observed in dSphs, but the initial [C/Fe] of the dSph giants is not uniform. Stars in dSphs at lower metallicities have larger [C/Fe] ratios. We hypothesize that [C/Fe] (corrected to the initial carbon abundance) declines with increasing [Fe/H] due to the metallicity dependence of the carbon yield of asymptotic giant branch stars and due to the increasing importance of Type Ia supernovae at higher metallicities. We also identified 11 very carbon-rich giants (8 previously known) in...

  7. Clustered regression with unknown clusters

    CERN Document Server

    Barman, Kishor

    2011-01-01

    We consider a collection of prediction experiments, which are clustered in the sense that groups of experiments ex- hibit similar relationship between the predictor and response variables. The experiment clusters as well as the regres- sion relationships are unknown. The regression relation- ships define the experiment clusters, and in general, the predictor and response variables may not exhibit any clus- tering. We call this prediction problem clustered regres- sion with unknown clusters (CRUC) and in this paper we focus on linear regression. We study and compare several methods for CRUC, demonstrate their applicability to the Yahoo Learning-to-rank Challenge (YLRC) dataset, and in- vestigate an associated mathematical model. CRUC is at the crossroads of many prior works and we study several prediction algorithms with diverse origins: an adaptation of the expectation-maximization algorithm, an approach in- spired by K-means clustering, the singular value threshold- ing approach to matrix rank minimization u...

  8. Subspace clustering through attribute clustering

    Institute of Scientific and Technical Information of China (English)

    Kun NIU; Shubo ZHANG; Junliang CHEN

    2008-01-01

    Many recently proposed subspace clustering methods suffer from two severe problems. First, the algorithms typically scale exponentially with the data dimensionality or the subspace dimensionality of clusters. Second, the clustering results are often sensitive to input parameters. In this paper, a fast algorithm of subspace clustering using attribute clustering is proposed to over-come these limitations. This algorithm first filters out redundant attributes by computing the Gini coefficient. To evaluate the correlation of every two non-redundant attributes, the relation matrix of non-redundant attributes is constructed based on the relation function of two dimensional united Gini coefficients. After applying an overlapping clustering algorithm on the relation matrix, the candidate of all interesting subspaces is achieved. Finally, all subspace clusters can be derived by clustering on interesting subspaces. Experiments on both synthesis and real datasets show that the new algorithm not only achieves a significant gain of runtime and quality to find subspace clusters, but also is insensitive to input parameters.

  9. Role of Cluster Deformations on Their Preformation Probabilities in Radioactive Cluster-Decay Studies

    Science.gov (United States)

    Săndulescu, Aurel; Gupta, Raj K.; Greiner, Walter; Carstoiu, Florin; Horoi, Mihai

    The folded Michigan — 3-Yukawa (M3Y) potential is used for the first time for calculating the WKB penetration probabilities, with deformation effects of the emitted clusters also included for the first time. For the clusters to be spheres, our calculations of the (empirical) performation probabilities P0 show that, depending rather sensitively on the choice of nuclear potential, P0 decreases with mass Ac of the emitted cluster, as is the case for other two model calculations of Blendowske-Walliser and Malik-Gupta. The deformation effects of the emitted clusters are shown to reduce the performation probabilities by an order of magnitude 103, which invalidates the simple straight line formula between — log10 P0 and Ac.

  10. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  11. AC410 Unit 9 Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

     AC410 Unit 9 Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-9-assignment/   18–29. The CPA firm of Carson & Boggs LLP is performing an internal control audit in accordance with PCAOB Standard No. 5. The partner in charge of the engagement has asked you to explain the process of determining which controls to test. Describe the process, presenting each of the links in this process and a short summary of how the auditors approach each of them. v ...

  12. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  13. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  14. AcEST: BP917259 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens... 30 9.0 sp|O88737|BSN_MOUSE Protein bassoon ... WGQPG AAGS + PG Sbjct: 748 SSSPTEWVKWSWGQPG-------AAGSRAPPG 772 >sp|O88737|BSN_MOUSE Protein bassoon

  15. AcEST: BP921446 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 2e-30 tr|A4VIU1|A4VIU1_PSEU5 Putative uncharacterized protein OS=Pseud... 129 1e-28 tr|Q11HF6|Q11HF6_MESSB...EHTHLMLDSKAGWVEPHIQAGDRCFAEYPDESLAQWHERLGL 159 >tr|Q11HF6|Q11HF6_MESSB Glutathione-dependent formaldehyde-ac

  16. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  17. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  18. AcEST: DK953266 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 0.49 sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ov... 34 0.49 sp|Q8YJ48|ACSA_BRUME Ac... K++ + NK L+ R G WG GR++ Sbjct: 180 FVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDL 235 >sp|A5VSF3|ACSA_BRUO2

  19. The Hubble Space Telescope advanced camera for surveys coma cluster survey. I. Survey objectives and design

    NARCIS (Netherlands)

    Carter, David; Goudfrooij, Paul; Mobasher, Bahram; Ferguson, Henry C.; Puzia, Thomas H.; Aguerri, Alfonso L.; Balcells, Marc; Batcheldor, Dan; Bridges, Terry J.; Davies, Jonathan I.; Erwin, Peter; Graham, Alister W.; Guzmán, Rafael; Hammer, Derek; Hornschemeier, Ann; Hoyos, Carlos; Hudson, Michael J.; Huxor, Avon; Jogee, Shardha; Komiyama, Yutaka; Lotz, Jennifer; Lucey, John R.; Marzke, Ronald O.; Merritt, David; Miller, Bryan W.; Miller, Neal A.; Mouhcine, Mustapha; Okamura, Sadanori; Peletier, Reynier F.; Phillipps, Steven; Poggianti, Bianca M.; Sharples, Ray M.; Smith, Russell J.; Trentham, Neil; Tully, R. Brent; Valentijn, Edwin; Verdoes Kleijn, Gijs

    2008-01-01

    We describe the HST ACS Coma Cluster Treasury survey, a deep two-passband imaging survey of one of the nearest rich clusters of galaxies, the Coma Cluster (Abell 1656). The survey was designed to cover an area of 740 arcmin2 in regions of different density of both galaxies and intergalactic medium w

  20. Distribution of star formation rates during the rapid assembly of NGC 1399 as deduced from its globular cluster system

    CERN Document Server

    Schulz, C; Kroupa, P; Pflamm-Altenburg, J

    2016-01-01

    Ultra-compact dwarf galaxies (UCDs) share many properties with globular clusters (GCs) and are found in similar environments. A large sample of UCDs and GCs around NGC 1399, the central giant elliptical of the Fornax galaxy cluster, is used to infer their formation history and also that of NGC 1399. We assumed that all GCs and UCDs in our sample are star clusters (SCs) and used them as tracers of past star formation activities. After correcting our GC/UCD sample for mass loss, we interpreted their overall mass function to be a superposition of SC populations that formed coevally during different times. The SC masses of each population were distributed according to the embedded cluster mass function (ECMF), a pure power law with the slope $-\\beta$ and a stellar upper mass limit, $M_{\\mathrm{max}}$, which depended on the star formation rate (SFR). We decomposed the observed GC/UCD mass function into individual SC populations and converted $M_{\\mathrm{max}}$ of each SC population to an SFR. The overall distribut...

  1. Deriving physical parameters of unresolved star clusters III. Application to M31 PHAT clusters

    CERN Document Server

    de Meulenaer, Philippe; Mineikis, Tadas; Vansevičius, Vladas

    2015-01-01

    This study is the third of a series that investigates the degeneracy and stochasticity problems present in the determination of physical parameters such as age, mass, extinction, and metallicity of partially resolved or unresolved star cluster populations situated in external galaxies when using broad-band photometry. This work tests the derivation of parameters of artificial star clusters using models with fixed and free metallicity for the WFC3+ACS photometric system. Then the method is applied to derive parameters of a sample of 203 star clusters in the Andromeda galaxy observed with the HST. Following Papers I \\& II, the star cluster parameters are derived using a large grid of stochastic models that are compared to the observed cluster broad-band integrated WFC3+ACS magnitudes. We derive the age, mass, and extinction of the sample of M31 star clusters with one fixed metallicity in agreement with previous studies. Using artificial tests we demonstrate the ability of the WFC3+ACS photometric system to ...

  2. Cluster editing

    DEFF Research Database (Denmark)

    Böcker, S.; Baumbach, Jan

    2013-01-01

    . The problem has been the inspiration for numerous algorithms in bioinformatics, aiming at clustering entities such as genes, proteins, phenotypes, or patients. In this paper, we review exact and heuristic methods that have been proposed for the Cluster Editing problem, and also applications......The Cluster Editing problem asks to transform a graph into a disjoint union of cliques using a minimum number of edge modifications. Although the problem has been proven NP-complete several times, it has nevertheless attracted much research both from the theoretical and the applied side...

  3. Cluster analysis

    CERN Document Server

    Everitt, Brian S; Leese, Morven; Stahl, Daniel

    2011-01-01

    Cluster analysis comprises a range of methods for classifying multivariate data into subgroups. By organizing multivariate data into such subgroups, clustering can help reveal the characteristics of any structure or patterns present. These techniques have proven useful in a wide range of areas such as medicine, psychology, market research and bioinformatics.This fifth edition of the highly successful Cluster Analysis includes coverage of the latest developments in the field and a new chapter dealing with finite mixture models for structured data.Real life examples are used throughout to demons

  4. Weighted Clustering

    CERN Document Server

    Ackerman, Margareta; Branzei, Simina; Loker, David

    2011-01-01

    In this paper we investigate clustering in the weighted setting, in which every data point is assigned a real valued weight. We conduct a theoretical analysis on the influence of weighted data on standard clustering algorithms in each of the partitional and hierarchical settings, characterising the precise conditions under which such algorithms react to weights, and classifying clustering methods into three broad categories: weight-responsive, weight-considering, and weight-robust. Our analysis raises several interesting questions and can be directly mapped to the classical unweighted setting.

  5. Globular Cluster Systems in Brightest Cluster Galaxies. III: Beyond Bimodality

    Science.gov (United States)

    Harris, William E.; Ciccone, Stephanie M.; Eadie, Gwendolyn M.; Gnedin, Oleg Y.; Geisler, Douglas; Rothberg, Barry; Bailin, Jeremy

    2017-01-01

    We present new deep photometry of the rich globular cluster (GC) systems around the Brightest Cluster Galaxies UGC 9799 (Abell 2052) and UGC 10143 (Abell 2147), obtained with the Hubble Space Telescope (HST) ACS and WFC3 cameras. For comparison, we also present new reductions of similar HST/ACS data for the Coma supergiants NGC 4874 and 4889. All four of these galaxies have huge cluster populations (to the radial limits of our data, comprising from 12,000 to 23,000 clusters per galaxy). The metallicity distribution functions (MDFs) of the GCs can still be matched by a bimodal-Gaussian form where the metal-rich and metal-poor modes are separated by ≃ 0.8 dex, but the internal dispersions of each mode are so large that the total MDF becomes very broad and nearly continuous from [Fe/H] ≃ ‑2.4 to solar. There are, however, significant differences between galaxies in the relative numbers of metal-rich clusters, suggesting that they underwent significantly different histories of mergers with massive gas-rich halos. Last, the proportion of metal-poor GCs rises especially rapidly outside projected radii R≳ 4 {R}{eff}, suggesting the importance of accreted dwarf satellites in the outer halo. Comprehensive models for the formation of GCs as part of the hierarchical formation of their parent galaxies will be needed to trace the systematic change in structure of the MDF with galaxy mass, from the distinctly bimodal form in smaller galaxies up to the broad continuum that we see in the very largest systems.

  6. ACS from development to operations

    Science.gov (United States)

    Caproni, Alessandro; Colomer, Pau; Jeram, Bogdan; Sommer, Heiko; Chiozzi, Gianluca; Mañas, Miguel M.

    2016-08-01

    The ALMA Common Software (ACS), provides the infrastructure of the distributed software system of ALMA and other projects. ACS, built on top of CORBA and Data Distribution Service (DDS) middleware, is based on a Component- Container paradigm and hides the complexity of the middleware allowing the developer to focus on domain specific issues. The transition of the ALMA observatory from construction to operations brings with it that ACS effort focuses primarily on scalability, stability and robustness rather than on new features. The transition came together with a shorter release cycle and a more extensive testing. For scalability, the most problematic area has been the CORBA notification service, used to implement the publisher subscriber pattern because of the asynchronous nature of the paradigm: a lot of effort has been spent to improve its stability and recovery from run time errors. The original bulk data mechanism, implemented using the CORBA Audio/Video Streaming Service, showed its limitations and has been replaced with a more performant and scalable DDS implementation. Operational needs showed soon the difference between releases cycles for Online software (i.e. used during observations) and Offline software, which requires much more frequent releases. This paper attempts to describe the impact the transition from construction to operations had on ACS, the solution adopted so far and a look into future evolution.

  7. Genome Sequence of the Mycorrhiza Helper Bacterium Streptomyces sp. Strain AcH 505.

    Science.gov (United States)

    Tarkka, M T; Feldhahn, L; Buscot, F; Wubet, T

    2015-04-02

    A draft genome sequence of Streptomyces sp. strain AcH 505 is presented here. The genome encodes 22 secondary metabolite gene clusters and a large arsenal of secreted proteins, and their comparative and functional analyses will help to advance our knowledge of symbiotic interactions and fungal and plant biomass degradation.

  8. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nin T, cardiac muscle OS=Homo sapiens... 35 0.27 sp|P98193|DMP1_RAT Dentin matrix...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac...EEDAEAEAETEETRAEEDEEEEEAKEAEDG 68 Query: 329 PADQETP 349 P ++ P Sbjct: 69 PMEESKP 75 >sp|P98193|DMP1_RAT Dentin

  9. AcEST: DK956827 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n, cytoplasmic 1 OS=Salmo salar GN=AC... 389 e-107 tr|B3TH90|B3TH90_POERE Beta-actin OS=Poecilia reticulata ...PE=2 SV=1 389 e-107 tr|B3TH89|B3TH89_POERE Beta-actin OS=Poecilia reticulata PE=4 SV=1 389 e-107 tr|B3GLI4|B

  10. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  11. The complex nature of the nuclear star cluster in FCC 277

    CERN Document Server

    Lyubenova, Mariya; Cote, Patrick; Kuntschner, Harald; van de Ven, Glenn; Ferrarese, Laura; Jordan, Andres; Infante, Leopoldo

    2013-01-01

    Recent observations have shown that compact nuclear star clusters (NSCs) are present in up to 80% of galaxies. However, detailed studies of their dynamical and chemical properties are confined mainly to spiral galaxy hosts, where they are more easily observed. In this paper we present our study of the NSC in FCC 277, a nucleated elliptical galaxy in the Fornax cluster. We use a combination of adaptive optics assisted near-infrared integral field spectroscopy, Hubble Space Telescope imaging, and literature long slit data. We show that while the NSC does not appear to rotate within our detection limit of ~6 km/s, rotation is detected at larger radii, where the isophotes appear to be disky, suggesting the presence of a nuclear disk. We also observe a distinct central velocity dispersion drop that is indicative of a dynamically cold rotating sub-system. Following the results of orbit-based dynamical modelling, co-rotating as well as counter-rotating stellar orbits are simultaneously needed to reproduce the observ...

  12. Globular clusters kinematics and dynamical models of the massive early-type galaxy NGC 1399

    Science.gov (United States)

    Samurović, S.

    2016-06-01

    We analyze the dynamical models of the massive early-type galaxy NGC 1399, the central galaxy of the Fornax cluster. We use the sample of 790 globular clusters as tracers of gravitational potential and we first extract the kinematics, which is then dynamically modeled. We find that the velocity dispersion remains high and approximately constant throughout the whole galaxy and that the departures from the Gaussian distribution of the orbits are not large. We use the spherical Jeans equation in both Newtonian and MOND approaches, assuming three cases of orbital anisotropies: we study isotropic, tangentially and radially anisotropic models in order to establish the best-fitting values of the mass-to-light ratios. We found that in the Newtonian approximation a significant amount of dark matter is needed and that Navarro-Frenk-White (NFW) model with a dark halo provides a satisfactory description of the kinematics of NGC 1399. We tested three MOND models (standard, simple and toy) and found that none of them can provide a fit of the velocity dispersion profile without the inclusion of dark matter. Finally, using our findings, we placed the galaxy NGC 1399 within the context of other observed early-type galaxies and discuss its location among them.

  13. AcEST: DK948573 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 30 5e-59 tr|B8R1J5|B8R1J5_EUCGR Iron-sulfer cluster scaffold protein ISU1... 230 7e-59 tr|A9NS42|A9NS42_PICS...AK 146 >tr|B8R1J5|B8R1J5_EUCGR Iron-sulfer cluster scaffold protein ISU1 OS=Eucalyptus grandis GN=ISU1 PE=2

  14. The Look-back Time Evolution of Far-Ultraviolet Flux from the Brightest Cluster Elliptical Galaxies at z < 0.2

    CERN Document Server

    Ree, C H; Yi, S K; Yoon, S J; Rich, R M; Deharveng, J M; Sohn, Y J; Kaviraj, S; Rhee, J; Sheen, Y K; Schawinski, K; Rey, S C; Boselli, A; Donas, J; Seibert, M; Wyder, T K; Barlow, T A; Bianchi, L; Forster, K; Friedman, P G; Heckman, T M; Madore, B F; Martin, D C; Milliard, B; Morrissey, P; Neff, S G; Schiminovich, D; Small, T; Szalay, A S; Welsh, B Y; Ree, Chang H.; Lee, Young-Wook; Yi, Sukyoung K.; Yoon, Suk-Jin; Deharveng, Jean-Michel; Sohn, Young-Jong; Kaviraj, Sugata; Rhee, Jonghwan; Sheen, Yun-Kyeong; Schawinski, Kevin; Rey, Soo-Chang; Boselli, Alessandro; Rhee, Jaehyon; Donas, Jose; Seibert, Mark; Wyder, Ted K.; Barlow, Tom A.; Bianchi, Luciana; Forster, Karl; Friedman, Peter G.; Heckman, Timothy M.; Madore, Barry F.; Milliard, Bruno; Morrissey, Patrick; Neff, Susan G.; Schiminovich, David; Small, Todd; Szalay, Alex S.; Welsh, Barry Y.

    2007-01-01

    We present the GALEX UV photometry of the elliptical galaxies in Abell clusters at moderate redshifts (z < 0.2) for the study of the look-back time evolution of the UV upturn phenomenon. The brightest elliptical galaxies (M_r < -22) in 12 remote clusters are compared with the nearby giant elliptical galaxies of comparable optical luminosity in the Fornax and Virgo clusters. The sample galaxies presented here appear to be quiescent without signs of massive star formation or strong nuclear activity, and show smooth, extended profiles in their UV images indicating that the far-UV (FUV) light is mostly produced by hot stars in the underlying old stellar population. Compared to their counterparts in nearby clusters, the FUV flux of cluster giant elliptical galaxies at moderate redshifts fades rapidly with ~ 2 Gyrs of look-back time, and the observed pace in FUV - V color evolution agrees reasonably well with the prediction from the population synthesis models where the dominant FUV source is hot horizontal-b...

  15. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  16. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  17. Fuzzy Clustering

    DEFF Research Database (Denmark)

    Berks, G.; Keyserlingk, Diedrich Graf von; Jantzen, Jan;

    2000-01-01

    and clustering are the basic concerns in medicine. Classification depends on definitions of the classes and their required degree of participant of the elements in the cases' symptoms. In medicine imprecise conditions are the rule and therefore fuzzy methods are much more suitable than crisp ones. Fuzzy c....... A symptom may belong to more than one class. For instance to the class of very severe disease and to the class of failure of awareness of the own disturbance. The description of language failures by c-mean classification of analyzed factors correspond in many but not in all cases to the traditional......-mean clustering is an easy and well improved tool, which has been applied in many medical fields. We used c-mean fuzzy clustering after feature extraction from an aphasia database. Factor analysis was applied on a correlation matrix of 26 symptoms of language disorders and led to five factors. The factors...

  18. Deep Chandra Observations of NGC 1404: Cluster Plasma Physics Revealed by an Infalling Early-type Galaxy

    Science.gov (United States)

    Su, Yuanyuan; Kraft, Ralph P.; Roediger, Elke; Nulsen, Paul; Forman, William R.; Churazov, Eugene; Randall, Scott W.; Jones, Christine; Machacek, Marie E.

    2017-01-01

    The intracluster medium (ICM), as a magnetized and highly ionized fluid, provides an ideal laboratory to study plasma physics under extreme conditions that cannot be achieved on Earth. NGC 1404 is a bright elliptical galaxy that is being gas stripped as it falls through the ICM of the Fornax Cluster. We use the new Chandra X-ray observations of NGC 1404 to study ICM microphysics. The interstellar medium of NGC 1404 is characterized by a sharp leading edge, 8 kpc from the Galaxy center, and a short downstream gaseous tail. Contact discontinuities are resolved on unprecedented spatial scales (0.″5 = 45 pc) due to the combination of the proximity of NGC 1404, the superb spatial resolution of Chandra, and the very deep (670 ks) exposure. At the leading edge, we observe sub-kiloparsec-scale eddies generated by Kelvin–Helmholtz instability (KHI) and put an upper limit of 5% Spitzer on the isotropic viscosity of the hot cluster plasma. We also observe mixing between the hot cluster gas and the cooler galaxy gas in the downstream stripped tail, which provides further evidence of a low viscosity plasma. The assumed ordered magnetic fields in the ICM ought to be smaller than 5 μG to allow KHI to develop. The lack of an evident magnetic draping layer just outside the contact edge is consistent with such an upper limit.

  19. Cluster Control of Offshore Wind Power Plants Connected to a Common HVDC Station

    DEFF Research Database (Denmark)

    Göksu, Ömer; Sakamuri, Jayachandra N.; Rapp, C. Andrea;

    2016-01-01

    In this paper a coordinated control for cluster of offshore WPPs connected to the same HVDC connection is being implemented and analyzed. The study is targeting two cases as; coordination of reactive power flow between HVDC converter and the WPP cluster while providing offshore AC grid voltage...... control, and coordinated closed loop control between the HVDC and the WPPs while the cluster is providing Power Oscillation Damping ( POD) via active power modulation. It is shown that the coordinated cluster control helps to improve the steady-state and dynamic response of the offshore AC grid in case...

  20. A New Coordinated Voltage Control Scheme for Offshore AC Grid of HVDC Connected Offshore Wind Power Plants

    DEFF Research Database (Denmark)

    Sakamuri, Jayachandra N.; Cutululis, Nicolaos Antonio; Rather, Zakir Hussain;

    2015-01-01

    This paper proposes a coordinated voltage control scheme (CVCS) which enhances the voltage ride through (VRT) capability of an offshore AC grid comprised of a cluster of offshore wind power plants (WPP) connected through AC cables to the offshore voltage source converter based high voltage DC (VSC-HVDC......) converter station. Due to limited short circuit power contribution from power electronic interfaced variable speed wind generators and with the onshore main grid decoupled by the HVDC link, the offshore AC grid becomes more vulnerable to dynamic voltage events. Therefore, a short circuit fault...... in the offshore AC Grid is likely to have significant implications on the voltage of the offshore AC grid, hence on the power flow to the onshore mainland grid. The proposed CVCS integrates individual local reactive power control of wind turbines and of the HVDC converter with the secondary voltage controller...

  1. AcEST: DK943968 [AcEST

    Lifescience Database Archive (English)

    Full Text Available = +2 Query: 71 SSIRDLDNSRPRAIACSDNSGICVAVAYNHLANM------AVATFRDKPSVHQAGS---M 223 SS+ S P AC+ N+ VA HL+N+ A+ F...ives = 24/56 (42%) Frame = +2 Query: 107 AIACSDNSGICVAVAYNHLANMAVATFRDKPSVHQAGSMN...es = 83/195 (42%), Gaps = 1/195 (0%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYNHLANMAVA.../188 (41%), Gaps = 2/188 (1%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKP... VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKPSVH 208 V++A S G WD D +RP + +N G+C+++A N +++ VA+FR

  2. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  3. Bayesian Analysis of Two Stellar Populations in Galactic Globular Clusters III: Analysis of 30 Clusters

    CERN Document Server

    Wagner-Kaiser, R; Sarajedini, A; von Hippel, T; van Dyk, D A; Robinson, E; Stein, N; Jefferys, W H

    2016-01-01

    We use Cycle 21 Hubble Space Telescope (HST) observations and HST archival ACS Treasury observations of 30 Galactic Globular Clusters to characterize two distinct stellar populations. A sophisticated Bayesian technique is employed to simultaneously sample the joint posterior distribution of age, distance, and extinction for each cluster, as well as unique helium values for two populations within each cluster and the relative proportion of those populations. We find the helium differences among the two populations in the clusters fall in the range of ~0.04 to 0.11. Because adequate models varying in CNO are not presently available, we view these spreads as upper limits and present them with statistical rather than observational uncertainties. Evidence supports previous studies suggesting an increase in helium content concurrent with increasing mass of the cluster and also find that the proportion of the first population of stars increases with mass as well. Our results are examined in the context of proposed g...

  4. Quotients of cluster categories

    OpenAIRE

    Jorgensen, Peter

    2007-01-01

    Higher cluster categories were recently introduced as a generalization of cluster categories. This paper shows that in Dynkin types A and D, half of all higher cluster categories are actually just quotients of cluster categories. The other half can be obtained as quotients of 2-cluster categories, the "lowest" type of higher cluster categories. Hence, in Dynkin types A and D, all higher cluster phenomena are implicit in cluster categories and 2-cluster categories. In contrast, the same is not...

  5. Regional Innovation Clusters

    Data.gov (United States)

    Small Business Administration — The Regional Innovation Clusters serve a diverse group of sectors and geographies. Three of the initial pilot clusters, termed Advanced Defense Technology clusters,...

  6. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  7. Cluster forcing

    DEFF Research Database (Denmark)

    Christensen, Thomas Budde

    -industrialism and the ‘liveable' region. In this paper the cluster strategies that have been applied to the automotive sector in Wales are analysed. The paper includes a theoretical discussion on how the cluster concept has been applied to industrial policies, along with an empirical analysis of the application of the concept...... automotive sector in Wales. The paper draws from a survey of Welsh automotive suppliers on the characteristics of the local business environment and innovation. On the basis of the survey it is concluded that the public sector has an important task ahead concerning the linkages between universities and local...... businesses. The universities were not considered by the participating companies to be important parts of the local business environment and inputs from universities did not appear to be an important source to access knowledge about new product development or new techniques in production, distribution...

  8. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...

  9. Horizontal transfer of a nitrate assimilation gene cluster and ecological transitions in fungi: a phylogenetic study.

    Directory of Open Access Journals (Sweden)

    Jason C Slot

    Full Text Available High affinity nitrate assimilation genes in fungi occur in a cluster (fHANT-AC that can be coordinately regulated. The clustered genes include nrt2, which codes for a high affinity nitrate transporter; euknr, which codes for nitrate reductase; and NAD(PH-nir, which codes for nitrite reductase. Homologs of genes in the fHANT-AC occur in other eukaryotes and prokaryotes, but they have only been found clustered in the oomycete Phytophthora (heterokonts. We performed independent and concatenated phylogenetic analyses of homologs of all three genes in the fHANT-AC. Phylogenetic analyses limited to fungal sequences suggest that the fHANT-AC has been transferred horizontally from a basidiomycete (mushrooms and smuts to an ancestor of the ascomycetous mold Trichoderma reesei. Phylogenetic analyses of sequences from diverse eukaryotes and eubacteria, and cluster structure, are consistent with a hypothesis that the fHANT-AC was assembled in a lineage leading to the oomycetes and was subsequently transferred to the Dikarya (Ascomycota+Basidiomycota, which is a derived fungal clade that includes the vast majority of terrestrial fungi. We propose that the acquisition of high affinity nitrate assimilation contributed to the success of Dikarya on land by allowing exploitation of nitrate in aerobic soils, and the subsequent transfer of a complete assimilation cluster improved the fitness of T. reesei in a new niche. Horizontal transmission of this cluster of functionally integrated genes supports the "selfish operon" hypothesis for maintenance of gene clusters.

  10. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  11. AcEST: DK956298 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1... 370 e-102 sp|Q43314|DHE1_ARATH Glutamate dehydrogenase 1...HGK 202 >sp|P93541|DHE3_SOLLC Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1 Length = 412...RG ++A EALL ++G+ Sbjct: 181 RDAATGRGALFATEALLNEHGK 202 >sp|Q43260|DHE3_MAIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1...ATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 Length = 411 Score = 369 bits (946),...AC Glutamate dehydrogenase OS=Nicotiana taba... 376 e-103 tr|A7YVW3|A7YVW3_ACTCH GDH1 OS=Actinidia chinensis GN=GDH1

  12. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  13. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  14. Dark matter searches with Cherenkov telescopes: nearby dwarf galaxies or local galaxy clusters?

    Energy Technology Data Exchange (ETDEWEB)

    Sánchez-Conde, Miguel A. [SLAC National Laboratory and Kavli Institute for Particle Astrophysics and Cosmology, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States); Cannoni, Mirco; Gómez, Mario E. [Dpto. Física Aplicada, Facultad de Ciencias Experimentales, Universidad de Huelva, 21071 Huelva (Spain); Zandanel, Fabio; Prada, Francisco, E-mail: masc@stanford.edu, E-mail: mirco.cannoni@dfa.uhu.es, E-mail: fabio@iaa.es, E-mail: mario.gomez@dfa.uhu.es, E-mail: fprada@iaa.es [Instituto de Astrofísica de Andalucía (CSIC), E-18008, Granada (Spain)

    2011-12-01

    In this paper, we compare dwarf galaxies and galaxy clusters in order to elucidate which object class is the best target for gamma-ray DM searches with imaging atmospheric Cherenkov telescopes (IACTs). We have built a mixed dwarfs+clusters sample containing some of the most promising nearby dwarf galaxies (Draco, Ursa Minor, Wilman 1 and Segue 1) and local galaxy clusters (Perseus, Coma, Ophiuchus, Virgo, Fornax, NGC 5813 and NGC 5846), and then compute their DM annihilation flux profiles by making use of the latest modeling of their DM density profiles. We also include in our calculations the effect of DM substructure. Willman 1 appears as the best candidate in the sample. However, its mass modeling is still rather uncertain, so probably other candidates with less uncertainties and quite similar fluxes, namely Ursa Minor and Segue 1, might be better options. As for galaxy clusters, Virgo represents the one with the highest flux. However, its large spatial extension can be a serious handicap for IACT observations and posterior data analysis. Yet, other local galaxy cluster candidates with more moderate emission regions, such as Perseus, may represent good alternatives. After comparing dwarfs and clusters, we found that the former exhibit annihilation flux profiles that, at the center, are roughly one order of magnitude higher than those of clusters, although galaxy clusters can yield similar, or even higher, integrated fluxes for the whole object once substructure is taken into account. Even when any of these objects are strictly point-like according to the properties of their annihilation signals, we conclude that dwarf galaxies are best suited for observational strategies based on the search of point-like sources, while galaxy clusters represent best targets for analyses that can deal with rather extended emissions. Finally, we study the detection prospects for present and future IACTs in the framework of the constrained minimal supersymmetric standard model. We

  15. Dark Matter Searches with Cherenkov Telescopes: Nearby Dwarf Galaxies or Local Galaxy Clusters?

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez-Conde, Miguel A.; /KIPAC, Menlo Park /SLAC /IAC, La Laguna /Laguna U., Tenerife; Cannoni, Mirco; /Huelva U.; Zandanel, Fabio; /IAA, Granada; Gomez, Mario E.; /Huelva U.; Prada, Francisco; /IAA, Granada

    2012-06-06

    In this paper, we compare dwarf galaxies and galaxy clusters in order to elucidate which object class is the best target for gamma-ray DM searches with imaging atmospheric Cherenkov telescopes (IACTs). We have built a mixed dwarfs+clusters sample containing some of the most promising nearby dwarf galaxies (Draco, Ursa Minor, Wilman 1 and Segue 1) and local galaxy clusters (Perseus, Coma, Ophiuchus, Virgo, Fornax, NGC 5813 and NGC 5846), and then compute their DM annihilation flux profiles by making use of the latest modeling of their DM density profiles. We also include in our calculations the effect of DM substructure. Willman 1 appears as the best candidate in the sample. However, its mass modeling is still rather uncertain, so probably other candidates with less uncertainties and quite similar fluxes, namely Ursa Minor and Segue 1, might be better options. As for galaxy clusters, Virgo represents the one with the highest flux. However, its large spatial extension can be a serious handicap for IACT observations and posterior data analysis. Yet, other local galaxy cluster candidates with more moderate emission regions, such as Perseus, may represent good alternatives. After comparing dwarfs and clusters, we found that the former exhibit annihilation flux profiles that, at the center, are roughly one order of magnitude higher than those of clusters, although galaxy clusters can yield similar, or even higher, integrated fluxes for the whole object once substructure is taken into account. Even when any of these objects are strictly point-like according to the properties of their annihilation signals, we conclude that dwarf galaxies are best suited for observational strategies based on the search of point-like sources, while galaxy clusters represent best targets for analyses that can deal with rather extended emissions. Finally, we study the detection prospects for present and future IACTs in the framework of the constrained minimal supersymmetric standard model. We

  16. Investigation of the Coupling Paths of a Galvanically Isolated AC/AC Converter

    NARCIS (Netherlands)

    Roc'h, Anne; Zhao, Dongsheng; Leferink, Frank; Polinder, Henk; Ferreira, Braham

    2007-01-01

    A galvanically isolated three-phase AC/AC converter with a high-frequency AC-link has been analyzed from an EMC point of view. This is a special configuration because of a large number of switches, a high frequency transformer, and a fourwire output. The essential coupling paths are identified. Corr

  17. Chemical composition and constraints on mass loss for globular clusters in dwarf galaxies: WLM and IKN

    CERN Document Server

    Larsen, S S; Forbes, D A; Strader, J

    2014-01-01

    We determine the metallicities for globular clusters (GCs) in the WLM and IKN dwarf galaxies, using VLT/UVES and Keck/ESI spectroscopy. For the WLM GC we also measure detailed abundance ratios for a number of light, alpha, Fe-peak and n-capture elements. We find low metallicities of [Fe/H]=-2.0 and -2.1 for the WLM GC and the GC IKN-5, respectively. We estimate that 17%-31% of the metal-poor stars in WLM belong to the GC, and IKN-5 may even contain a similar number of metal-poor stars as the whole of the IKN dwarf itself. These high ratios of metal-poor GCs to field stars are in tension with GC formation scenarios that require GCs to have lost a very large fraction of their initial mass. The GCs in the WLM and IKN dwarf galaxies resemble those in the Fornax dSph by being significantly more metal-poor than a typical halo GC in the Milky Way and other large galaxies. They are also substantially more metal-poor than the bulk of the field stars in their parent galaxies. The overall abundance patterns in the WLM G...

  18. An Automatic Clustering Technique for Optimal Clusters

    CERN Document Server

    Pavan, K Karteeka; Rao, A V Dattatreya; 10.5121/ijcsea.2011.1412

    2011-01-01

    This paper proposes a simple, automatic and efficient clustering algorithm, namely, Automatic Merging for Optimal Clusters (AMOC) which aims to generate nearly optimal clusters for the given datasets automatically. The AMOC is an extension to standard k-means with a two phase iterative procedure combining certain validation techniques in order to find optimal clusters with automation of merging of clusters. Experiments on both synthetic and real data have proved that the proposed algorithm finds nearly optimal clustering structures in terms of number of clusters, compactness and separation.

  19. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette;

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  20. Titanium-oxo cluster with 9-anthracenecarboxylate antennae: a fluorescent and photocurrent transfer material.

    Science.gov (United States)

    Wu, Yin-Yin; Lu, Xiao-Wen; Qi, Miao; Su, Hu-Chao; Zhao, Xiao-Wei; Zhu, Qin-Yu; Dai, Jie

    2014-07-21

    Attention has been paid to titanium-oxo clusters (TOCs) modified with functional molecules, because they can be considered as model systems for dye-sensitized titanium oxides in terms of their information in structures and electron transfer. We select 9-anthracenecarboxylate (9-AC) as a photoactive ligand and prepare two model compounds, [Ti6O6(O(i)Pr)6(9-AC)6] (1) and [Ti6O4(O(i)Pr)6(cat)4(9-AC)2] (2) (where cat = catecholate). Structures of the TOCs and the dye-TOC linkage are characterized by single-crystal analysis. Solvent-induced fluorescence change is observed for the cluster solution, and the fluorescence can be turned off by irradiating and on by oxygen bubbling. Photoinduced Ti(III) is responsible for the fluorescence extinction. The photocurrent conversion property of the clusters is examined by use of a three-electrode cell with cluster-coated indium tin oxide (ITO) electrodes. The results indicate that 9-AC is an effective photosensitizer and cluster 1 shows higher photocurrent intensity for its multiantenna structure in comparison with that of 2. Density of states for cluster 1 is calculated, in which the discrete energy bands of Ti6O24 include a number of new energy levels for the contribution of 9-AC molecules.

  1. BioCluster:Tool for Identification and Clustering of Enterobacteriaceae Based on Biochemical Data

    Institute of Scientific and Technical Information of China (English)

    Ahmed Abdullah; S.M.Sabbir Alam; Munawar Sultana; M.Anwar Hossain

    2015-01-01

    Presumptive identification of different Enterobacteriaceae species is routinely achieved based on biochemical properties. Traditional practice includes manual comparison of each biochem-ical property of the unknown sample with known reference samples and inference of its identity based on the maximum similarity pattern with the known samples. This process is labor-intensive, time-consuming, error-prone, and subjective. Therefore, automation of sorting and sim-ilarity in calculation would be advantageous. Here we present a MATLAB-based graphical user interface (GUI) tool named BioCluster. This tool was designed for automated clustering and iden-tification of Enterobacteriaceae based on biochemical test results. In this tool, we used two types of algorithms, i.e., traditional hierarchical clustering (HC) and the Improved Hierarchical Clustering (IHC), a modified algorithm that was developed specifically for the clustering and identification of Enterobacteriaceae species. IHC takes into account the variability in result of 1–47 biochemical tests within this Enterobacteriaceae family. This tool also provides different options to optimize the clus-tering in a user-friendly way. Using computer-generated synthetic data and some real data, we have demonstrated that BioCluster has high accuracy in clustering and identifying enterobacterial species based on biochemical test data. This tool can be freely downloaded at http://microbialgen.du.ac.bd/biocluster/.

  2. AC susceptibility as a tool to probe the dipolar interaction in magnetic nanoparticles

    OpenAIRE

    Landi, Gabriel T.; Arantes, Fabiana R; Cornejo, Daniel R.; Bakuzis, Andris F.; Andreu, Irene; Natividad, Eva

    2016-01-01

    The dipolar interaction is known to substantially affect the properties of magnetic nanoparticles. This is particularly important when the particles are kept in a fluid suspension or packed inside nano-carriers. In addition to its usual long-range nature, in these cases the dipolar interaction may also induce the formation of clusters of particles, thereby strongly modifying their magnetic anisotropies. In this paper we show how AC susceptibility may be used to obtain important information re...

  3. Identification and preliminary characterization of acsF, a Putative Ni-insertase used in the biosynthesis of acetyl-CoA synthase from Clostridium thermoaceticum

    Energy Technology Data Exchange (ETDEWEB)

    Huay-Keng Loke; Paul A. Lindahl

    2003-01-01

    OAK-B135 The acsABCDE genes in the Clostridium thermoaceticum genome are used for autotrophic acetyl-CoA synthesis using the Wood/Ljungdahl pathway. A 2.8 kb region between acsC and acsD was cloned and sequenced. Two open reading frames, orf7 ({approx} 1.9 kb) and acsF ({approx} 0.7 kb) were identified. orf7 appears to encode an Fe-S protein, in that it contains 5 conserved cysteine residues, 3 of which are present in a motif (CXXXXXCXXC) commonly used to coordinate Fe-S clusters. However, Orf7 is probably not involved in autotrophic acetyl-CoA synthesis, as homologous genes are present in organisms that do not utilize this pathway and are absent in many that do. In contrast, acsF is probably involved in this pathway. Sequence alignment of AcsF and 11 homologs reveals a number of conserved regions, including a P-loop that binds nucleoside triphosphates and catalyzes their hydrolysis. One homolog is CooC, an ATPase/GTPase that inserts Ni into a precursor form of the C-cluster of the carbon monoxide dehydrogenase (CODH) from Rhodospirillum rubrum. Purified AcsF lacked Ni and Fe, and slowly catalyzed the hydrolysis of ATP. Such similarities to CooC suggest that AcsF may function to insert Ni into a Ni-deficient form of the bifunctional acetyl-CoA synthase/CODH from C. thermoaceticum (ACSCt). However, this could not be established, as expression of acsF did not effect activation of recombinant AcsAB expressed in E. coli. Also, E. coli cells defective in hypB retained the ability to synthesize active recombinant AcsAB. Rather, the concentration of extracellular Ni2+ ions was critical to activation.

  4. Applying Machine Learning to Star Cluster Classification

    Science.gov (United States)

    Fedorenko, Kristina; Grasha, Kathryn; Calzetti, Daniela; Mahadevan, Sridhar

    2016-01-01

    Catalogs describing populations of star clusters are essential in investigating a range of important issues, from star formation to galaxy evolution. Star cluster catalogs are typically created in a two-step process: in the first step, a catalog of sources is automatically produced; in the second step, each of the extracted sources is visually inspected by 3-to-5 human classifiers and assigned a category. Classification by humans is labor-intensive and time consuming, thus it creates a bottleneck, and substantially slows down progress in star cluster research.We seek to automate the process of labeling star clusters (the second step) through applying supervised machine learning techniques. This will provide a fast, objective, and reproducible classification. Our data is HST (WFC3 and ACS) images of galaxies in the distance range of 3.5-12 Mpc, with a few thousand star clusters already classified by humans as a part of the LEGUS (Legacy ExtraGalactic UV Survey) project. The classification is based on 4 labels (Class 1 - symmetric, compact cluster; Class 2 - concentrated object with some degree of asymmetry; Class 3 - multiple peak system, diffuse; and Class 4 - spurious detection). We start by looking at basic machine learning methods such as decision trees. We then proceed to evaluate performance of more advanced techniques, focusing on convolutional neural networks and other Deep Learning methods. We analyze the results, and suggest several directions for further improvement.

  5. Cluster headache

    Directory of Open Access Journals (Sweden)

    Ducros Anne

    2008-07-01

    Full Text Available Abstract Cluster headache (CH is a primary headache disease characterized by recurrent short-lasting attacks (15 to 180 minutes of excruciating unilateral periorbital pain accompanied by ipsilateral autonomic signs (lacrimation, nasal congestion, ptosis, miosis, lid edema, redness of the eye. It affects young adults, predominantly males. Prevalence is estimated at 0.5–1.0/1,000. CH has a circannual and circadian periodicity, attacks being clustered (hence the name in bouts that can occur during specific months of the year. Alcohol is the only dietary trigger of CH, strong odors (mainly solvents and cigarette smoke and napping may also trigger CH attacks. During bouts, attacks may happen at precise hours, especially during the night. During the attacks, patients tend to be restless. CH may be episodic or chronic, depending on the presence of remission periods. CH is associated with trigeminovascular activation and neuroendocrine and vegetative disturbances, however, the precise cautive mechanisms remain unknown. Involvement of the hypothalamus (a structure regulating endocrine function and sleep-wake rhythms has been confirmed, explaining, at least in part, the cyclic aspects of CH. The disease is familial in about 10% of cases. Genetic factors play a role in CH susceptibility, and a causative role has been suggested for the hypocretin receptor gene. Diagnosis is clinical. Differential diagnoses include other primary headache diseases such as migraine, paroxysmal hemicrania and SUNCT syndrome. At present, there is no curative treatment. There are efficient treatments to shorten the painful attacks (acute treatments and to reduce the number of daily attacks (prophylactic treatments. Acute treatment is based on subcutaneous administration of sumatriptan and high-flow oxygen. Verapamil, lithium, methysergide, prednisone, greater occipital nerve blocks and topiramate may be used for prophylaxis. In refractory cases, deep-brain stimulation of the

  6. Memory effect in ac plasma displays

    Science.gov (United States)

    Szlenk, K.; Obuchowicz, E.

    1993-10-01

    The bistable or `memory' mode of operation of an ac plasma display panel is presented. The difference between dc and ac plasma panel operation from the point of view of memory function is discussed. The graphic ac plasma display with thin film Cr-Cu-Cr electrodes was developed in OBREP and its basic parameters are described. It consists of 36 X 59 picture elements, its outer dimensions are: 76 X 52 mm2 and the screen size is: 49 X 30 mm2. The different dielectric glass materials were applied as dielectric layers and the influence of the properties of these materials on display parameters and memory function was investigated.

  7. AcEST: BP916116 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_C12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000083_C12. BP916116 - Show BP916116...is mRNA. clone: YMU001_000083_C12. Accession BP916116 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP916116|Adiantum capillu...ocyte receptor cluster member 8 homolo... 39 0.016 sp|Q6NFC2|ISPF_CORDI 2-C-methyl-D-erythritol 2,4-cyclodip...diphosphat... 30 4.5 sp|Q8K387|UBP45_MOUSE Ubiquitin carboxyl-terminal hydrolase 45 O... 30 5.8 sp|P50165|TR

  8. Memory Convergence and Optimization with Fuzzy PSO and ACS

    Directory of Open Access Journals (Sweden)

    Subhash C. Pandey

    2008-01-01

    Full Text Available Associative neural memories are models of biological phenomena that allow for the storage of pattern associations and the retrieval of the desired output pattern upon presentation of a possibly noisy or incomplete version of an input pattern. In this study, we introduce fuzzy swarm particle optimization technique for convergence of associative neural memories based on fuzzy set theory. A Fuzzy Particle Swarm Optimization (FPSO consists of clustering of swarm's particle by applying fuzzy c-mean algorithm to attain the neighborhood best. We present a singular value decomposition method for the selection of efficient rule from a given rule base required to attain the global best. Finally, we illustrate the proposed method by virtue of some examples. Further, ant colony system ACS algorithm is used to study the Symmetric Traveling Salesman Problem TSP. The optimum parameters for this algorithm have to found by trial and error. The ACS parameters working in a designed subset of TSP instances has also been optimized by virtue of Particle Swarm Optimization PSO.

  9. Partitional clustering algorithms

    CERN Document Server

    2015-01-01

    This book summarizes the state-of-the-art in partitional clustering. Clustering, the unsupervised classification of patterns into groups, is one of the most important tasks in exploratory data analysis. Primary goals of clustering include gaining insight into, classifying, and compressing data. Clustering has a long and rich history that spans a variety of scientific disciplines including anthropology, biology, medicine, psychology, statistics, mathematics, engineering, and computer science. As a result, numerous clustering algorithms have been proposed since the early 1950s. Among these algorithms, partitional (nonhierarchical) ones have found many applications, especially in engineering and computer science. This book provides coverage of consensus clustering, constrained clustering, large scale and/or high dimensional clustering, cluster validity, cluster visualization, and applications of clustering. Examines clustering as it applies to large and/or high-dimensional data sets commonly encountered in reali...

  10. Clustering and Community Detection with Imbalanced Clusters

    OpenAIRE

    Aksoylar, Cem; Qian, Jing; Saligrama, Venkatesh

    2016-01-01

    Spectral clustering methods which are frequently used in clustering and community detection applications are sensitive to the specific graph constructions particularly when imbalanced clusters are present. We show that ratio cut (RCut) or normalized cut (NCut) objectives are not tailored to imbalanced cluster sizes since they tend to emphasize cut sizes over cut values. We propose a graph partitioning problem that seeks minimum cut partitions under minimum size constraints on partitions to de...

  11. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  12. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Energy Technology Data Exchange (ETDEWEB)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  13. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Directory of Open Access Journals (Sweden)

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  14. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  15. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.;

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  16. Cluster headaches.

    Science.gov (United States)

    Ryan, R E; Ryan, R E

    1989-12-01

    The patient with cluster headaches will be afflicted with the most severe type of pain that one will encounter. If the physician can do something to help this patient either by symptomatic or, more importantly, prophylactic treatment, he or she will have a most thankful patient. This type of headache is seen most frequently in men, and occurs in a cyclic manner. During an acute cycle, the patient will experience a daily type of pain that may occur many times per day. The pain is usually unilateral and may be accompanied by unilateral lacrimation, conjunctivitis, and clear rhinorrhea. Prednisone is the first treatment we employ. Patients are seen for follow-up approximately twice a week, and their medication is lowered in an appropriate manner, depending on their response to the treatment. Regulation of dosage has to be individualized, and when one reaches the lower dose such as 5 to 10 mg per day, the drug may have to be tapered more slowly, or even maintained at that level for a period of time to prevent further recurrence of symptoms. We frequently will use an intravenous histamine desensitization technique to prevent further attacks. We will give the patient an ergotamine preparation to use for symptomatic relief. As these patients often have headaches during the middle of the night, we will place the patient on a 2-mg ergotamine preparation to take prior to going to bed in the evening. This often works in a prophylactic nature, and prevents the nighttime occurrence of a headache. We believe that following these principles to make the accurate diagnosis and institute the proper therapy will help the practicing otolaryngologist recognize and treat patients suffering from this severe pain.

  17. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  18. Factorial PD-Clustering

    CERN Document Server

    Tortora, Cristina; Summa, Mireille Gettler

    2011-01-01

    Factorial clustering methods have been developed in recent years thanks to the improving of computational power. These methods perform a linear transformation of data and a clustering on transformed data optimizing a common criterion. Factorial PD-clustering is based on Probabilistic Distance clustering (PD-clustering). PD-clustering is an iterative, distribution free, probabilistic, clustering method. Factorial PD-clustering make a linear transformation of original variables into a reduced number of orthogonal ones using a common criterion with PD-Clustering. It is demonstrated that Tucker 3 decomposition allows to obtain this transformation. Factorial PD-clustering makes alternatively a Tucker 3 decomposition and a PD-clustering on transformed data until convergence. This method could significantly improve the algorithm performance and allows to work with large dataset, to improve the stability and the robustness of the method.

  19. Possibilistic Exponential Fuzzy Clustering

    Institute of Scientific and Technical Information of China (English)

    Kiatichai Treerattanapitak; Chuleerat Jaruskulchai

    2013-01-01

    Generally,abnormal points (noise and outliers) cause cluster analysis to produce low accuracy especially in fuzzy clustering.These data not only stay in clusters but also deviate the centroids from their true positions.Traditional fuzzy clustering like Fuzzy C-Means (FCM) always assigns data to all clusters which is not reasonable in some circumstances.By reformulating objective function in exponential equation,the algorithm aggressively selects data into the clusters.However noisy data and outliers cannot be properly handled by clustering process therefore they are forced to be included in a cluster because of a general probabilistic constraint that the sum of the membership degrees across all clusters is one.In order to improve this weakness,possibilistic approach relaxes this condition to improve membership assignment.Nevertheless,possibilistic clustering algorithms generally suffer from coincident clusters because their membership equations ignore the distance to other clusters.Although there are some possibilistic clustering approaches that do not generate coincident clusters,most of them require the right combination of multiple parameters for the algorithms to work.In this paper,we theoretically study Possibilistic Exponential Fuzzy Clustering (PXFCM) that integrates possibilistic approach with exponential fuzzy clustering.PXFCM has only one parameter and not only partitions the data but also filters noisy data or detects them as outliers.The comprehensive experiments show that PXFCM produces high accuracy in both clustering results and outlier detection without generating coincident problems.

  20. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  1. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  2. 21 CFR 888.1240 - AC-powered dynamometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  3. 21 CFR 886.1630 - AC-powered photostimulator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  4. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... No. 812-14066] ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission... (``Act''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b..., reinvesting, owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  5. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  6. Dissolution of Globular Clusters

    OpenAIRE

    Baumgardt, Holger

    2006-01-01

    Globular clusters are among the oldest objects in galaxies, and understanding the details of their formation and evolution can bring valuable insight into the early history of galaxies. This review summarises the current knowledge about the dissolution of star clusters and discusses the implications of star cluster dissolution for the evolution of the mass function of star cluster systems in galaxies.

  7. Structures of Mn clusters

    Indian Academy of Sciences (India)

    Tina M Briere; Marcel H F Sluiter; Vijay Kumar; Yoshiyuki Kawazoe

    2003-01-01

    The geometries of several Mn clusters in the size range Mn13–Mn23 are studied via the generalized gradient approximation to density functional theory. For the 13- and 19-atom clusters, the icosahedral structures are found to be most stable, while for the 15-atom cluster, the bcc structure is more favoured. The clusters show ferrimagnetic spin configurations.

  8. Contextualizing the Cluster

    DEFF Research Database (Denmark)

    Giacomin, Valeria

    This dissertation examines the case of the palm oil cluster in Malaysia and Indonesia, today one of the largest agricultural clusters in the world. My analysis focuses on the evolution of the cluster from the 1880s to the 1970s in order to understand how it helped these two countries to integrate......-researched topic in the cluster literature – the emergence of clusters, their governance and institutional change, and competition between rival cluster locations – through the case of the Southeast Asian palm oil cluster....

  9. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  10. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  11. Clustering in analytical chemistry.

    Science.gov (United States)

    Drab, Klaudia; Daszykowski, Michal

    2014-01-01

    Data clustering plays an important role in the exploratory analysis of analytical data, and the use of clustering methods has been acknowledged in different fields of science. In this paper, principles of data clustering are presented with a direct focus on clustering of analytical data. The role of the clustering process in the analytical workflow is underlined, and its potential impact on the analytical workflow is emphasized.

  12. Cyclotron and linac production of Ac-225.

    Science.gov (United States)

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  13. Relation between magnetic and structural anisotropy in the Ni23Se12(PEt3)13 cluster compound

    NARCIS (Netherlands)

    Narasimhan, L.R.; Palstra, T.T.M.; Tanzler, S.M.; Steigerwald, M.L.

    1995-01-01

    We have measured the magnetic properties of the cluster compound Ni23Se12(PEt3)13, where PEt3 is triethyl phosphine, by dc magnetization (1.5–300 K) and ac susceptibility (0.280–4 K). We observe a small, almost temperature-independent, magnetic moment of only ~2μB/cluster indicating the presence of

  14. Bayesian analysis of two stellar populations in Galactic globular clusters- III. Analysis of 30 clusters

    Science.gov (United States)

    Wagner-Kaiser, R.; Stenning, D. C.; Sarajedini, A.; von Hippel, T.; van Dyk, D. A.; Robinson, E.; Stein, N.; Jefferys, W. H.

    2016-12-01

    We use Cycle 21 Hubble Space Telescope (HST) observations and HST archival ACS Treasury observations of 30 Galactic globular clusters to characterize two distinct stellar populations. A sophisticated Bayesian technique is employed to simultaneously sample the joint posterior distribution of age, distance, and extinction for each cluster, as well as unique helium values for two populations within each cluster and the relative proportion of those populations. We find the helium differences among the two populations in the clusters fall in the range of ˜0.04 to 0.11. Because adequate models varying in carbon, nitrogen, and oxygen are not presently available, we view these spreads as upper limits and present them with statistical rather than observational uncertainties. Evidence supports previous studies suggesting an increase in helium content concurrent with increasing mass of the cluster and we also find that the proportion of the first population of stars increases with mass as well. Our results are examined in the context of proposed globular cluster formation scenarios. Additionally, we leverage our Bayesian technique to shed light on the inconsistencies between the theoretical models and the observed data.

  15. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    Institute of Scientific and Technical Information of China (English)

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  16. Two Populations of Young Massive Star Clusters in Arp 220

    CERN Document Server

    Wilson, C D; Longden, R; Scoville, N Z; Wilson, Christine D.; Harris, William E.; Longden, Rebecca

    2006-01-01

    We present new optical observations of young massive star clusters in Arp 220, the nearest ultraluminous infrared galaxy, taken in UBVI with the Hubble Space Telescope ACS/HRC camera. We find a total of 206 probable clusters whose spatial distribution is centrally concentrated toward the nucleus of Arp 220. We use model star cluster tracks to determine ages, luminosities, and masses for 14 clusters with complete UBVI indices or previously published near-infrared data. We estimate rough masses for 24 additional clusters with I < 24 mag from BVI indices alone. The clusters with useful ages fall into two distinct groups: a ``young'' population (< 10 Myr) and an intermediate-age population (~300 Myr). There are many clusters with masses clearly above 10^6 Msun and possibly even above 10^7 Msun in the most extreme instances. These masses are high enough that the clusters being formed in the Arp 220 starburst can be considered as genuine young globular clusters. In addition, this study allows us to extend the...

  17. Kinematics and stellar populations of low-luminosity early-type galaxies in the Abell 496 cluster

    Science.gov (United States)

    Chilingarian, I. V.; Cayatte, V.; Durret, F.; Adami, C.; Balkowski, C.; Chemin, L.; Laganá, T. F.; Prugniel, P.

    2008-07-01

    Context: The morphology and stellar populations of low-luminosity early-type galaxies in clusters have until now been limited to a few relatively nearby clusters such as Virgo or Fornax. Scenarii for the formation and evolution of dwarf galaxies in clusters are therefore not well constrained. Aims: We investigate here the morphology and stellar populations of low-luminosity galaxies in the relaxed richness class 1 cluster Abell 496 (z = 0.0330). Methods: Deep multiband imaging obtained with the CFHT Megacam allowed us to select a sample of faint galaxies, defined here as objects with magnitudes 18 power R = 6300. We present structural analysis and colour maps for the 48 galaxies belonging to the cluster. We fit the spectra of 46 objects with PEGASE.HR synthetic spectra to estimate the ages, metallicities, and velocity dispersions. We estimated possible biases by similarly analysing spectra of ~1200 early-type galaxies from the Sloan Digital Sky Survey Data Release 6 (SDSS DR6). We computed values of α/Fe abundance ratios from the measurements of Lick indices. We briefly discuss effects of the fixed aperture size on the measurements. Results: For the first time, high-precision estimates of stellar population properties have been obtained for a large sample of faint galaxies in a cluster, allowing for the extension of relations between stellar populations and internal kinematics to the low-velocity dispersion regime. We have revealed a peculiar population of elliptical galaxies in the core of the cluster, resembling massive early-type galaxies by their stellar population properties and velocity dispersions, but having luminosities of about 2 mag fainter. Conclusions: External mechanisms of gas removal (ram pressure stripping and gravitational harassment) are more likely to have occurred than internal mechanisms such as supernova-driven winds. The violent tidal stripping of intermediate-luminosity, early-type galaxies in the cluster core can explain the properties of

  18. Globular Cluster Formation at High Density: A Model for Elemental Enrichment with Fast Recycling of Massive-star Debris

    Science.gov (United States)

    Elmegreen, Bruce G.

    2017-02-01

    The self-enrichment of massive star clusters by p-processed elements is shown to increase significantly with increasing gas density as a result of enhanced star formation rates and stellar scatterings compared to the lifetime of a massive star. Considering the type of cloud core where a globular cluster (GC) might have formed, we follow the evolution and enrichment of the gas and the time dependence of stellar mass. A key assumption is that interactions between massive stars are important at high density, including interactions between massive stars and massive-star binaries that can shred stellar envelopes. Massive-star interactions should also scatter low-mass stars out of the cluster. Reasonable agreement with the observations is obtained for a cloud-core mass of ∼4 × 106 M ⊙ and a density of ∼2 × 106 cm‑3. The results depend primarily on a few dimensionless parameters, including, most importantly, the ratio of the gas consumption time to the lifetime of a massive star, which has to be low, ∼10%, and the efficiency of scattering low-mass stars per unit dynamical time, which has to be relatively large, such as a few percent. Also for these conditions, the velocity dispersions of embedded GCs should be comparable to the high gas dispersions of galaxies at that time, so that stellar ejection by multistar interactions could cause low-mass stars to leave a dwarf galaxy host altogether. This could solve the problem of missing first-generation stars in the halos of Fornax and WLM.

  19. AC susceptibilities of grain-textured superconductors

    Science.gov (United States)

    Sakamoto, N.; Fukuda, Y.; Koga, M.; Akune, T.; Khan, H. R.; Lüders, K.

    2008-09-01

    In-phase χ n‧ and out-phase χ n″ components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field Bdc, an amplitude Ba and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low- Tc metallic superconductors, χ1‧ shows smooth transition and χ1″ does single peak. High- Tc oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in χ1″ and shoulders in χ1‧ appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  20. The star cluster - field star connection in nearby spiral galaxies. II. Field star and cluster formation histories and their relation

    CERN Document Server

    Silva-Villa, Esteban

    2011-01-01

    Recent studies have started to cast doubt on the assumption that most stars are formed in clusters. Observational studies of field stars and star cluster systems in nearby galaxies can lead to better constraints on the fraction of stars forming in clusters. We aim to constrain the amount of star formation happening in long-lived clusters for four galaxies through the homogeneous study of field stars and star clusters. Using HST/ACS-WFPC2 images of the galaxies NGC45, NGC1313, NGC5236 and NGC7793, we estimate star formation histories by means of the synthetic CMD method. Masses and ages of star clusters are estimated using simple stellar population model fitting. Comparing observed and modeled luminosity functions we estimate cluster formation rates. By randomly sampling the stellar IMF, we construct artificial star clusters and quantify how stochastic effects influence cluster detection, integrated colors and age estimates. Star formation rates appear to be constant over the past 10-100 Myr. The number of clu...

  1. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  2. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede;

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  3. The ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  4. AC410 Unit 2 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

      AC410 Unit 2 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-2-homework-assignment/   3-31 Ron Barber, CPA, is auditing the financial statements of DGF, Inc., a publicly held company. During the course of the audit, Barber discovered that DGF has been making illegal bribes to foreign government officials to obtain business, and he reported the matter to senior management and the board of directors of DGF. Required: If management a...

  5. Cascaded Buck-Boost AC/AC converter%级联式Buck-Boost AC/AC变换器

    Institute of Scientific and Technical Information of China (English)

    张友军; 丁明昌; 任永保; 王阿敏; 翁振明

    2010-01-01

    详细分析了Buck型和Boost型AC/AC变换器的工作原理及其控制方法,在此基础上提出了一种新型级联式Buck-Boost AC/AC变换器及其三模式控制策略.三模式控制策略是比较输入电压与基准输出电压的大小,使得变换器只有3种工作模式:Buck模式、Boost模式和滤波模式.该电路虽然由Buck型和Boost型AC/AC变换器2级变换器级联而成,并采用2级占空比调制,但实际上最多只存在一级功率变换,具有控制简单、变换效率高、开关管电压应力低等优点.仿真结果证明了级联式Buck-Boost AC/AC变换器及其控制策略的可行性和理论分析的正确性.

  6. What Makes Clusters Decline?

    DEFF Research Database (Denmark)

    Østergaard, Christian Richter; Park, Eun Kyung

    2015-01-01

    Most studies on regional clusters focus on identifying factors and processes that make clusters grow. However, sometimes technologies and market conditions suddenly shift, and clusters decline. This paper analyses the process of decline of the wireless communication cluster in Denmark....... The longitudinal study on the high-tech cluster reveals that technological lock-in and exit of key firms have contributed to decline. Entrepreneurship has a positive effect on the cluster’s adaptive capabilities, while multinational companies have contradicting effects by bringing in new resources to the cluster...

  7. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  8. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    Directory of Open Access Journals (Sweden)

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  9. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  10. 76 FR 65633 - RIN 1904-AC43

    Science.gov (United States)

    2011-10-24

    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  11. AC Losses of Prototype HTS Transmission Cables

    Energy Technology Data Exchange (ETDEWEB)

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.

    1998-09-13

    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  12. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  13. Thermal Simulation of AC Electromagnetic Contactor

    Institute of Scientific and Technical Information of China (English)

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen

    2005-01-01

    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  14. A dry-cooled AC quantum voltmeter

    Science.gov (United States)

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.

    2016-10-01

    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  15. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez;

    2015-01-01

    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  16. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...

  17. Aging, Counterfeiting Configuration Control (AC3)

    Science.gov (United States)

    2010-01-31

    relabeled fake microcircuit chips from overseas - threaten the reliability, safety, and performance of DoD systems. These systems are vulnerable... NASA , Raytheon internal, etc. Aging, Counterfeiting Configuration Control (AC3) Page 13 of 28 are important in determining the alert’s priority

  18. The Cluster Substructure - Alignment Connection

    OpenAIRE

    Plionis, Manolis

    2001-01-01

    Using the APM cluster data we investigate whether the dynamical status of clusters is related to the large-scale structure of the Universe. We find that cluster substructure is strongly correlated with the tendency of clusters to be aligned with their nearest neighbour and in general with the nearby clusters that belong to the same supercluster. Furthermore, dynamically young clusters are more clustered than the overall cluster population. These are strong indications that cluster develop in ...

  19. Nuclear Clusters in Astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Kubono, S.; Binh, Dam N.; Hayakawa, S.; Hashimoto, H.; Kahl, D.; Wakabayashi, Y.; Yamaguchi, H. [Center for Nuclear Study (CNS), University of Tokyo, Wako Branch at RIKEN 2-1 Hirosawa, Wako, Saitama, 351-0198 (Japan); Teranishi, T. [Department of Physics, Kyushu University, Fukuoka, 812-8581 (Japan); Iwasa, N. [Department of Physics, Tohoku University, Sendai, 980-8578 (Japan); Komatsubara, T. [Department of Physics, Tsukuba University, Ibaraki, 305-8571 (Japan); Kato, S. [Department of Physics, Yamagata University, Yamagata, 990-8560 (Japan); Khiem, Le H. [Institute of Physics, Vietnam Academy for Science and Technology, Hanoi (Viet Nam)

    2010-03-01

    The role of nuclear clustering is discussed for nucleosynthesis in stellar evolution with Cluster Nucleosynthesis Diagram (CND) proposed before. Special emphasis is placed on alpha-induced stellar reactions together with molecular states for O and C burning.

  20. HST/ACS Imaging of Omega Centauri: Optical Counterparts of Chandra X-Ray Sources

    CERN Document Server

    Cool, Adrienne M; Arias, Tersi; Brochmann, Michelle; Dorfman, Jason; Gafford, April; White, Vivian; Anderson, Jay

    2012-01-01

    We present results of a search for optical counterparts of X-ray sources in and toward the globular cluster Omega Centauri (NGC 5139) using the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope. The ACS data consist of a mosaic of Wide Field Channel (WFC) images obtained using F625W, F435W, and F658N filters; with 9 pointings we cover the central ~10'x10' of the cluster and encompass 109 known Chandra sources. We find promising optical counterparts for 59 of the sources, ~40 of which are likely to be associated with the cluster. These include 27 candidate cataclysmic variables (CVs), 24 of which are reported here for the first time. Fourteen of the CV candidates are very faint, with absolute magnitudes in the range M_625 = 10.4 - 12.6, making them comparable in brightness to field CVs near the period minimum discovered in the SDSS (Gansicke et al. 2009). Additional optical counterparts include three BY Dra candidates, a possible blue straggler, and a previously-reported quiescent low-mass X-ray ...

  1. Forming Early-type Galaxies in Groups Prior to Cluster Assembly

    CERN Document Server

    Kautsch, Stefan J; Soto, Christian A; Tran, Kim-Vy H; Zaritsky, Dennis; Moustakas, John

    2008-01-01

    We study a unique proto-cluster of galaxies, the supergroup SG1120-1202. We quantify the degree to which morphological transformation of cluster galaxies occurs prior to cluster assembly in order to explain the observed early-type fractions in galaxy clusters at z=0. SG1120-1202 at z~0.37 is comprised of four gravitationally bound groups that are expected to coalesce into a single cluster by z=0. Using HST ACS observations, we compare the morphological fractions of the supergroup galaxies to those found in a range of environments. We find that the morphological fractions of early-type galaxies (~60 %) and the ratio of S0 to elliptical galaxies (0.5) in SG1120-1202 are very similar to clusters at comparable redshift, consistent with pre-processing in the group environment playing the dominant role in establishing the observed early-type fraction in galaxy clusters.

  2. [Pathophysiology of cluster headache].

    Science.gov (United States)

    Donnet, Anne

    2015-11-01

    The aetiology of cluster headache is partially unknown. Three areas are involved in the pathogenesis of cluster headache: the trigeminal nociceptive pathways, the autonomic system and the hypothalamus. The cluster headache attack involves activation of the trigeminal autonomic reflex. A dysfunction located in posterior hypothalamic gray matter is probably pivotal in the process. There is a probable association between smoke exposure, a possible genetic predisposition and the development of cluster headache.

  3. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  4. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Directory of Open Access Journals (Sweden)

    J. G. Oliveira

    2012-01-01

    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  5. Cluster Physics with Merging Galaxy Clusters

    Directory of Open Access Journals (Sweden)

    Sandor M. Molnar

    2016-02-01

    Full Text Available Collisions between galaxy clusters provide a unique opportunity to study matter in a parameter space which cannot be explored in our laboratories on Earth. In the standard LCDM model, where the total density is dominated by the cosmological constant ($Lambda$ and the matter density by cold dark matter (CDM, structure formation is hierarchical, and clusters grow mostly by merging.Mergers of two massive clusters are the most energetic events in the universe after the Big Bang,hence they provide a unique laboratory to study cluster physics.The two main mass components in clusters behave differently during collisions:the dark matter is nearly collisionless, responding only to gravity, while the gas is subject to pressure forces and dissipation, and shocks and turbulenceare developed during collisions. In the present contribution we review the different methods used to derive the physical properties of merging clusters. Different physical processes leave their signatures on different wavelengths, thusour review is based on a multifrequency analysis. In principle, the best way to analyze multifrequency observations of merging clustersis to model them using N-body/HYDRO numerical simulations. We discuss the results of such detailed analyses.New high spatial and spectral resolution ground and space based telescopeswill come online in the near future. Motivated by these new opportunities,we briefly discuss methods which will be feasible in the near future in studying merging clusters.

  6. The Durban Auto Cluster

    DEFF Research Database (Denmark)

    Lorentzen, Jochen; Robbins, Glen; Barnes, Justin

    2004-01-01

    The paper describes the formation of the Durban Auto Cluster in the context of trade liberalization. It argues that the improvement of operational competitiveness of firms in the cluster is prominently due to joint action. It tests this proposition by comparing the gains from cluster activities i...

  7. Controlled clustering of carboxylated SPIONs through polyethylenimine

    Energy Technology Data Exchange (ETDEWEB)

    Nesztor, Dániel; Bali, Krisztina; Tóth, Ildikó Y.; Szekeres, Márta; Tombácz, Etelka, E-mail: tombacz@chem.u-szeged.hu

    2015-04-15

    Clusters of magnetite nanoparticles (MNPs) were synthesized using poly(acrylic acid-co-maleic acid) coated MNPs (PAM@MNP) and branched polyethylenimine (PEI). Materials were characterized by potentiometric titration, zeta potential and dynamic light scattering (DLS) measurements. PEI and PAM@MNP are oppositely charged as characterized by zeta potential measurements (+8, −34 mV respectively) and titration (10.30 mmol −NH{sub 3}{sup +}/g PEI; 0.175 mmol −COO{sup −}/g PAM@MNP) at pH 6.5±0.2; therefore magnetic clusters are formed by electrostatic adhesion. Two different preparation methods and the effect of PEI and electrolyte (NaCl) concentration on the cluster formation was studied. Choosing an optimal concentration of PEI (charge ratio of PEI to PAM@MNP: 0.17) and electrolyte (10 mM), a concentrated (10 g MNP/L) product containing PEI–PAM@MNP nanoclusters with size of 165±10 nm was prepared. Its specific absorption rate (SAR) measured in AC magnetic field (110 kHz, 25 mT) is 12 W/g Fe. The clustered product is expected to have enhanced contrast efficiency in MRI. - Highlights: • SPION clusters of controlled size were prepared by means of electrostatic adhesion. • Nanocluster formation optimum was at 0.17 charge ratio of PEI to PAM@MNP. • Huge aggregates form at higher PEI to PAM@MNP charge ratio. • Higher ionic strength promotes the formation of clusters at lower PEI concentrations.

  8. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  9. Dicty_cDB: FCL-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC21 (Link to dictyBase) - - - Contig-U15479-1 FCL-AC21E ...(Link to Original site) - - - - - - FCL-AC21E 632 Show FCL-AC21 Library FCL (Link to library) Clone ID FCL-AC2... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC21Q.Seq.d/ Representative seq. ID FCL-AC2...1E (Link to Original site) Representative DNA sequence >FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC2...M/SL/SLG7-D/SLG773Q.Seq.d/ 1205 0.0 FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC21

  10. Cluster analysis for applications

    CERN Document Server

    Anderberg, Michael R

    1973-01-01

    Cluster Analysis for Applications deals with methods and various applications of cluster analysis. Topics covered range from variables and scales to measures of association among variables and among data units. Conceptual problems in cluster analysis are discussed, along with hierarchical and non-hierarchical clustering methods. The necessary elements of data analysis, statistics, cluster analysis, and computer implementation are integrated vertically to cover the complete path from raw data to a finished analysis.Comprised of 10 chapters, this book begins with an introduction to the subject o

  11. Management of cluster headache

    DEFF Research Database (Denmark)

    Tfelt-Hansen, Peer C; Jensen, Rigmor H

    2012-01-01

    and agitation. Patients may have up to eight attacks per day. Episodic cluster headache (ECH) occurs in clusters of weeks to months duration, whereas chronic cluster headache (CCH) attacks occur for more than 1 year without remissions. Management of cluster headache is divided into acute attack treatment....... In drug-resistant CCH, neuromodulation with either occipital nerve stimulation or deep brain stimulation of the hypothalamus is an alternative treatment strategy. For most cluster headache patients there are fairly good treatment options both for acute attacks and for prophylaxis. The big problem...

  12. Cluster Decline and Resilience

    DEFF Research Database (Denmark)

    Østergaard, Christian Richter; Park, Eun Kyung

    -2011. Our longitudinal study reveals that technological lock-in and exit of key firms have contributed to impairment of the cluster’s resilience in adapting to disruptions. Entrepreneurship has a positive effect on cluster resilience, while multinational companies have contradicting effects by bringing......Most studies on regional clusters focus on identifying factors and processes that make clusters grow. However, sometimes technologies and market conditions suddenly shift, and clusters decline. This paper analyses the process of decline of the wireless communication cluster in Denmark, 1963...

  13. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  14. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  15. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or...

  16. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area....

  17. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  18. Clustering high dimensional data

    DEFF Research Database (Denmark)

    Assent, Ira

    2012-01-01

    to render traditional clustering algorithms ineffective. The curse of dimensionality, among other effects, means that with increasing number of dimensions, a loss of meaningful differentiation between similar and dissimilar objects is observed. As high-dimensional objects appear almost alike, new approaches...... for clustering are required. Consequently, recent research has focused on developing techniques and clustering algorithms specifically for high-dimensional data. Still, open research issues remain. Clustering is a data mining task devoted to the automatic grouping of data based on mutual similarity. Each cluster...... that provide different cluster models and different algorithmic approaches for cluster detection. Common to all approaches is the fact that they require some underlying assessment of similarity between data objects. In this article, we provide an overview of the effects of high-dimensional spaces...

  19. Clusters in nuclei

    CERN Document Server

    Beck, Christian

    Following the pioneering discovery of alpha clustering and of molecular resonances, the field of nuclear clustering is today one of those domains of heavy-ion nuclear physics that faces the greatest challenges, yet also contains the greatest opportunities. After many summer schools and workshops, in particular over the last decade, the community of nuclear molecular physicists has decided to collaborate in producing a comprehensive collection of lectures and tutorial reviews covering the field. This third volume follows the successful Lect. Notes Phys. 818 (Vol. 1) and 848 (Vol. 2), and comprises six extensive lectures covering the following topics:  - Gamma Rays and Molecular Structure - Faddeev Equation Approach for Three Cluster Nuclear Reactions - Tomography of the Cluster Structure of Light Nuclei Via Relativistic Dissociation - Clustering Effects Within the Dinuclear Model : From Light to Hyper-heavy Molecules in Dynamical Mean-field Approach - Clusterization in Ternary Fission - Clusters in Light N...

  20. Unconventional methods for clustering

    Science.gov (United States)

    Kotyrba, Martin

    2016-06-01

    Cluster analysis or clustering is a task of grouping a set of objects in such a way that objects in the same group (called a cluster) are more similar (in some sense or another) to each other than to those in other groups (clusters). It is the main task of exploratory data mining and a common technique for statistical data analysis used in many fields, including machine learning, pattern recognition, image analysis, information retrieval, and bioinformatics. The topic of this paper is one of the modern methods of clustering namely SOM (Self Organising Map). The paper describes the theory needed to understand the principle of clustering and descriptions of algorithm used with clustering in our experiments.

  1. Spatial cluster modelling

    CERN Document Server

    Lawson, Andrew B

    2002-01-01

    Research has generated a number of advances in methods for spatial cluster modelling in recent years, particularly in the area of Bayesian cluster modelling. Along with these advances has come an explosion of interest in the potential applications of this work, especially in epidemiology and genome research. In one integrated volume, this book reviews the state-of-the-art in spatial clustering and spatial cluster modelling, bringing together research and applications previously scattered throughout the literature. It begins with an overview of the field, then presents a series of chapters that illuminate the nature and purpose of cluster modelling within different application areas, including astrophysics, epidemiology, ecology, and imaging. The focus then shifts to methods, with discussions on point and object process modelling, perfect sampling of cluster processes, partitioning in space and space-time, spatial and spatio-temporal process modelling, nonparametric methods for clustering, and spatio-temporal ...

  2. Carbon radioactivity of {sup 223}Ac and a search for nitrogen emission

    Energy Technology Data Exchange (ETDEWEB)

    Guglielmetti, A; Faccio, D; Bonetti, R [Istituto di Fisica Generale Applicata and INFN, Milano (Italy); Shishkin, S V; Tretyakova, S P [JINR, Dubna (Russian Federation); Dmitriev, S V; Ogloblin, A A; Pik-Pichak, G A [Kurchatov Institute, Moscow (Russian Federation); Meulen, N P van der; Steyn, G F; Walt, T N van der; Vermeulen, C; McGee, D [iThemba LABS, Somerset West 7129 (South Africa)], E-mail: Alessandra.Guglielmetti@mi.infn.it

    2008-05-15

    A very intense {sup 227}Pa source was produced in order to study the possible {sup 14}C and {sup 15}N spontaneous emission from {sup 223}Ac. After the irradiation of a hemispherical, highly efficient array of nuclear track detectors, about 350 Carbon events were found leading to a branching ratio with respect to alpha decay B = 3.2 10{sup -11}. Comparison with other {sup 14}C emitters allows the study of the influence of even-odd effects on cluster radioactivity.

  3. CLEAN: CLustering Enrichment ANalysis

    Directory of Open Access Journals (Sweden)

    Medvedovic Mario

    2009-07-01

    Full Text Available Abstract Background Integration of biological knowledge encoded in various lists of functionally related genes has become one of the most important aspects of analyzing genome-wide functional genomics data. In the context of cluster analysis, functional coherence of clusters established through such analyses have been used to identify biologically meaningful clusters, compare clustering algorithms and identify biological pathways associated with the biological process under investigation. Results We developed a computational framework for analytically and visually integrating knowledge-based functional categories with the cluster analysis of genomics data. The framework is based on the simple, conceptually appealing, and biologically interpretable gene-specific functional coherence score (CLEAN score. The score is derived by correlating the clustering structure as a whole with functional categories of interest. We directly demonstrate that integrating biological knowledge in this way improves the reproducibility of conclusions derived from cluster analysis. The CLEAN score differentiates between the levels of functional coherence for genes within the same cluster based on their membership in enriched functional categories. We show that this aspect results in higher reproducibility across independent datasets and produces more informative genes for distinguishing different sample types than the scores based on the traditional cluster-wide analysis. We also demonstrate the utility of the CLEAN framework in comparing clusterings produced by different algorithms. CLEAN was implemented as an add-on R package and can be downloaded at http://Clusteranalysis.org. The package integrates routines for calculating gene specific functional coherence scores and the open source interactive Java-based viewer Functional TreeView (FTreeView. Conclusion Our results indicate that using the gene-specific functional coherence score improves the reproducibility of the

  4. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  5. Agricultural Clusters in the Netherlands

    NARCIS (Netherlands)

    Schouten, M.A.; Heijman, W.J.M.

    2012-01-01

    Michael Porter was the first to use the term cluster in an economic context. He introduced the term in The Competitive Advantage of Nations (1990). The term cluster is also known as business cluster, industry cluster, competitive cluster or Porterian cluster. This article aims at determining and mea

  6. Lazy AC-Pattern Matching for Rewriting

    OpenAIRE

    Walid Belkhir; Alain Giorgetti

    2012-01-01

    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  7. AC plasma anemometer—characteristics and design

    Science.gov (United States)

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram

    2015-08-01

    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  8. Lazy AC-Pattern Matching for Rewriting

    Directory of Open Access Journals (Sweden)

    Walid Belkhir

    2012-04-01

    Full Text Available We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  9. The Hubble Legacy Archive ACS Grism Data

    CERN Document Server

    Kuemmel, M; Fosbury, R; Haase, J; Hook, R N; Kuntschner, H; Lombardi, M; Micol, A; Nilsson, K K; Stoehr, F; Walsh, J R

    2011-01-01

    A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 \\mu$m, with a dispersion of $40 \\ \\AA / pixel$ and a resolution of $\\sim 80\\ \\AA$ for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47,919 datasets (65% of the total number of extracted spect...

  10. AC susceptibilities of grain-textured superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Sakamoto, N. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan)], E-mail: saka@te.kyusan-u.ac.jp; Fukuda, Y.; Koga, M.; Akune, T. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan); Khan, H.R. [Institut von Ionenstrahl und Vakuum Technologie, 73728 Esslingen (Germany); Lueders, K. [Freie Universitaet Berlin, Arnimallee, Fac.Physik, D-14195 Berlin (Germany)

    2008-09-15

    In-phase {chi}{sub n}' and out-phase {chi}{sub n}'' components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field B{sub dc}, an amplitude B{sub a} and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low-T{sub c} metallic superconductors, {chi}{sub 1}' shows smooth transition and {chi}{sub 1}'' does single peak. High-T{sub c} oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in {chi}{sub 1}'' and shoulders in {chi}{sub 1}' appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  11. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    Institute of Scientific and Technical Information of China (English)

    万衡; 喻嬿; 黄道

    2002-01-01

    针对传统AC-DC-AC变换存在的缺陷,采用高频调制直接AC-AC变换技术,实现了两种不同结构的单相AC-AC直接变换器,对其特点和仿真结果进行了分析,并探讨了应用前景.

  12. Epidemiology Analysis of Streptococcus pyogenes in a Hospital in Southern Taiwan by Use of the Updated emm Cluster Typing System.

    Science.gov (United States)

    Chiang-Ni, Chuan; Zheng, Po-Xing; Wang, Shu-Ying; Tsai, Pei-Jane; Chuang, Woei-Jer; Lin, Yee-Shin; Liu, Ching-Chuan; Wu, Jiunn-Jong

    2016-01-01

    emm typing is the most widely used molecular typing method for the human pathogen Streptococcus pyogenes (group A streptococcus [GAS]). emm typing is based on a small variable region of the emm gene; however, the emm cluster typing system defines GAS types according to the nearly complete sequence of the emm gene. Therefore, emm cluster typing is considered to provide more information regarding the functional and structural properties of M proteins in different emm types of GAS. In the present study, 677 isolates collected between 1994 and 2008 in a hospital in southern Taiwan were analyzed by the emm cluster typing system. emm clusters A-C4, E1, E6, and A-C3 were the most prevalent emm cluster types and accounted for 67.4% of total isolates. emm clusters A-C4 and E1 were associated with noninvasive diseases, whereas E6 was significantly associated with both invasive and noninvasive manifestations. In addition, emm clusters D4, E2, and E3 were significantly associated with invasive manifestations. Furthermore, we found that the functional properties of M protein, including low fibrinogen-binding and high IgG-binding activities, were correlated significantly with invasive manifestations. In summary, the present study provides updated epidemiological information on GAS emm cluster types in southern Taiwan.

  13. Molecular biology of maize Ac/Ds elements: an overview.

    Science.gov (United States)

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard

    2013-01-01

    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  14. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  15. Clustering Categorical Data:A Cluster Ensemble Approach

    Institute of Scientific and Technical Information of China (English)

    He Zengyou(何增友); Xu Xiaofei; Deng Shengchun

    2003-01-01

    Clustering categorical data, an integral part of data mining,has attracted much attention recently. In this paper, the authors formally define the categorical data clustering problem as an optimization problem from the viewpoint of cluster ensemble, and apply cluster ensemble approach for clustering categorical data. Experimental results on real datasets show that better clustering accuracy can be obtained by comparing with existing categorical data clustering algorithms.

  16. Spatial Scan Statistic: Selecting clusters and generating elliptic clusters

    DEFF Research Database (Denmark)

    Christiansen, Lasse Engbo; Andersen, Jens Strodl

    2004-01-01

    The spatial scan statistic is widely used to search for clusters. This paper shows that the usually applied elimination of overlapping clusters to find secondary clusters is sensitive to smooth changes in the shape of the clusters. We present an algorithm for generation of set of confocal elliptic...... clusters. In addition, we propose a new way to present the information in a given set of clusters based on the significance of the clusters....

  17. Disentangling Porterian Clusters

    DEFF Research Database (Denmark)

    Jagtfelt, Tue

    This dissertation investigates the contemporary phenomenon of industrial clusters based on the work of Michael E. Porter, the central progenitor and promoter of the cluster notion. The dissertation pursues two central questions: 1) What is a cluster? and 2) How could Porter’s seemingly fuzzy...... to his membership on the Commission on Industrial Competitiveness, and that the cluster notion found in his influential book, Nations, represents a significant shift in his conception of cluster compared with his early conceptions. This shift, it is argued, is a deliberate attempt by Porter to create......, contested theory become so widely disseminated and applied as a normative and prescriptive strategy for economic development? The dissertation traces the introduction of the cluster notion into the EU’s Lisbon Strategy and demonstrates how its inclusion originates from Porter’s colleagues: Professor Örjan...

  18. Online Correlation Clustering

    CERN Document Server

    Mathieu, Claire; Schudy, Warren

    2010-01-01

    We study the online clustering problem where data items arrive in an online fashion. The algorithm maintains a clustering of data items into similarity classes. Upon arrival of v, the relation between v and previously arrived items is revealed, so that for each u we are told whether v is similar to u. The algorithm can create a new cluster for v and merge existing clusters. When the objective is to minimize disagreements between the clustering and the input, we prove that a natural greedy algorithm is O(n)-competitive, and this is optimal. When the objective is to maximize agreements between the clustering and the input, we prove that the greedy algorithm is .5-competitive; that no online algorithm can be better than .834-competitive; we prove that it is possible to get better than 1/2, by exhibiting a randomized algorithm with competitive ratio .5+c for a small positive fixed constant c.

  19. Melting of sodium clusters

    CERN Document Server

    Reyes-Nava, J A; Beltran, M R; Michaelian, K

    2002-01-01

    Thermal stability properties and the melting-like transition of Na_n, n=13-147, clusters are studied through microcanonical molecular dynamics simulations. The metallic bonding in the sodium clusters is mimicked by a many-body Gupta potential based on the second moment approximation of a tight-binding Hamiltonian. The characteristics of the solid-to-liquid transition in the sodium clusters are analyzed by calculating physical quantities like caloric curves, heat capacities, and root-mean-square bond length fluctuations using simulation times of several nanoseconds. Distinct melting mechanisms are obtained for the sodium clusters in the size range investigated. The calculated melting temperatures show an irregular variation with the cluster size, in qualitative agreement with recent experimental results. However, the calculated melting point for the Na_55 cluster is about 40 % lower than the experimental value.

  20. Cosmology with cluster surveys

    Indian Academy of Sciences (India)

    Subhabrata Majumdar

    2004-10-01

    Surveys of clusters of galaxies provide us with a powerful probe of the density and nature of the dark energy. The red-shift distribution of detected clusters is highly sensitive to the dark energy equation of state parameter . Upcoming Sunyaev–Zel'dovich (SZ) surveys would provide us large yields of clusters to very high red-shifts. Self-calibration of cluster scaling relations, possible for such a huge sample, would be able to constrain systematic biases on mass estimators. Combining cluster red-shift abundance with limited mass follow-up and cluster mass power spectrum can then give constraints on , as well as on 8 and to a few per cents.

  1. CSR in Industrial Clusters

    DEFF Research Database (Denmark)

    Lund-Thomsen, Peter; Pillay, Renginee G.

    2012-01-01

    Purpose – The paper seeks to review the literature on CSR in industrial clusters in developing countries, identifying the main strengths, weaknesses, and gaps in this literature, pointing to future research directions and policy implications in the area of CSR and industrial cluster development...... in this field and their comments incorporated in the final version submitted to Corporate Governance. Findings – The article traces the origins of the debate on industrial clusters and CSR in developing countries back to the early 1990s when clusters began to be seen as an important vehicle for local economic...... development in the South. At the turn of the millennium the industrial cluster debate expanded as clusters were perceived as a potential source of poverty reduction, while their role in promoting CSR among small and medium-sized enterprises began to take shape from 2006 onwards. At present, there is still...

  2. Cluster Management Institutionalization

    DEFF Research Database (Denmark)

    Normann, Leo; Agger Nielsen, Jeppe

    2015-01-01

    This article explores a new management form – cluster management – in Danish public sector day care. Although cluster management has been widely adopted in Danish day care at the municipality level, it has attracted only sparse research attention. We use theoretical insights from Scandinavian...... institutionalism together with a longitudinal case-based inquiry into how cluster management has entered and penetrated the management practices of day care in Denmark. We demonstrate how cluster management became widely adopted in the day care field not only because of its intrinsic properties but also because...... of how it was legitimized as a “ready-to-use” management model. Further, our account reveals how cluster management translated into considerably different local variants as it travelled into specific organizations. However, these processes have not occurred sequentially with cluster management first...

  3. The Hubble Space Telescope Cluster Supernova Survey: V. Improving the Dark Energy Constraints Above z>1 and Building an Early-Type-Hosted Supernova Sample

    CERN Document Server

    Suzuki, N; Lidman, C; Aldering, G; Amanullah, R; Barbary, K; Barrientos, L F; Botyanszki, J; Brodwin, M; Connolly, N; Dawson, K S; Dey, A; Doi, M; Donahue, M; Deustua, S; Eisenhardt, P; Ellingson, E; Faccioli, L; Fadeyev, V; Fakhouri, H K; Fruchter, A S; Gilbank, D G; Gladders, M D; Goldhaber, G; Gonzalez, A H; Goobar, A; Gude, A; Hattori, T; Hoekstra, H; Hsiao, E; Huang, X; Ihara, Y; Jee, M J; Johnston, D; Kashikawa, N; Koester, B; Konishi, K; Kowalski, M; Linder, E V; Lubin, L; Melbourne, J; Meyers, J; Morokuma, T; Munshi, F; Mullis, C; Oda, T; Panagia, N; Perlmutter, S; Postman, M; Pritchard, T; Rhodes, J; Ripoche, P; Rosati, P; Schlegel, D J; Spadafora, A; Stanford, S A; Stanishev, V; Stern, D; Strovink, M; Takanashi, N; Tokita, K; Wagner, M; Wang, L; Yasuda, N; Yee, H K C

    2011-01-01

    We present ACS, NICMOS, and Keck AO-assisted photometry of 20 Type Ia supernovae SNe Ia from the HST Cluster Supernova Survey. The SNe Ia were discovered over the redshift interval 0.623 1 SNe Ia. We describe how such a sample could be efficiently obtained by targeting cluster fields with WFC3 on HST.

  4. Structures in Galaxy Clusters

    CERN Document Server

    Escalera, E; Girardi, M; Giuricin, G; Mardirossian, F; Mazure, A; Mezzetti, M

    1993-01-01

    The analysis of the presence of substructures in 16 well-sampled clusters of galaxies suggests a stimulating hypothesis: Clusters could be classified as unimodal or bimodal, on the basis of to the sub-clump distribution in the {\\em 3-D} space of positions and velocities. The dynamic study of these clusters shows that their fundamental characteristics, in particular the virial masses, are not severely biased by the presence of subclustering if the system considered is bound.

  5. Clustering Techniques in Bioinformatics

    Directory of Open Access Journals (Sweden)

    Muhammad Ali Masood

    2015-01-01

    Full Text Available Dealing with data means to group information into a set of categories either in order to learn new artifacts or understand new domains. For this purpose researchers have always looked for the hidden patterns in data that can be defined and compared with other known notions based on the similarity or dissimilarity of their attributes according to well-defined rules. Data mining, having the tools of data classification and data clustering, is one of the most powerful techniques to deal with data in such a manner that it can help researchers identify the required information. As a step forward to address this challenge, experts have utilized clustering techniques as a mean of exploring hidden structure and patterns in underlying data. Improved stability, robustness and accuracy of unsupervised data classification in many fields including pattern recognition, machine learning, information retrieval, image analysis and bioinformatics, clustering has proven itself as a reliable tool. To identify the clusters in datasets algorithm are utilized to partition data set into several groups based on the similarity within a group. There is no specific clustering algorithm, but various algorithms are utilized based on domain of data that constitutes a cluster and the level of efficiency required. Clustering techniques are categorized based upon different approaches. This paper is a survey of few clustering techniques out of many in data mining. For the purpose five of the most common clustering techniques out of many have been discussed. The clustering techniques which have been surveyed are: K-medoids, K-means, Fuzzy C-means, Density-Based Spatial Clustering of Applications with Noise (DBSCAN and Self-Organizing Map (SOM clustering.

  6. Clustering of Absorbers

    CERN Document Server

    Cristiani, S; D'Odorico, V; Fontana, A; Giallongo, E; Moscardini, L; Savaglio, S

    1997-01-01

    The observed clustering of Lyman-$\\alpha$ lines is reviewed and compared with the clustering of CIV systems. We argue that a continuity of properties exists between Lyman-$\\alpha$ and metal systems and show that the small-scale clustering of the absorbers is consistent with a scenario of gravitationally induced correlations. At large scales statistically significant over and under-densities (including voids) are found on scales of tens of Mpc.

  7. Globular cluster systems of six shell galaxies

    CERN Document Server

    Sikkema, G; Carter, D; Valentijn, E A; Balcells, M

    2006-01-01

    Shells in Elliptical Galaxies are faint, sharp-edged features, believed to provide evidence of a recent ($\\sim 0.5 - 2 \\times 10^9$ years ago) merger event. We analyse the Globular Cluster (GC) systems of six shell elliptical galaxies, to examine the effects of mergers upon the GC formation history. We examine the colour distributions, and investigate differences between red and blue globular cluster populations. We present luminosity functions, spatial distributions and specific frequencies ($S_N$) at 50 kpc radius for our sample. We present V and I magnitudes for cluster candidates measured with the HST Advanced Camera for Surveys (ACS). Galaxy background light is modelled and removed, and magnitudes are measured in 8 pixel (0.4 arcsec) diameter apertures. Background contamination is removed using counts from HDFS. We find that the colour distributions for NGC 3923 and NGC 5982 have a bimodal form typical of bright ellipticals, with peaks near $V-I=0.92 \\pm 0.04$ and $V-I=1.18 \\pm 0.06$. In NGC 7626, we fin...

  8. Star Clusters within FIRE

    Science.gov (United States)

    Perez, Adrianna; Moreno, Jorge; Naiman, Jill; Ramirez-Ruiz, Enrico; Hopkins, Philip F.

    2017-01-01

    In this work, we analyze the environments surrounding star clusters of simulated merging galaxies. Our framework employs Feedback In Realistic Environments (FIRE) model (Hopkins et al., 2014). The FIRE project is a high resolution cosmological simulation that resolves star forming regions and incorporates stellar feedback in a physically realistic way. The project focuses on analyzing the properties of the star clusters formed in merging galaxies. The locations of these star clusters are identified with astrodendro.py, a publicly available dendrogram algorithm. Once star cluster properties are extracted, they will be used to create a sub-grid (smaller than the resolution scale of FIRE) of gas confinement in these clusters. Then, we can examine how the star clusters interact with these available gas reservoirs (either by accreting this mass or blowing it out via feedback), which will determine many properties of the cluster (star formation history, compact object accretion, etc). These simulations will further our understanding of star formation within stellar clusters during galaxy evolution. In the future, we aim to enhance sub-grid prescriptions for feedback specific to processes within star clusters; such as, interaction with stellar winds and gas accretion onto black holes and neutron stars.

  9. The Youngest Globular Clusters

    CERN Document Server

    Beck, Sara

    2014-01-01

    It is likely that all stars are born in clusters, but most clusters are not bound and disperse. None of the many protoclusters in our Galaxy are likely to develop into long-lived bound clusters. The Super Star Clusters (SSCs) seen in starburst galaxies are more massive and compact and have better chances of survival. The birth and early development of SSCs takes place deep in molecular clouds, and during this crucial stage the embedded clusters are invisible to optical or UV observations but are studied via the radio-infared supernebulae (RISN) they excite. We review observations of embedded clusters and identify RISN within 10 Mpc whose exciting clusters have a million solar masses or more in volumes of a few cubic parsecs and which are likely to not only survive as bound clusters, but to evolve into objects as massive and compact as Galactic globulars. These clusters are distinguished by very high star formation efficiency eta, at least a factor of 10 higher than the few percent seen in the Galaxy, probably...

  10. 15th Cluster workshop

    CERN Document Server

    Laakso, Harri; Escoubet, C. Philippe; The Cluster Active Archive : Studying the Earth’s Space Plasma Environment

    2010-01-01

    Since the year 2000 the ESA Cluster mission has been investigating the small-scale structures and processes of the Earth's plasma environment, such as those involved in the interaction between the solar wind and the magnetospheric plasma, in global magnetotail dynamics, in cross-tail currents, and in the formation and dynamics of the neutral line and of plasmoids. This book contains presentations made at the 15th Cluster workshop held in March 2008. It also presents several articles about the Cluster Active Archive and its datasets, a few overview papers on the Cluster mission, and articles reporting on scientific findings on the solar wind, the magnetosheath, the magnetopause and the magnetotail.

  11. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    Institute of Scientific and Technical Information of China (English)

    周振军; 李磊

    2011-01-01

    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  12. Document Clustering Based on Semi-Supervised Term Clustering

    Directory of Open Access Journals (Sweden)

    Hamid Mahmoodi

    2012-05-01

    Full Text Available The study is conducted to propose a multi-step feature (term selection process and in semi-supervised fashion, provide initial centers for term clusters. Then utilize the fuzzy c-means (FCM clustering algorithm for clustering terms. Finally assign each of documents to closest associated term clusters. While most text clustering algorithms directly use documents for clustering, we propose to first group the terms using FCM algorithm and then cluster documents based on terms clusters. We evaluate effectiveness of our technique on several standard text collections and compare our results with the some classical text clustering algorithms.

  13. Hierarchically Clustered Star Formation in the Magellanic Clouds

    CERN Document Server

    Gouliermis, Dimitrios A; Ossenkopf, Volker; Klessen, Ralf S; Dolphin, Andrew E

    2012-01-01

    We present a cluster analysis of the bright main-sequence and faint pre--main-sequence stellar populations of a field ~ 90 x 90 pc centered on the HII region NGC 346/N66 in the Small Magellanic Cloud, from imaging with HST/ACS. We extend our earlier analysis on the stellar cluster population in the region to characterize the structuring behavior of young stars in the region as a whole with the use of stellar density maps interpreted through techniques designed for the study of the ISM structuring. In particular, we demonstrate with Cartwrigth & Whitworth's Q parameter, dendrograms, and the Delta-variance wavelet transform technique that the young stellar populations in the region NGC 346/N66 are hierarchically clustered, in agreement with other regions in the Magellanic Clouds observed with HST. The origin of this hierarchy is currently under investigation.

  14. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  15. The Antennae Galaxies (NGC 4038/4039) Revisited: ACS and NICMOS Observations of a Prototypical Merger

    CERN Document Server

    Whitmore, Bradley C; Schweizer, Francois; Rothberg, Barry; Leitherer, Claus; Rieke, Marcia; Rieke, George; Blair, W P; Mengel, S; Alonso-Herrero, A

    2010-01-01

    The ACS and NICMOS have been used to obtain new HST images of NGC 4038/4039 ("The Antennae"). These new observations allow us to better differentiate compact star clusters from individual stars, based on both size and color. We use this ability to extend the cluster luminosity function by approximately two magnitudes over our previous WFPC2 results, and find that it continues as a single power law, dN/dL propto L^alpha with alpha=-2.13+/-0.07, down to the observational limit of Mv~-7. Similarly, the mass function is a single power law dN/dM propto M^beta with beta=-2.10+/-0.20 for clusters with ages t<3x10^8 yr, corresponding to lower mass limits that range from 10^4 to 10^5 Msun, depending on the age range of the subsample. Hence the power law indices for the luminosity and mass functions are essentially the same. The luminosity function for intermediate-age clusters (i.e., ~100-300 Myr old objects found in the loops, tails, and outer areas) shows no bend or turnover down to Mv~-6, consistent with relaxat...

  16. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  17. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  18. Clustering Text Data Streams

    Institute of Scientific and Technical Information of China (English)

    Yu-Bao Liu; Jia-Rong Cai; Jian Yin; Ada Wai-Chee Fu

    2008-01-01

    Clustering text data streams is an important issue in data mining community and has a number of applications such as news group filtering, text crawling, document organization and topic detection and tracing etc. However, most methods are similarity-based approaches and only use the TF*IDF scheme to represent the semantics of text data and often lead to poor clustering quality. Recently, researchers argue that semantic smoothing model is more efficient than the existing TF.IDF scheme for improving text clustering quality. However, the existing semantic smoothing model is not suitable for dynamic text data context. In this paper, we extend the semantic smoothing model into text data streams context firstly. Based on the extended model, we then present two online clustering algorithms OCTS and OCTSM for the clustering of massive text data streams. In both algorithms, we also present a new cluster statistics structure named cluster profile which can capture the semantics of text data streams dynamically and at the same time speed up the clustering process. Some efficient implementations for our algorithms are also given. Finally, we present a series of experimental results illustrating the effectiveness of our technique.

  19. Neurostimulation in cluster headache

    DEFF Research Database (Denmark)

    Pedersen, Jeppe L; Barloese, Mads; Jensen, Rigmor H

    2013-01-01

    PURPOSE OF REVIEW: Neurostimulation has emerged as a viable treatment for intractable chronic cluster headache. Several therapeutic strategies are being investigated including stimulation of the hypothalamus, occipital nerves and sphenopalatine ganglion. The aim of this review is to provide...... effective strategy must be preferred as first-line therapy for intractable chronic cluster headache....

  20. Securing personal network clusters

    NARCIS (Netherlands)

    Jehangir, Assed; Heemstra de Groot, Sonia M.

    2007-01-01

    A Personal Network is a self-organizing, secure and private network of a user’s devices notwithstanding their geographic location. It aims to utilize pervasive computing to provide users with new and improved services. In this paper we propose a model for securing Personal Network clusters. Clusters

  1. [Cluster headache differential diagnosis].

    Science.gov (United States)

    Guégan-Massardier, Evelyne; Laubier, Cécile

    2015-11-01

    Cluster headache is characterized by disabling stereotyped headache. Early diagnosis allows appropriate treatment, unfortunately diagnostic errors are frequent. The main differential diagnoses are other primary or essential headaches. Migraine, more frequent and whose diagnosis is carried by excess, trigeminal neuralgia or other trigemino-autonomic cephalgia. Vascular or tumoral underlying condition can mimic cluster headache, neck and brain imaging is recommended, ideally MRI.

  2. Coma cluster of galaxies

    Science.gov (United States)

    1999-01-01

    Atlas Image mosaic, covering 34' x 34' on the sky, of the Coma cluster, aka Abell 1656. This is a particularly rich cluster of individual galaxies (over 1000 members), most prominently the two giant ellipticals, NGC 4874 (right) and NGC 4889 (left). The remaining members are mostly smaller ellipticals, but spiral galaxies are also evident in the 2MASS image. The cluster is seen toward the constellation Coma Berenices, but is actually at a distance of about 100 Mpc (330 million light years, or a redshift of 0.023) from us. At this distance, the cluster is in what is known as the 'Hubble flow,' or the overall expansion of the Universe. As such, astronomers can measure the Hubble Constant, or the universal expansion rate, based on the distance to this cluster. Large, rich clusters, such as Coma, allow astronomers to measure the 'missing mass,' i.e., the matter in the cluster that we cannot see, since it gravitationally influences the motions of the member galaxies within the cluster. The near-infrared maps the overall luminous mass content of the member galaxies, since the light at these wavelengths is dominated by the more numerous older stellar populations. Galaxies, as seen by 2MASS, look fairly smooth and homogeneous, as can be seen from the Hubble 'tuning fork' diagram of near-infrared galaxy morphology. Image mosaic by S. Van Dyk (IPAC).

  3. Cluster Management Institutionalization

    DEFF Research Database (Denmark)

    Normann, Leo; Agger Nielsen, Jeppe

    2015-01-01

    This article explores a new management form – cluster management – in Danish public sector day care. Although cluster management has been widely adopted in Danish day care at the municipality level, it has attracted only sparse research attention. We use theoretical insights from Scandinavian ins...

  4. Cluster Synchronization Algorithms

    NARCIS (Netherlands)

    Xia, Weiguo; Cao, Ming

    2010-01-01

    This paper presents two approaches to achieving cluster synchronization in dynamical multi-agent systems. In contrast to the widely studied synchronization behavior, where all the coupled agents converge to the same value asymptotically, in the cluster synchronization problem studied in this paper,

  5. Cost-Effective Clustering

    CERN Document Server

    Gottlieb, S

    2001-01-01

    Small Beowulf clusters can effectively serve as personal or group supercomputers. In such an environment, a cluster can be optimally designed for a specific problem (or a small set of codes). We discuss how theoretical analysis of the code and benchmarking on similar hardware lead to optimal systems.

  6. Relevant Subspace Clustering

    DEFF Research Database (Denmark)

    Müller, Emmanuel; Assent, Ira; Günnemann, Stephan;

    2009-01-01

    Subspace clustering aims at detecting clusters in any subspace projection of a high dimensional space. As the number of possible subspace projections is exponential in the number of dimensions, the result is often tremendously large. Recent approaches fail to reduce results to relevant subspace c...

  7. On TPC cluster reconstruction

    CERN Document Server

    Dydak, F; Nefedov, Y; Wotschack, J; Zhemchugov, A

    2004-01-01

    For a bias-free momentum measurement of TPC tracks, the correct determination of cluster positions is mandatory. We argue in particular that (i) the reconstruction of the entire longitudinal signal shape in view of longitudinal diffusion, electronic pulse shaping, and track inclination is important both for the polar angle reconstruction and for optimum r phi resolution; and that (ii) self-crosstalk of pad signals calls for special measures for the reconstruction of the z coordinate. The problem of 'shadow clusters' is resolved. Algorithms are presented for accepting clusters as 'good' clusters, and for the reconstruction of the r phi and z cluster coordinates, including provisions for 'bad' pads and pads next to sector boundaries, respectively.

  8. Job Oriented Monitoring Clusters

    Directory of Open Access Journals (Sweden)

    Vijayalaxmi Cigala,

    2011-03-01

    Full Text Available There has been a lot of development in the field of clusters and grids. Recently, the use of clusters has been on rise in every possible field. This paper proposes a system that monitors jobs onlarge computational clusters. Monitoring jobs is essential to understand how jobs are being executed. This helps us in understanding the complete life cycle of the jobs being executed on large clusters. Also, this paper describes how the information obtained by monitoring the jobs would help in increasing the overall throughput of clusters. Heuristics help in efficient job distribution among the computational nodes, thereby accomplishing fair job distribution policy. The proposed system would be capable of loadbalancing among the computational nodes, detecting failures, taking corrective actions after failure detection, job monitoring, system resource monitoring, etc.

  9. Neutrosophic Hierarchical Clustering Algoritms

    Directory of Open Access Journals (Sweden)

    Rıdvan Şahin

    2014-03-01

    Full Text Available Interval neutrosophic set (INS is a generalization of interval valued intuitionistic fuzzy set (IVIFS, whose the membership and non-membership values of elements consist of fuzzy range, while single valued neutrosophic set (SVNS is regarded as extension of intuitionistic fuzzy set (IFS. In this paper, we extend the hierarchical clustering techniques proposed for IFSs and IVIFSs to SVNSs and INSs respectively. Based on the traditional hierarchical clustering procedure, the single valued neutrosophic aggregation operator, and the basic distance measures between SVNSs, we define a single valued neutrosophic hierarchical clustering algorithm for clustering SVNSs. Then we extend the algorithm to classify an interval neutrosophic data. Finally, we present some numerical examples in order to show the effectiveness and availability of the developed clustering algorithms.

  10. A Commodity Computing Cluster

    Science.gov (United States)

    Teuben, P. J.; Wolfire, M. G.; Pound, M. W.; Mundy, L. G.

    We have assembled a cluster of Intel-Pentium based PCs running Linux to compute a large set of Photodissociation Region (PDR) and Dust Continuum models. For various reasons the cluster is heterogeneous, currently ranging from a single Pentium-II 333 MHz to dual Pentium-III 450 MHz CPU machines. Although this will be sufficient for our ``embarrassingly parallelizable problem'' it may present some challenges for as yet unplanned future use. In addition the cluster was used to construct a MIRIAD benchmark, and compared to equivalent Ultra-Sparc based workstations. Currently the cluster consists of 8 machines, 14 CPUs, 50GB of disk-space, and a total peak speed of 5.83 GHz, or about 1.5 Gflops. The total cost of this cluster has been about $12,000, including all cabling, networking equipment, rack, and a CD-R backup system. The URL for this project is http://dustem.astro.umd.edu.

  11. Mathematical classification and clustering

    CERN Document Server

    Mirkin, Boris

    1996-01-01

    I am very happy to have this opportunity to present the work of Boris Mirkin, a distinguished Russian scholar in the areas of data analysis and decision making methodologies. The monograph is devoted entirely to clustering, a discipline dispersed through many theoretical and application areas, from mathematical statistics and combina­ torial optimization to biology, sociology and organizational structures. It compiles an immense amount of research done to date, including many original Russian de­ velopments never presented to the international community before (for instance, cluster-by-cluster versions of the K-Means method in Chapter 4 or uniform par­ titioning in Chapter 5). The author's approach, approximation clustering, allows him both to systematize a great part of the discipline and to develop many in­ novative methods in the framework of optimization problems. The optimization methods considered are proved to be meaningful in the contexts of data analysis and clustering. The material presented in ...

  12. Cool Cluster Correctly Correlated

    Energy Technology Data Exchange (ETDEWEB)

    Varganov, Sergey Aleksandrovich [Iowa State Univ., Ames, IA (United States)

    2005-01-01

    Atomic clusters are unique objects, which occupy an intermediate position between atoms and condensed matter systems. For a long time it was thought that physical and chemical properties of atomic dusters monotonically change with increasing size of the cluster from a single atom to a condensed matter system. However, recently it has become clear that many properties of atomic clusters can change drastically with the size of the clusters. Because physical and chemical properties of clusters can be adjusted simply by changing the cluster's size, different applications of atomic clusters were proposed. One example is the catalytic activity of clusters of specific sizes in different chemical reactions. Another example is a potential application of atomic clusters in microelectronics, where their band gaps can be adjusted by simply changing cluster sizes. In recent years significant advances in experimental techniques allow one to synthesize and study atomic clusters of specified sizes. However, the interpretation of the results is often difficult. The theoretical methods are frequently used to help in interpretation of complex experimental data. Most of the theoretical approaches have been based on empirical or semiempirical methods. These methods allow one to study large and small dusters using the same approximations. However, since empirical and semiempirical methods rely on simple models with many parameters, it is often difficult to estimate the quantitative and even qualitative accuracy of the results. On the other hand, because of significant advances in quantum chemical methods and computer capabilities, it is now possible to do high quality ab-initio calculations not only on systems of few atoms but on clusters of practical interest as well. In addition to accurate results for specific clusters, such methods can be used for benchmarking of different empirical and semiempirical approaches. The atomic clusters studied in this work contain from a few atoms

  13. VizieR Online Data Catalog: Photometry of star clusters in 5 nearby gal. (Silva-Villa+, 2011)

    Science.gov (United States)

    Silva-Villa, E.; Larsen, S.

    2011-03-01

    Using HST/ACS and HST/WFPC2 images of the galaxies NGC 45, NGC 1313, NGC 5236, and NGC 7793, we estimate star formation histories by means of the synthetic CMD method. Masses and ages of star clusters are estimated using simple stellar population model fitting. Comparing observed and modeled luminosity functions, we estimate cluster formation rates. By randomly sampling the stellar initial mass function (SIMF), we construct artificial star clusters and quantify how stochastic effects influence cluster detection, integrated colors, and age estimates. (6 data files).

  14. POWER FACTOR IMPROVEMENT IN THREE PHASE AC-AC CONVERTER THROUGH MODIFIED SPWM

    Directory of Open Access Journals (Sweden)

    P.VASUKI,

    2011-02-01

    Full Text Available Recently, a new generation of ac-ac single-phase and three-phase power converters with more commutations per half cycle has been proposed for ac power due to the increasing availability and power capability of high frequency controlled-on and off power emiconductor switching devices. This paper presents three phase ac-acconverter whose control strategy is based on modified sinusoidal ulse-width modulation switching technique. As majority of the industrial loads are being inductive, the power factor is less. To improve the power factor, the delayed current is shifted to the input voltage, through a modification of the classical sinusoidal pulse width modulation switching technique. In this way, the decrease in the phase angle between the input current and voltage is feasible, and consequently, high cost compensation capacitors can be avoided. The improvement of power factor through this switching technique on the proposed converter is investigated and verified via simulation using the software Matlab/Simulink.

  15. Blue Straggler Stars in the Unusual Globular Cluster NGC 6388

    CERN Document Server

    Dalessandro, E; Ferraro, F R; Rood, R T; Milone, A; Piotto, G; Valenti, E

    2007-01-01

    We have used multi-band high resolution HST WFPC2 and ACS observations combined with wide field ground-based observations to study the blue straggler star (BSS) population in the galactic globular cluster NGC 6388. As in several other clusters we have studied, the BSS distribution is found to be bimodal: highly peaked in the cluster center, rapidly decreasing at intermediate radii, and rising again at larger radii. In other clusters the sparsely populated intermediate-radius region (or ``zone of avoidance'') corresponds well to that part of the cluster where dynamical friction would have caused the more massive BSS or their binary progenitors to settle to the cluster center. Instead, in NGC 6388, BSS still populate a region that should have been cleaned out by dynamical friction effects, thus suggesting that dynamical friction is somehow less efficient than expected. As by-product of these observations, the peculiar morphology of the horizontal branch (HB) is also confirmed. In particular, within the (very ex...

  16. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  17. Electrothermally driven flows in ac electrowetting.

    Science.gov (United States)

    García-Sánchez, Pablo; Ramos, Antonio; Mugele, Frieder

    2010-01-01

    Mixing within sessile drops can be enhanced by generating internal flow patterns using ac electrowetting. While for low ac frequencies, the flow patterns have been attributed to oscillations of the drop surface, we provide here the driving mechanism of the hitherto unexplained high-frequency flows. We show that: (1) the electric field in the liquid bulk becomes important, leading to energy dissipation due to Joule heating and a temperature increase of several degrees Celsius, and (2) the fluid flow at these frequencies is generated by electrothermal effect, i.e., gradients in temperature give rise to gradients in conductivity and permittivity, the electric field acting on these inhomogeneities induces an electrical body force that generates the flow. We solved numerically the equations for the electric, temperature and flow fields. The temperature is obtained from a convection-diffusion equation where Joule heating is introduced as a source term. From the solution of the electric field and the temperature, we compute the electrical force that acts as a body force in Stokes equations. Our numerical results agree with previous experimental observations.

  18. Transport AC Losses in Striated YBCO Coated Conductors (Postprint)

    Science.gov (United States)

    2012-02-01

    AFRL-RZ-WP-TP-2012-0124 TRANSPORT AC LOSSES IN STRIATED YBCO COATED CONDUCTORS (POSTPRINT) G.A. Levin and P.N. Barnes Mechanical Energy...TRANSPORT AC LOSSES IN STRIATED YBCO COATED CONDUCTORS (POSTPRINT) 5a. CONTRACT NUMBER In-house 5b. GRANT NUMBER 5c. PROGRAM ELEMENT...2006. 14. ABSTRACT DC current-voltage characteristics and transport ac losses of striated and non-striated Y1Ba2Cu3O7-δ ( YBCO ) coated conductors

  19. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  20. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  1. Cluster knockout reactions

    Indian Academy of Sciences (India)

    Arun K Jain; B N Joshi

    2014-04-01

    Cluster knockout reactions are expected to reveal the amount of clustering (such as that of , d and even of heavier clusters such as 12C, 16O etc.) in the target nucleus. In simple terms, incident medium high-energy nuclear projectile interacts strongly with the cluster (present in the target nucleus) as if it were existing as a free entity. Theoretically, the relatively softer interactions of the two outgoing particles with the residual nucleus lead to optical distortions and are treated in terms of distorted wave (DW) formalism. The long-range projectile–cluster interaction is accounted for, in terms of the finite range (FR) direct reaction formalism, as against the more commonly adopted zero-range (ZR) distorted wave impulse approximation (DWIA) formalism. Comparison of the DWIA calculations with the observed data provide information about the momentum distribution and the clustering spectroscopic factor of the target nucleus. Interesting results and some recent advancements in the area of (, 2) reactions and heavy cluster knockout reactions are discussed. Importance of the finite-range vertex and the final-state interactions are brought out.

  2. Software-Defined Cluster

    Institute of Scientific and Technical Information of China (English)

    聂华; 杨晓君; 刘淘英

    2015-01-01

    The cluster architecture has played an important role in high-end computing for the past 20 years. With the advent of Internet services, big data, and cloud computing, traditional clusters face three challenges: 1) providing flexible system balance among computing, memory, and I/O capabilities;2) reducing resource pooling overheads;and 3) addressing low performance-power efficiency. This position paper proposes a software-defined cluster (SDC) architecture to deal with these challenges. The SDC architecture inherits two features of traditional cluster: its architecture is multicomputer and it has loosely-coupled interconnect. SDC provides two new mechanisms: global I/O space (GIO) and hardware-supported native access (HNA) to remote devices. Application software can define a virtual cluster best suited to its needs from resources pools provided by a physical cluster, and traditional cluster ecosystems need no modification. We also discuss a prototype design and implementation of a 32-processor cloud server utilizing the SDC architecture.

  3. Spanning Tree Based Attribute Clustering

    DEFF Research Database (Denmark)

    Zeng, Yifeng; Jorge, Cordero Hernandez

    2009-01-01

    inconsistent edges from a maximum spanning tree by starting appropriate initial modes, therefore generating stable clusters. It discovers sound clusters through simple graph operations and achieves significant computational savings. We compare the Star Discovery algorithm against earlier attribute clustering...

  4. Textile Industrial Clusters in China

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    "National Textile Industry Cluster Development Seminar" convened, held by China National Textile and Apparel Council, 23 cities and towns were awarded as China’s Textile Industry Cluster Pilot District. By far, China’s textile industrial clusters have grown

  5. Allodynia in Cluster Headache.

    Science.gov (United States)

    Wilbrink, Leopoldine A; Louter, Mark A; Teernstra, Onno Pm; van Zwet, Erik W; Huygen, Frank Jpm; Haan, Joost; Ferrari, Michel D; Terwindt, Gisela M

    2017-03-04

    Cutaneous allodynia is an established marker for central sensitization in migraine. There is debate whether cutaneous allodynia may also occur in cluster headache, another episodic headache disorder. Here we examined the presence and severity of allodynia in a large well-defined nation-wide population of people with cluster headache.Using validated questionnaires we assessed, cross-sectionally, ictal allodynia and comorbid depression and migraine in the nation-wide "Leiden University Cluster headache neuro-Analysis" (LUCA) study. Participants with cluster headache were diagnosed according to the International Classification of Headache Disorders criteria. Multivariate regression models were used, with correction for demographic factors and cluster headache subtype (chronic vs. episodic; recent attacks cluster headache responded of whom 218/606 (36%) had allodynia during attacks. Female gender (OR 2.05, 95% CI 1.28-3.29), low age at onset (OR 0.98, 95% CI 0.96- 0.99), lifetime depression (OR 1.63; 95% CI 1.06-2.50), comorbid migraine (OR 1.96; 95% CI 1.02-3.79), and having recent attacks (OR 1.80; 95% CI 1.13-2.86), but not duration of attacks and chronic cluster headache, were independent risk factors for allodynia.The high prevalence of cutaneous allodynia with similar risk factors for allodynia as found for migraine suggests that central sensitization, like in migraine, also occurs in cluster headache. In clinical practice, awareness that people with cluster headache may suffer from allodynia can in the future be an important feature in treatment options.

  6. Distribution of star formation rates during the rapid assembly of NGC 1399 as deduced from its globular cluster system

    Science.gov (United States)

    Schulz, C.; Hilker, M.; Kroupa, P.; Pflamm-Altenburg, J.

    2016-10-01

    Ultra-compact dwarf galaxies (UCDs) share many properties with globular clusters (GCs) and are found in similar environments. Here, a large sample of UCDs and GCs around NGC 1399, the central giant elliptical of the Fornax galaxy cluster, is used to infer their formation history and also to shed light on the formation of NGC 1399 itself. We assumed that all GCs and UCDs in our sample are the result of star cluster (SC) formation processes and used them as tracers of past star formation activities. After correcting our GC/UCD sample for mass loss, we interpreted their overall mass function to be a superposition of SC populations that formed coevally during different formation epochs. The SC masses of each population were distributed according to the embedded cluster mass function (ECMF), a pure power law with the slope - β. Each ECMF was characterized by a stellar upper mass limit, Mmax, which depended on the star formation rate (SFR). We decomposed the observed GC/UCD mass function into individual SC populations and converted Mmax of each SC population to an SFR. The overall distribution of SFRs reveals under which conditions the GC/UCD sample around NGC 1399 formed. Considering the constraints set by the age of the GCs/UCDs and the present stellar mass of NGC 1399, we found that the formation of the GCs/UCDs can be well explained within our framework with values for β below 2.3. This finding agrees very well with the observation of young SCs where β ≈ 2.0 is usually found. Even though we took into account that some of the most massive objects might not be genuine SCs and applied different corrections for the mass loss, we found that these considerations do not influence much the outcome. We derived the peak SFRs to be between approximately 300 and 3000 M⊙ yr-1, which matches the SFRs observed in massive high-redshift sub-millimeter galaxies and an SFR estimate inferred from NGC 1399 based on the so-called downsizing picture, meaning that more massive

  7. Introduction to cluster dynamics

    CERN Document Server

    Reinhard, Paul-Gerhard

    2008-01-01

    Clusters as mesoscopic particles represent an intermediate state of matter between single atoms and solid material. The tendency to miniaturise technical objects requires knowledge about systems which contain a ""small"" number of atoms or molecules only. This is all the more true for dynamical aspects, particularly in relation to the qick development of laser technology and femtosecond spectroscopy. Here, for the first time is a highly qualitative introduction to cluster physics. With its emphasis on cluster dynamics, this will be vital to everyone involved in this interdisciplinary subje

  8. ClusterAlive

    Science.gov (United States)

    Caruso, G.; Arezzini, S.; Ciampa, A.; Formuso, A.; Mazzoni, E.

    2015-12-01

    INFN-Pisa Scientific Computing Center is working from many years both in GRID and HPC computing. The monitoring and managing tools have been key components of the center's successful operation. The lessons learned from the use of standard tools, such as Ganglia, have been starting points for the development of new tools specific for our infrastructure. In this note we will illustrate the integration of many different monitoring tools in one single platform called ClusterAlive. Aim of ClusterAlive is to increase the HPC cluster performance and simplify maintenance operations, possibly in a proactive approach.

  9. Raspberry Pi super cluster

    CERN Document Server

    Dennis, Andrew K

    2013-01-01

    This book follows a step-by-step, tutorial-based approach which will teach you how to develop your own super cluster using Raspberry Pi computers quickly and efficiently.Raspberry Pi Super Cluster is an introductory guide for those interested in experimenting with parallel computing at home. Aimed at Raspberry Pi enthusiasts, this book is a primer for getting your first cluster up and running.Basic knowledge of C or Java would be helpful but no prior knowledge of parallel computing is necessary.

  10. Cluster modular autocontenido

    OpenAIRE

    2009-01-01

    Desde hace años es común en organizaciones educativas y de investigación el desarrollo de actividades que requieren grandes capacidades de cálculo. La solución más común a estas necesidades es la compra o construcción de un cluster HPC (High Performance Computing), pero construir un cluster acarrea problemas y costos inesperados problemas al momento de utilizarlo y mantenerlo en operaciones. Nuestro proyecto busca desarrollar y documentar técnicas para construir un cluster HPC que sea fácilme...

  11. Extending Beowulf Clusters

    Science.gov (United States)

    Steinwand, Daniel R.; Maddox, Brian; Beckmann, Tim; Hamer, George

    2003-01-01

    Beowulf clusters can provide a cost-effective way to compute numerical models and process large amounts of remote sensing image data. Usually a Beowulf cluster is designed to accomplish a specific set of processing goals, and processing is very efficient when the problem remains inside the constraints of the original design. There are cases, however, when one might wish to compute a problem that is beyond the capacity of the local Beowulf system. In these cases, spreading the problem to multiple clusters or to other machines on the network may provide a cost-effective solution.

  12. Combining cluster number counts and galaxy clustering

    Science.gov (United States)

    Lacasa, Fabien; Rosenfeld, Rogerio

    2016-08-01

    The abundance of clusters and the clustering of galaxies are two of the important cosmological probes for current and future large scale surveys of galaxies, such as the Dark Energy Survey. In order to combine them one has to account for the fact that they are not independent quantities, since they probe the same density field. It is important to develop a good understanding of their correlation in order to extract parameter constraints. We present a detailed modelling of the joint covariance matrix between cluster number counts and the galaxy angular power spectrum. We employ the framework of the halo model complemented by a Halo Occupation Distribution model (HOD). We demonstrate the importance of accounting for non-Gaussianity to produce accurate covariance predictions. Indeed, we show that the non-Gaussian covariance becomes dominant at small scales, low redshifts or high cluster masses. We discuss in particular the case of the super-sample covariance (SSC), including the effects of galaxy shot-noise, halo second order bias and non-local bias. We demonstrate that the SSC obeys mathematical inequalities and positivity. Using the joint covariance matrix and a Fisher matrix methodology, we examine the prospects of combining these two probes to constrain cosmological and HOD parameters. We find that the combination indeed results in noticeably better constraints, with improvements of order 20% on cosmological parameters compared to the best single probe, and even greater improvement on HOD parameters, with reduction of error bars by a factor 1.4-4.8. This happens in particular because the cross-covariance introduces a synergy between the probes on small scales. We conclude that accounting for non-Gaussian effects is required for the joint analysis of these observables in galaxy surveys.

  13. Spin-cluster glass state in U(Ga0.95Mn0.05)3

    Science.gov (United States)

    Dong-Hua, Xie; Wen, Zhang; Yi, Liu; Wei, Feng; Yun, Zhang; Shi-Yong, Tan; Xie-Gang, Zhu; Qiu-Yun, Chen; Qin, Liu; Bing-Kai, Yuan; Xin-Chun, Lai

    2016-04-01

    We report the study of a low temperature cluster glass state in 5% Mn-doped UGa3 heavy fermion compound. This compound transforms from a paramagnetic state to a spin-cluster glass state, which is confirmed by measuring the dc susceptibility and magnetization. The ac susceptibility exhibits a frequency-dependent peak around T f, which provides direct evidence of the cluster glass state. By analyzing the field-dependent magnetization and frequency-dependent ac susceptibility in detail, we deduce that this compound forms a spin-cluster glass state below T f. Project supported by the Natural Science Foundation of China Academy of Engineering Physic (Grant No. 2014A0301013) and the National Natural Science Foundation of China (Grant Nos. 11304291 and 11504342).

  14. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Directory of Open Access Journals (Sweden)

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  15. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Science.gov (United States)

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  16. Evolution of clustered storage

    CERN Document Server

    CERN. Geneva; Van de Vyvre, Pierre

    2007-01-01

    The session actually featured two presentations: * Evolution of clustered storage by Lance Hukill, Quantum Corporation * ALICE DAQ - Usage of a Cluster-File System: Quantum StorNext by Pierre Vande Vyvre, CERN-PH the second one prepared at short notice by Pierre (thanks!) to present how the Quantum technologies are being used in the ALICE experiment. The abstract to Mr Hukill's follows. Clustered Storage is a technology that is driven by business and mission applications. The evolution of Clustered Storage solutions starts first at the alignment between End-users needs and Industry trends: * Push-and-Pull between managing for today versus planning for tomorrow * Breaking down the real business problems to the core applications * Commoditization of clients, servers, and target devices * Interchangeability, Interoperability, Remote Access, Centralized control * Oh, and yes, there is a budget and the "real world" to deal with This presentation will talk through these needs and trends, and then ask the question, ...

  17. Globular clusters with Gaia

    Science.gov (United States)

    Pancino, E.; Bellazzini, M.; Giuffrida, G.; Marinoni, S.

    2017-01-01

    The treatment of crowded fields in Gaia data will only be a reality in a few years from now. In particular, for globular clusters, only the end-of-mission data (public in 2022-2023) will have the necessary full crowding treatment and will reach sufficient quality for the faintest stars. As a consequence, the work on the deblending and decontamination pipelines is still ongoing. We describe the present status of the pipelines for different Gaia instruments, and we model the end-of-mission crowding errors on the basis of available information. We then apply the nominal post-launch Gaia performances, appropriately worsened by the estimated crowding errors, to a set of 18 simulated globular clusters with different concentration, distance, and field contamination. We conclude that there will be 103-104 stars with astrometric performances virtually untouched by crowding (contaminated by <1 mmag) in the majoritiy of clusters. The most limiting factor will be field crowding, not cluster crowding: the most contaminated clusters will only contain 10-100 clean stars. We also conclude that: (i) the systemic proper motions and parallaxes will be determined to 1% or better up to ≃15 kpc, and the nearby clusters will have radial velocities to a few km s-1 ; (ii) internal kinematics will be of unprecendented quality, cluster masses will be determined to ≃10% up to 15 kpc and beyond, and it will be possible to identify differences of a few km s-1 or less in the kinematics (if any) of cluster sub-populations up to 10 kpc and beyond; (iii) the brightest stars (V≃17 mag) will have space-quality, wide-field photometry (mmag errors), and all Gaia photometry will have 1-3% errors on the absolute photometric calibration.

  18. Magnetic cluster excitations

    Science.gov (United States)

    Furrer, Albert; Waldmann, Oliver

    2013-01-01

    Magnetic clusters, i.e., assemblies of a finite number (between two or three and several hundred) of interacting spin centers which are magnetically decoupled from their environment, can be found in many materials ranging from inorganic compounds and magnetic molecules to artificial metal structures formed on surfaces and metalloproteins. Their magnetic excitation spectra are determined by the nature of the spin centers and of the magnetic interactions, and the particular arrangement of the mutual interaction paths between the spin centers. Small clusters of up to four magnetic ions are ideal model systems in which to examine the fundamental magnetic interactions, which are usually dominated by Heisenberg exchange, but often complemented by anisotropic and/or higher-order interactions. In large magnetic clusters, which may potentially deal with a dozen or more spin centers, there is the possibility of novel many-body quantum states and quantum phenomena. In this review the necessary theoretical concepts and experimental techniques to study the magnetic cluster excitations and the resulting characteristic magnetic properties are introduced, followed by examples of small clusters, demonstrating the enormous amount of detailed physical information that can be retrieved. The current understanding of the excitations and their physical interpretation in the molecular nanomagnets which represent large magnetic clusters is then presented, with a section devoted to the subclass of single-molecule magnets, distinguished by displaying quantum tunneling of the magnetization. Finally, there is a summary of some quantum many-body states which evolve in magnetic insulators characterized by built-in or field-induced magnetic clusters. The review concludes by addressing future perspectives in the field of magnetic cluster excitations.

  19. Cauchy cluster process

    DEFF Research Database (Denmark)

    Ghorbani, Mohammad

    2013-01-01

    In this paper we introduce an instance of the well-know Neyman–Scott cluster process model with clusters having a long tail behaviour. In our model the offspring points are distributed around the parent points according to a circular Cauchy distribution. Using a modified Cramér-von Misses test st...... statistic and the simulated pointwise envelopes it is shown that this model fits better than the Thomas process to the frequently analyzed long-leaf pine data-set....

  20. Parallel Wolff Cluster Algorithms

    Science.gov (United States)

    Bae, S.; Ko, S. H.; Coddington, P. D.

    The Wolff single-cluster algorithm is the most efficient method known for Monte Carlo simulation of many spin models. Due to the irregular size, shape and position of the Wolff clusters, this method does not easily lend itself to efficient parallel implementation, so that simulations using this method have thus far been confined to workstations and vector machines. Here we present two parallel implementations of this algorithm, and show that one gives fairly good performance on a MIMD parallel computer.

  1. Effective ac response in weakly nonlinear composites

    Energy Technology Data Exchange (ETDEWEB)

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  2. The AC and DC Conductivity of Nanocomposites

    Directory of Open Access Journals (Sweden)

    David S. McLachlan

    2007-01-01

    Full Text Available The microstructures of binary (conductor-insulator composites, containing nanoparticles, will usually have one of two basic structures. The first is the matrix structure where the nanoparticles (granules are embedded in and always coated by the matrix material and there are no particle-particle contacts. The AC and DC conductivity of this microstructure is usually described by the Maxwell-Wagner/Hashin-Shtrikman or Bricklayer model. The second is a percolation structure, which can be thought to be made up by randomly packing the two types of granules (not necessarily the same size together. In percolation systems, there exits a critical volume fraction below which the electrical properties are dominated by the insulating component and above which the conducting component dominates. Such percolation systems are best analyzed using the two-exponent phenomenological percolation equation (TEPPE. This paper discusses all of the above and addresses the problem of how to distinguish among the microstructures using electrical measurements.

  3. Fuzzy efficiency optimization of AC induction motors

    Science.gov (United States)

    Jani, Yashvant; Sousa, Gilberto; Turner, Wayne; Spiegel, Ron; Chappell, Jeff

    1993-01-01

    This paper describes the early states of work to implement a fuzzy logic controller to optimize the efficiency of AC induction motor/adjustable speed drive (ASD) systems running at less than optimal speed and torque conditions. In this paper, the process by which the membership functions of the controller were tuned is discussed and a controller which operates on frequency as well as voltage is proposed. The membership functions for this dual-variable controller are sketched. Additional topics include an approach for fuzzy logic to motor current control which can be used with vector-controlled drives. Incorporation of a fuzzy controller as an application-specific integrated circuit (ASIC) microchip is planned.

  4. Transcranial alternating current stimulation (tACS

    Directory of Open Access Journals (Sweden)

    Andrea eAntal

    2013-06-01

    Full Text Available Transcranial alternating current stimulation (tACS seems likely to open a new era of the field of noninvasive electrical stimulation of the human brain by directly interfering with cortical rhythms. It is expected to synchronize (by one single resonance frequency or desynchronize (e.g. by the application of several frequencies cortical oscillations. If applied long enough it may cause neuroplastic effects. In the theta range it may improve cognition when applied in phase. Alpha rhythms could improve motor performance, whereas beta intrusion may deteriorate them. TACS with both alpha and beta frequencies has a high likelihood to induce retinal phosphenes. Gamma intrusion can possibly interfere with attention. Stimulation in the ripple range induces intensity dependent inhibition or excitation in the motor cortex most likely by entrainment of neuronal networks, whereas stimulation in the low kHz range induces excitation by neuronal membrane interference. TACS in the 200 kHz range may have a potential in oncology.

  5. AC Dielectrophoresis Using Elliptic Electrode Geometry

    Directory of Open Access Journals (Sweden)

    S. M. Rezaul Hasan

    2011-01-01

    Full Text Available This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of specimen in a dielectrophoretic cage is also being reported. Using an actuating signal between 1 kHz and 1 MHz, successful trapping of 45 μm polystyrene beads suspended in distilled water was demonstrated due to negative dielectrophoresis near 100 kHz using the novel elliptic electrode.

  6. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV......) levels are still not seen as possibility, the future expansion of transmission grids are dependent on new solutions with lessened environment impact, especially with regard to the visual impact. In the present Thesis, composite materials and composite based overhead line components are presented...... and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  7. Galaxy cluster's rotation

    CERN Document Server

    Manolopoulou, Maria

    2016-01-01

    We study the possible rotation of cluster galaxies, developing, testing and applying a novel algorithm which identifies rotation, if such does exits, as well as its rotational centre, its axis orientation, rotational velocity amplitude and, finally, the clockwise or counterclockwise direction of rotation on the plane of the sky. To validate our algorithms we construct realistic Monte-Carlo mock rotating clusters and confirm that our method provides robust indications of rotation. We then apply our methodology on a sample of Abell clusters with z<~0.1 with member galaxies selected from the SDSS DR10 spectroscopic database. We find that ~35% of our clusters are rotating when using a set of strict criteria, while loosening the criteria we find this fraction increasing to ~48%. We correlate our rotation indicators with the cluster dynamical state, provided either by their Bautz-Morgan type or by their X-ray isophotal shape and find for those clusters showing rotation that the significance and strength of their...

  8. Cluster functional renormalization group

    Science.gov (United States)

    Reuther, Johannes; Thomale, Ronny

    2014-01-01

    Functional renormalization group (FRG) has become a diverse and powerful tool to derive effective low-energy scattering vertices of interacting many-body systems. Starting from a free expansion point of the action, the flow of the RG parameter Λ allows us to trace the evolution of the effective one- and two-particle vertices towards low energies by taking into account the vertex corrections between all parquet channels in an unbiased fashion. In this work, we generalize the expansion point at which the diagrammatic resummation procedure is initiated from a free UV limit to a cluster product state. We formulate a cluster FRG scheme where the noninteracting building blocks (i.e., decoupled spin clusters) are treated exactly, and the intercluster couplings are addressed via RG. As a benchmark study, we apply our cluster FRG scheme to the spin-1/2 bilayer Heisenberg model (BHM) on a square lattice where the neighboring sites in the two layers form the individual two-site clusters. Comparing with existing numerical evidence for the BHM, we obtain reasonable findings for the spin susceptibility, the spin-triplet excitation energy, and quasiparticle weight even in coupling regimes close to antiferromagnetic order. The concept of cluster FRG promises applications to a large class of interacting electron systems.

  9. Cluster bomb ocular injuries

    Directory of Open Access Journals (Sweden)

    Ahmad M Mansour

    2012-01-01

    Full Text Available Purpose: To present the visual outcomes and ocular sequelae of victims of cluster bombs. Materials and Methods: This retrospective, multicenter case series of ocular injury due to cluster bombs was conducted for 3 years after the war in South Lebanon (July 2006. Data were gathered from the reports to the Information Management System for Mine Action. Results: There were 308 victims of clusters bombs; 36 individuals were killed, of which 2 received ocular lacerations and; 272 individuals were injured with 18 receiving ocular injury. These 18 surviving individuals were assessed by the authors. Ocular injury occurred in 6.5% (20/308 of cluster bomb victims. Trauma to multiple organs occurred in 12 of 18 cases (67% with ocular injury. Ocular findings included corneal or scleral lacerations (16 eyes, corneal foreign bodies (9 eyes, corneal decompensation (2 eyes, ruptured cataract (6 eyes, and intravitreal foreign bodies (10 eyes. The corneas of one patient had extreme attenuation of the endothelium. Conclusions: Ocular injury occurred in 6.5% of cluster bomb victims and 67% of the patients with ocular injury sustained trauma to multiple organs. Visual morbidity in civilians is an additional reason for a global ban on the use of cluster bombs.

  10. Spatial connectivity of urban clusters and regional climate effects

    Science.gov (United States)

    Jia, G.; Hu, Y.; Xu, R.

    2015-12-01

    Rapid urbanization in East Asia in past three decades is considered as a remarkable process that featured with expansion of urban clusters and tightened linkages within and among clusters. Such process could lead to much larger scale climate effects, and could even contribute to sub-regional and regional climate change. In large area of urban clusters with significant expansion of built-up in relatively short period, local urban heat islands could contribute to sub-regional climate forcing. Here we use visible/near infrared and thermal infrared satellite data to estimate multiple scale structure of urban clusters, and to assess effects of urban heat islands at local and regional scales in East Asia. Our estimates of urban extent were greater than previously reported in most global datasets. Strong spatial connection and internal expansion were found in major urban clusters in past 30 years, and was accelerated in past 10 years. Many city clusters were merging into each other, with gradual blurring boundaries and disappearing of gaps among member cities. Cities and towns were more connected with roads and commercial corridors, while wildland and urban greens became more isolated as patches among built-up areas. We would argue that in many cases in this region, urban clusters are no longer "islands", they are now "seas" in term of climate related urban canopy. Urban greens such as parks and plantation were long recognized for their cooling effects that buffer the urban heat island effect, however, such cooling effects tend to be weakened as their patches became smaller and isolated, and over dominated by urban surfaces. There were significant positive relations between urban fraction and urban heat island effects as demonstrated by VNIR and TIR data from multiple satellites. Those new estimates are expected to effectively improve climate simulation for better understanding the impacts of inter-connected urban clusters on air temperature, precipitation, wind speed

  11. Determination of atomic cluster structure with cluster fusion algorithm

    DEFF Research Database (Denmark)

    Obolensky, Oleg I.; Solov'yov, Ilia; Solov'yov, Andrey V.

    2005-01-01

    We report an efficient scheme of global optimization, called cluster fusion algorithm, which has proved its reliability and high efficiency in determination of the structure of various atomic clusters.......We report an efficient scheme of global optimization, called cluster fusion algorithm, which has proved its reliability and high efficiency in determination of the structure of various atomic clusters....

  12. Modeling the Formation of Globular Cluster Systems in the Virgo Cluster

    CERN Document Server

    Li, Hui

    2014-01-01

    Globular cluster (GC) systems are some of the oldest and most unique building blocks of galaxies. The mass and chemical composition of GCs preserve the fossil record of the early stages of formation of their host galaxies. The observed distribution of GC colors within massive early-type galaxies in the ACS Virgo Cluster Survey (ACSVCS) reveals a multi-modal shape, which likely corresponds to a multi-modal metallicity distribution. In this paper, we present a simple model for the formation and dynamical disruption of globular clusters that aims to match the ACSVCS data. We test the hypothesis that GCs are formed during major mergers of gas-rich galaxies and inherit the metallicity of their hosts. To trace merger events, we use halo merger trees extracted from a large cosmological N-body simulation. We select 20 halos in the mass range 2*10^{12}-7*10^{13} M_sun and match them to 18 Virgo galaxies with K-band luminosity between 3*10^{10} and 3*10^{11}L_sun. To set the Iron abundances, we use an empirical galaxy ...

  13. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  14. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2007-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can accurately produce...... the correct volt-sec average at its output, while simultaneously achieving inductive voltage boosting. More interestingly, these performance features are achieved with no increase in the number of semiconductor commutations, and hence no increase in switching losses. The proposed converter therefore offers...

  15. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  16. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  17. The topological AC effect on noncommutative phase space

    CERN Document Server

    Li, K; Li, Kang; Wang, Jianhua

    2006-01-01

    The Aharonov-Casher (AC) effect in non-commutative(NC) quantum mechanics is studied. Instead of using the star product method, we use a generalization of Bopp's shift method. After solving the Dirac equations both on noncommutative space and noncommutative phase space by the new method, we obtain the corrections to AC phase on NC space and NC phase space respectively.

  18. Considerations for an Ac Dipole for the LHC

    CERN Document Server

    Bai, M; Fischer, W; Oddo, P; Schmickler, Hermann; Serrano, J; Jansson, A; Syphers, M; Kopp, S; Miyamoto, R

    2007-01-01

    Following successful experience at the BNL AGS, FNAL Tevatron, and CERN SPS, an AC Dipole will be adopted at the LHC for rapid measurements of ring optics. This paper describes some of the parameters of the AC dipole for the LHC, scaling from performance of the FNAL and BNL devices.

  19. Equivalent circuit models for ac impedance data analysis

    Science.gov (United States)

    Danford, M. D.

    1990-01-01

    A least-squares fitting routine has been developed for the analysis of ac impedance data. It has been determined that the checking of the derived equations for a particular circuit with a commercially available electronics circuit program is essential. As a result of the investigation described, three equivalent circuit models were selected for use in the analysis of ac impedance data.

  20. A remark on Kov\\'acs' vanishing theorem

    CERN Document Server

    Fujino, Osamu

    2012-01-01

    We give an alternative proof of Kov\\'acs' vanishing theorem. Our proof is based on the standard arguments of the minimal model theory. We do not need the notion of Du Bois pairs. We reduce Kov\\'acs' vanishing theorem to the well-known relative Kawamata--Viehweg--Nadel vanishing theorem.

  1. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  2. Precursors of Short GRBs Registered by SPI-ACS/INTEGRAL

    Science.gov (United States)

    Minaev, P.; Pozanenko, A.

    2016-10-01

    We have searched for precursors in light curves of short gamma-ray bursts registered by SPI-ACS/INTEGRAL in 2002-2014. The portion of short bursts with precursor activity will be less than 0.4% from all short bursts registered by SPI-ACS.

  3. New switching pattern for AC/AC converters with RB-IGBTs for offshore wind parks

    OpenAIRE

    Mogstad, Anne Berit

    2008-01-01

    Offshore wind power has an increasing interest in the research community and among the politicians. Therefore it is important to find the right solutions to meet the environmental and commercial requirements to give offshore wind power a promising future. This thesis are proposing a new converter topology for offshore wind parks. Since the topology is based on DC transmission in stead of AC transmission it is better suited for use in this type of parks. All the converters are located in the w...

  4. Cluster fusion algorithm: application to Lennard-Jones clusters

    DEFF Research Database (Denmark)

    Solov'yov, Ilia; Solov'yov, Andrey V.; Greiner, Walter

    2008-01-01

    We present a new general theoretical framework for modelling the cluster structure and apply it to description of the Lennard-Jones clusters. Starting from the initial tetrahedral cluster configuration, adding new atoms to the system and absorbing its energy at each step, we find cluster growing...... paths up to the cluster size of 150 atoms. We demonstrate that in this way all known global minima structures of the Lennard-Jones clusters can be found. Our method provides an efficient tool for the calculation and analysis of atomic cluster structure. With its use we justify the magic number sequence...... for the clusters of noble gas atoms and compare it with experimental observations. We report the striking correspondence of the peaks in the dependence of the second derivative of the binding energy per atom on cluster size calculated for the chain of the Lennard-Jones clusters based on the icosahedral symmetry...

  5. Cluster fusion algorithm: application to Lennard-Jones clusters

    DEFF Research Database (Denmark)

    Solov'yov, Ilia; Solov'yov, Andrey V.; Greiner, Walter

    2006-01-01

    We present a new general theoretical framework for modelling the cluster structure and apply it to description of the Lennard-Jones clusters. Starting from the initial tetrahedral cluster configuration, adding new atoms to the system and absorbing its energy at each step, we find cluster growing...... paths up to the cluster size of 150 atoms. We demonstrate that in this way all known global minima structures of the Lennard-Jones clusters can be found. Our method provides an efficient tool for the calculation and analysis of atomic cluster structure. With its use we justify the magic number sequence...... for the clusters of noble gas atoms and compare it with experimental observations. We report the striking correspondence of the peaks in the dependence of the second derivative of the binding energy per atom on cluster size calculated for the chain of the Lennard-Jones clusters based on the icosahedral symmetry...

  6. HST/ACS IMAGING OF OMEGA CENTAURI: OPTICAL COUNTERPARTS OF CHANDRA X-RAY SOURCES

    Energy Technology Data Exchange (ETDEWEB)

    Cool, Adrienne M.; Arias, Tersi; Brochmann, Michelle; Dorfman, Jason; Gafford, April; White, Vivian [Department of Physics and Astronomy, San Francisco State University, 1600 Holloway Avenue, San Francisco, CA 94132 (United States); Haggard, Daryl [Center for Interdisciplinary Exploration and Research in Astrophysics, Physics and Astronomy Department, Northwestern University, 2145 Sheridan Road, Evanston, IL 60208 (United States); Anderson, Jay, E-mail: cool@sfsu.edu, E-mail: dhaggard@northwestern.edu [Space Telescope Science Institute, Baltimore, MD 21218 (United States)

    2013-02-15

    We present results of a search for optical counterparts of X-ray sources in and toward the globular cluster Omega Centauri (NGC 5139) using the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope. The ACS data consist of a mosaic of Wide Field Channel images obtained using F625W, F435W, and F658N filters; with nine pointings we cover the central {approx}10' Multiplication-Sign 10' of the cluster and encompass 109 known Chandra sources. We find promising optical counterparts for 59 of the sources, {approx}40 of which are likely to be associated with the cluster. These include 27 candidate cataclysmic variables (CVs), 24 of which are reported here for the first time. Fourteen of the CV candidates are very faint, with absolute magnitudes in the range M {sub 625} =10.4-12.6, making them comparable in brightness to field CVs near the period minimum discovered in the Sloan Digital Sky Survey. Additional optical counterparts include three BY Dra candidates, a possible blue straggler, and a previously reported quiescent low-mass X-ray binary. We also identify 3 foreground stars and 11 probable active galactic nuclei. Finally, we report the discovery of a group of seven stars whose X-ray properties are suggestive of magnetically active binaries, and whose optical counterparts lie on or very near the metal-rich anomalous giant and subgiant branches in {omega} Cen. If the apparent association between these seven stars and the RGB/SGB-a stars is real, then the frequency of X-ray sources in this metal-rich population is enhanced by a factor of at least five relative to the other giant and subgiant populations in the cluster. If these stars are not members of the metal-rich population, then they bring the total number of red stragglers (also known as sub-subgiants) that have been identified in {omega} to Cen 20, the largest number yet known in any globular cluster.

  7. Determination for β-delayed fission probability of 230Ac

    Institute of Scientific and Technical Information of China (English)

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝

    2002-01-01

    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  8. Characterisation of AC1: a naturally decaffeinated coffee

    Directory of Open Access Journals (Sweden)

    Luciana Benjamim Benatti

    2012-01-01

    Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

  9. Ac response of a coupled double quantum dot

    Institute of Scientific and Technical Information of China (English)

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang

    2005-01-01

    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  10. Estimation of the Thurstonian model for the 2-AC protocol

    DEFF Research Database (Denmark)

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model....... This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative...

  11. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  12. 单相电压型Z源AC/AC变流器电路%Single-Phase Voltage-Fed Z-Source AC/AC Converter

    Institute of Scientific and Technical Information of China (English)

    房绪鹏

    2006-01-01

    提出了一种新型AC/AC变流器电路--单相电压型Z源AC/AC变流器;介绍了其电路拓扑、工作原理、控制方法等;给出了相应的仿真和实验结果.仿真和实验证实了该电路拓扑的合理性和优越性.

  13. An Ac transposon system based on maize chromosome 4S for isolating long-distance-transposed Ac tags in the maize genome.

    Science.gov (United States)

    Wang, Fei; Li, Zhaoying; Fan, Jun; Li, Pengfei; Hu, Wei; Wang, Gang; Xu, Zhengkai; Song, Rentao

    2010-12-01

    Transposon tagging is an important tool for gene isolation and functional studies. In maize, several transposon-tagging systems have been developed, mostly using Activator/Dissociation (Ac/Ds) and Mutator systems. Here, we establish another Ac-based transposon system with the donor Ac tightly linked with sugary1 (su1) on maize chromosome 4S. Newly transposed Ac (tr-Acs) were detected based on a negative dosage effect, and long-distance-transposed Ac events were identified and isolated from the donor Ac by a simple backcross scheme. In this study, we identified 208 independent long-distance-transposed Ac lines. Thirty-one flanking sequences of these tr-Acs were isolated and localized in the maize genome. As found in previous studies, the tr-Acs preferentially inserted into genic sequences. The distribution of tr-Acs is not random. In our study, the tr-Acs preferentially transposed into chromosomes 1, 2, 9 and 10. We discuss the preferential distribution of tr-Acs from Ac systems. Our system is complementary to two other Ac-based regional-mutagenesis systems in maize, and the combined use of these systems will achieve an even and high-density distribution of Ac elements throughout the maize genome for functional-genomics studies.

  14. Multiwavelength photometry in the Globular Cluster M2

    CERN Document Server

    Dalessandro, E; Lanzoni, B; Ferraro, F R; Schiavon, R; Rood, R T

    2009-01-01

    We present a multiwavelength photometric analysis of the globular cluster M2. The data-set has been obtained by combining high-resolution (HST/WFPC2 and ACS) and wide-field (GALEX) space observations and ground based (MEGACAM-CFHT, EMMI-NTT) images. The photometric sample covers the entire cluster extension from the very central regions up to the tidal radius and beyond. It allows an accurate determination of the cluster center of gravity and other structural parameters derived from the star count density profile. Moreover we study the BSS population and its radial distribution. A total of 123 BSS has been selected, and their radial distribution has been found to be bimodal (highly peaked in the center, decreasing at intermediate radii and rising outward), as already found in a number of other clusters. The radial position of the minimum of the BSS distribution is consistent with the radius of avoidance caused by the dynamical friction of massive objects over the cluster age. We also searched for gradients in...

  15. Subspace K-means clustering

    NARCIS (Netherlands)

    Timmerman, Marieke E.; Ceulemans, Eva; De Roover, Kim; Van Leeuwen, Karla

    2013-01-01

    To achieve an insightful clustering of multivariate data, we propose subspace K-means. Its central idea is to model the centroids and cluster residuals in reduced spaces, which allows for dealing with a wide range of cluster types and yields rich interpretations of the clusters. We review the existi

  16. Altered Chromosomal Positioning, Compaction, and Gene Expression with a Lamin A/C Gene Mutation

    Science.gov (United States)

    Abuisneineh, Fida; Fahrenbach, John P.; Zhang, Yuan; MacLeod, Heather; Dellefave, Lisa; Pytel, Peter; Selig, Sara; Labno, Christine M.; Reddy, Karen; Singh, Harinder; McNally, Elizabeth

    2010-01-01

    Background Lamins A and C, encoded by the LMNA gene, are filamentous proteins that form the core scaffold of the nuclear lamina. Dominant LMNA gene mutations cause multiple human diseases including cardiac and skeletal myopathies. The nuclear lamina is thought to regulate gene expression by its direct interaction with chromatin. LMNA gene mutations may mediate disease by disrupting normal gene expression. Methods/Findings To investigate the hypothesis that mutant lamin A/C changes the lamina's ability to interact with chromatin, we studied gene misexpression resulting from the cardiomyopathic LMNA E161K mutation and correlated this with changes in chromosome positioning. We identified clusters of misexpressed genes and examined the nuclear positioning of two such genomic clusters, each harboring genes relevant to striated muscle disease including LMO7 and MBNL2. Both gene clusters were found to be more centrally positioned in LMNA-mutant nuclei. Additionally, these loci were less compacted. In LMNA mutant heart and fibroblasts, we found that chromosome 13 had a disproportionately high fraction of misexpressed genes. Using three-dimensional fluorescence in situ hybridization we found that the entire territory of chromosome 13 was displaced towards the center of the nucleus in LMNA mutant fibroblasts. Additional cardiomyopathic LMNA gene mutations were also shown to have abnormal positioning of chromosome 13, although in the opposite direction. Conclusions These data support a model in which LMNA mutations perturb the intranuclear positioning and compaction of chromosomal domains and provide a mechanism by which gene expression may be altered. PMID:21179469

  17. Altered chromosomal positioning, compaction, and gene expression with a lamin A/C gene mutation.

    Directory of Open Access Journals (Sweden)

    Stephanie K Mewborn

    Full Text Available BACKGROUND: Lamins A and C, encoded by the LMNA gene, are filamentous proteins that form the core scaffold of the nuclear lamina. Dominant LMNA gene mutations cause multiple human diseases including cardiac and skeletal myopathies. The nuclear lamina is thought to regulate gene expression by its direct interaction with chromatin. LMNA gene mutations may mediate disease by disrupting normal gene expression. METHODS/FINDINGS: To investigate the hypothesis that mutant lamin A/C changes the lamina's ability to interact with chromatin, we studied gene misexpression resulting from the cardiomyopathic LMNA E161K mutation and correlated this with changes in chromosome positioning. We identified clusters of misexpressed genes and examined the nuclear positioning of two such genomic clusters, each harboring genes relevant to striated muscle disease including LMO7 and MBNL2. Both gene clusters were found to be more centrally positioned in LMNA-mutant nuclei. Additionally, these loci were less compacted. In LMNA mutant heart and fibroblasts, we found that chromosome 13 had a disproportionately high fraction of misexpressed genes. Using three-dimensional fluorescence in situ hybridization we found that the entire territory of chromosome 13 was displaced towards the center of the nucleus in LMNA mutant fibroblasts. Additional cardiomyopathic LMNA gene mutations were also shown to have abnormal positioning of chromosome 13, although in the opposite direction. CONCLUSIONS: These data support a model in which LMNA mutations perturb the intranuclear positioning and compaction of chromosomal domains and provide a mechanism by which gene expression may be altered.

  18. A Study of Dwarf Galaxies in Five Rich Clusters I: Abell 1689 and Abell 1703

    Science.gov (United States)

    Bruursema, Justice; Riley, S.; Ford, H. C.; Zekser, K. C.; Infante, L.; Postman, M.

    2008-05-01

    Dwarf galaxies play an important role in understanding galactic formation, cluster dynamics, and large scale structure. Although local dwarf populations have been well studied, dwarf galaxies outside the local supercluster remain relatively unexamined. Using ACS Investigation Definition Team data, we examine the dwarf galaxy populations of A1689 (z=0.1832), A1703 (z=0.2580), A2218 (z=0.1756), CL0024+16 (z=0.395), and MS1358+62 (z=0.328). We have modeled and subtracted the light from the brighter elliptical galaxies using the XVISTA subroutine SNUC. An assumption of concentric elliptical isophotes is made and the position angle, ellipticity, and brightness are fit using a nonlinear least-squares algorithm. The subtraction of the models reveals a population of dwarf galaxies usually hidden by the light of bright ellipticals. SExtractor and Bayesian Photometric Redshifts (BPZ) are used in order to identify cluster members. With the 0.05" per pixel resolution of ACS and a completeness of mF625 = 28 we are able to identify approximately 1000 dwarf galaxies candidates, defined as MF625 > -18, in all five clusters combined. We will discuss the results of this research including, but not limited to, dwarf galaxy luminosity functions, radial distribution, and the characteristics of dwarfs compared to those in other well studied clusters. ACS was developed under NASA contract NAS5-32865, and this research was supported by NASA grant NAG5-7697.

  19. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  20. Cluster Implantation and Deposition Apparatus

    DEFF Research Database (Denmark)

    Hanif, Muhammad; Popok, Vladimir

    2015-01-01

    In the current report, a design and capabilities of a cluster implantation and deposition apparatus (CIDA) involving two different cluster sources are described. The clusters produced from gas precursors (Ar, N etc.) by PuCluS-2 can be used to study cluster ion implantation in order to develop...... contributions to the theory of cluster stopping in matter as well as for practical applications requiring ultra-shallow implantation and modification of surfaces on the nanoscale. Metal clusters from the magnetron cluster source are of interest for the production of optical sensors to detect specific biological...

  1. Stellar populations in star clusters

    CERN Document Server

    Li, Chengyuan; Deng, Licai

    2016-01-01

    Stellar populations contain the most important information about star clus- ter formation and evolution. Until several decades ago, star clusters were believed to be ideal laboratories for studies of simple stellar populations (SSPs). However, discoveries of multiple stellar populations in Galactic globular clusters have expanded our view on stellar populations in star clusters. They have simultaneously generated a number of controversies, particularly as to whether young star clusters may have the same origin as old globular clusters. In addition, extensive studies have revealed that the SSP scenario does not seem to hold for some intermediate-age and young star clusters either, thus making the origin of multiple stellar populations in star clusters even more complicated. Stellar population anomalies in numerous star clusters are well-documented, implying that the notion of star clusters as true SSPs faces serious challenges. In this review, we focus on stellar populations in massive clusters with different ...

  2. Clustering by Pattern Similarity

    Institute of Scientific and Technical Information of China (English)

    Hai-xun Wang; Jian Pei

    2008-01-01

    The task of clustering is to identify classes of similar objects among a set of objects. The definition of similarity varies from one clustering model to another. However, in most of these models the concept of similarity is often based on such metrics as Manhattan distance, Euclidean distance or other Lp distances. In other words, similar objects must have close values in at least a set of dimensions. In this paper, we explore a more general type of similarity. Under the pCluster model we proposed, two objects are similar if they exhibit a coherent pattern on a subset of dimensions. The new similarity concept models a wide range of applications. For instance, in DNA microarray analysis, the expression levels of two genes may rise and fall synchronously in response to a set of environmental stimuli. Although the magnitude of their expression levels may not be close, the patterns they exhibit can be very much alike. Discovery of such clusters of genes is essential in revealing significant connections in gene regulatory networks. E-commerce applications, such as collaborative filtering, can also benefit from the new model, because it is able to capture not only the closeness of values of certain leading indicators but also the closeness of (purchasing, browsing, etc.) patterns exhibited by the customers. In addition to the novel similarity model, this paper also introduces an effective and efficient algorithm to detect such clusters, and we perform tests on several real and synthetic data sets to show its performance.

  3. The clustered nature of star formation. Pre--main-sequence clusters in the star-forming region NGC 602/N90 in the Small Magellanic Cloud

    CERN Document Server

    Gouliermis, Dimitrios A; Dolphin, Andrew E; Gennaro, Mario; Tognelli, Emanuele; Moroni, Pier Giorgio Prada

    2012-01-01

    Located at the tip of the wing of the Small Magellanic Cloud (SMC), the star-forming region NGC602/N90 is characterized by the HII nebular ring N90 and the young cluster of pre--main-sequence (PMS) and early-type main sequence stars NGC602. We present a thorough cluster analysis of the stellar sample identified with HST/ACS camera in the region. We show that apart from the central cluster, low-mass PMS stars are congregated in thirteen additional small compact sub-clusters at the periphery of NGC602. We find that the spatial distribution of the PMS stars is bimodal, with an unusually large fraction (~60%) of the total population being clustered, while the remaining is diffusely distributed in the inter-cluster area. From the corresponding color-magnitude diagrams we disentangle an age-difference of ~2.5Myr between NGC602 and the compact sub-clusters which appear younger. The diffuse PMS population appears to host stars as old as those in NGC602. Almost all detected PMS sub-clusters appear to be centrally conc...

  4. Chemical evolution of star clusters

    OpenAIRE

    van Loon, Jacco Th.

    2009-01-01

    I discuss the chemical evolution of star clusters, with emphasis on old globular clusters, in relation to their formation histories. Globular clusters clearly formed in a complex fashion, under markedly different conditions from any younger clusters presently known. Those special conditions must be linked to the early formation epoch of the Galaxy and must not have occurred since. While a link to the formation of globular clusters in dwarf galaxies has been suggested, present-day dwarf galaxi...

  5. Maximum-likelihood cluster recontruction

    CERN Document Server

    Bartelmann, M; Seitz, S; Schneider, P J; Bartelmann, Matthias; Narayan, Ramesh; Seitz, Stella; Schneider, Peter

    1996-01-01

    We present a novel method to recontruct the mass distribution of galaxy clusters from their gravitational lens effect on background galaxies. The method is based on a least-chisquare fit of the two-dimensional gravitational cluster potential. The method combines information from shear and magnification by the cluster lens and is designed to easily incorporate possible additional information. We describe the technique and demonstrate its feasibility with simulated data. Both the cluster morphology and the total cluster mass are well reproduced.

  6. Bayesian Analysis of Two Stellar Populations in Galactic Globular Clusters II: NGC 5024, NGC 5272, and NGC 6352

    CERN Document Server

    Wagner-Kaiser, R; Robinson, E; von Hippel, T; Sarajedini, A; van Dyk, D A; Stein, N; Jefferys, W H

    2016-01-01

    We use Cycle 21 Hubble Space Telescope (HST) observations and HST archival ACS Treasury observations of Galactic Globular Clusters to find and characterize two stellar populations in NGC 5024 (M53), NGC 5272 (M3), and NGC 6352. For these three clusters, both single and double-population analyses are used to determine a best fit isochrone(s). We employ a sophisticated Bayesian analysis technique to simultaneously fit the cluster parameters (age, distance, absorption, and metallicity) that characterize each cluster. For the two-population analysis, unique population level helium values are also fit to each distinct population of the cluster and the relative proportions of the populations are determined. We find differences in helium ranging from $\\sim$0.05 to 0.11 for these three clusters. Model grids with solar $\\alpha$-element abundances ([$\\alpha$/Fe] =0.0) and enhanced $\\alpha$-elements ([$\\alpha$/Fe]=0.4) are adopted.

  7. Clustering Game Behavior Data

    DEFF Research Database (Denmark)

    Bauckhage, C.; Drachen, Anders; Sifa, Rafet

    2015-01-01

    Recent years have seen a deluge of behavioral data from players hitting the game industry. Reasons for this data surge are many and include the introduction of new business models, technical innovations, the popularity of online games, and the increasing persistence of games. Irrespective...... of the causes, the proliferation of behavioral data poses the problem of how to derive insights therefrom. Behavioral data sets can be large, time-dependent and high-dimensional. Clustering offers a way to explore such data and to discover patterns that can reduce the overall complexity of the data. Clustering...... scientists and present a review and tutorial focusing on the application of clustering techniques to mine behavioral game data. Several algorithms are reviewed and examples of their application shown. Key topics such as feature normalization are discussed and open problems in the context of game analytics...

  8. The concept of cluster

    DEFF Research Database (Denmark)

    Laursen, Lea Louise Holst; Møller, Jørgen

    2013-01-01

    villages in order to secure their future. This paper will address the concept of cluster-villages as a possible approach to strengthen the conditions of contemporary Danish villages. Cluster-villages is a concept that gather a number of villages in a network-structure where the villages both work together...... to forskellige positioner ser vi en ny mulighed for landsbyudvikling, som vi kalder Clustervillages. In order to investigate the potentials and possibilities of the cluster-village concept the paper will seek to unfold the concept strategically; looking into the benefits of such concept. Further, the paper seeks...... to inscribe the concept into the existing debate regarding villages in the rural districts....

  9. Clusters in Light Nuclei

    CERN Document Server

    Beck, C; Zafra, A Sanchez i; Thummerer, S; Azaiez, F; Bednarczyk, P; Courtin, S; Curien, D; Dorvaux, O; Goasduff, A; ~Lebhertz, D; Nourreddine, A; ~Rousseau, M; Salsac, M -D; von Oertzen, W; Gebauer, B; Wheldon, C; Kokalova, Tz; Efimov, G; Zherebchevsky, V; Schulz, Ch; Bohlen, H G; Kamanin, D; de Angelis, G; Gadea, A; Lenzi, S; Napoli, D R; Szilner, S; Milin, M; Catford, W N; Jenkins, D G; Royer, G

    2010-01-01

    A great deal of research work has been undertaken in the alpha-clustering study since the pioneering discovery, half a century ago, of 12C+12C molecular resonances. Our knowledge of the field of the physics of nuclear molecules has increased considerably and nuclear clustering remains one of the most fruitful domains of nuclear physics, facing some of the greatest challenges and opportunities in the years ahead. In this work, the occurence of "exotic" shapes in light N=Z alpha-like nuclei is investigated. Various approaches of superdeformed and hyperdeformed bands associated with quasimolecular resonant structures are presented. Results on clustering aspects are also discussed for light neutron-rich Oxygen isotopes.

  10. Importance of Attenuation Correction (AC for Small Animal PET Imaging

    Directory of Open Access Journals (Sweden)

    Henrik H. El Ali

    2012-10-01

    Full Text Available The purpose of this study was to investigate whether a correction for annihilation photon attenuation in small objects such as mice is necessary. The attenuation recovery for specific organs and subcutaneous tumors was investigated. A comparison between different attenuation correction methods was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7 were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II. CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%, for kidneys 20 ± 1% (19–21%, and for bladder 18 ± 3% (15–21%. The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction.

  11. Measurement of AC loss of superconductors by vaporizing method

    Energy Technology Data Exchange (ETDEWEB)

    Wakabayashi, Hiroshi; Isono, Takaaki; Matsui, Kunihiro; Fujisaki, Reishi; Nunoya, Yoshihiko; Koizumi, Norikiyo; Takahashi, Yoshikazu; Tsuji, Hiroshi [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment

    1995-07-01

    In Japan Atomic Energy Research Institute, the development of superconducting pulse conductors for next period nuclear fusion reactors has been carried out. For these conductors, the rated current of 46 kA and the rated magnetic field of 13T are demanded. When the pulse excitation of superconductors is carried out, AC loss arises, and the temperature of the superconductors rises, and when it exceeds a certain value, the superconducting state cannot be maintained. Therefore, the AC loss of pulse conductors must be limited to a low value. It is difficult to evaluate the AC loss of superconductors by calculation, therefore, it is evaluated by actual measurement. There are magnetizing method and vaporizing method for measuring the AC loss. This time, the equipment for measuring the AC loss of 40 kA class superconductors by vaporizing method which measures the helium gas quantity vaporizing at the time of AC loss occurrence was designed and manufactured for the first time. The method of measuring the AC loss, the structure of the measuring equipment, the helium gas recovering part and the measuring part, the countermeasures for preventing helium gas leakage, the resistance heater for calibration, and the results of measurement are reported. (K.I.)

  12. South Asian Cluster

    Directory of Open Access Journals (Sweden)

    Ionel Sergiu Pirju

    2014-12-01

    Full Text Available This article aims at presenting the South Asian cluster composed of India, Indonesia, Iran and Malaysia, the intercultural values that characterizes it, the supported leadership style and tracing the main macroeconomic considerations which characterizes them. The research is synchronic, analysing the contemporary situation of these countries without reference to their evolution in time, by using the positivist paradigm that explains the reality at one point. It will be analysed the overall cluster with the existing interactions between the countries that composes it, while the article being one of information will avoid building recommendation, or new theories.

  13. I Cluster geografici

    Directory of Open Access Journals (Sweden)

    Maurizio Rosina

    2010-03-01

    Full Text Available Geographic ClustersOver the past decade, public alphanumeric database have been growing at exceptional rate. Most of data can be georeferenced, so that is possible gaining new knowledge from such databases. The contribution of this paper is two-fold. We first present a model of geographic clusters, which uses only geographic and functionally data properties. The model is useful to process huge amount of public/government data, even daily upgrading. After that, we merge the model into the framework GEOPOI (GEOcoding Points Of Interest, and show some graphic map results.

  14. Cluster-tilting theory

    OpenAIRE

    Simões, Raquel Coelho Guardado

    2008-01-01

    Tese de mestado em Matemática (Álgebra, Lógica e Fundamentos) apresentada à Universidade de Lisboa, através da Faculdade de Ciências, 2008 Resumo alargado disponível em português The notion of Cluster Algebra first appeared in 2001, in a paper by S. Fomin and A. Zelevinsky, studying the dual canonical basis of the quantum group of a finite dimensional simple Lie algebra over the complex numbers, and also total positivity for algebraic groups. Cluster categories, introduced by A. Buan, R...

  15. Kinematics of Clustering

    CERN Document Server

    Wang, Steven; Metcalfe, Guy; Wu, Jie

    2014-01-01

    The dynamical system for inertial particles in fluid flow has both attracting and repelling regions, the interplay of which can localize particles. In laminar flow experiments we find that particles, initially moving throughout the fluid domain, can undergo an instability and cluster into subdomains of the fluid when the flow Reynolds number exceeds a critical value that depends on particle and fluid inertia. We derive an expression for the instability boundary and for a universal curve that describes the clustering rate for all particles.

  16. Molecular dynamics simulation of gold cluster growth during sputter deposition

    Science.gov (United States)

    Abraham, J. W.; Strunskus, T.; Faupel, F.; Bonitz, M.

    2016-05-01

    We present a molecular dynamics simulation scheme that we apply to study the time evolution of the self-organized growth process of metal cluster assemblies formed by sputter-deposited gold atoms on a planar surface. The simulation model incorporates the characteristics of the plasma-assisted deposition process and allows for an investigation over a wide range of deposition parameters. It is used to obtain data for the cluster properties which can directly be compared with recently published experimental data for gold on polystyrene [M. Schwartzkopf et al., ACS Appl. Mater. Interfaces 7, 13547 (2015)]. While good agreement is found between the two, the simulations additionally provide valuable time-dependent real-space data of the surface morphology, some of whose details are hidden in the reciprocal-space scattering images that were used for the experimental analysis.

  17. An Emerge Approach in Inter Cluster Similarity for Quality Clusters

    Directory of Open Access Journals (Sweden)

    H. Venkateswara Reddy

    2013-04-01

    Full Text Available Relationship between the datasets is one most important issue in recent years. The recent methods are based mostly on the numerical data, but these methods are not suitable for real time data such as web pages, business transactions etc., which are known as Categorical data. It is difficult to find relationship in categorical data. In this paper, a new approach is proposed for finding the relationshipbetween the categorical data, hence to find relationship between the clusters. The main aim is to identify the quality clusters based on the relationship between clusters. If there is no relationship between clusters then those clusters are treated as quality clusters.

  18. AC Impedance Behaviour of Black Diamond Films

    Institute of Scientific and Technical Information of China (English)

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN

    2005-01-01

    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  19. Faint Galaxies in deep ACS observations

    CERN Document Server

    Benítez, N; Bouwens, R; Menanteau, F; Blakeslee, J P; Gronwall, C; Illingworth, G D; Meurer, G; Broadhurst, T J; Clampin, M; Franx, M; Hartig, G F; Magee, D; Sirianni, M; Ardila, D R; Bartko, F; Brown, R A; Burrows, C J; Cheng, E S; Cross, N J G; Feldman, P D; Golimowski, D A; Infante, L; Kimble, R A; Krist, J E; Lesser, M P; Levay, Z G; Martel, A R; Miley, G K; Postman, M; Rosati, P; Sparks, W B; Tran, H D; Tsvetanov, Z I; Zheng, R L

    2003-01-01

    We present the analysis of the faint galaxy population in the Advanced Camera for Surveys (ACS) Early Release Observation fields VV 29 (UGC 10214) and NGC 4676. Here we attempt to thoroughly consider all aspects relevant for faint galaxy counting and photometry, developing methods which are based on public software and that are easily reproducible by other astronomers. Using simulations we determine the best SExtractor parameters for the detection of faint galaxies in deep HST observations, paying special attention to the issue of deblending, which significantly affects the normalization and shape of the number count distribution. We confirm, as claimed by Bernstein, Freedman and Madore (2002), that Kron-like magnitudes, such as the ones generated by SExtractor, can miss more than half of the light of faint galaxies, what dramatically affects the slope of the number counts. We present catalogs for the VV 29 and NGC 4676 fields with photometry in the g,V and I bands. We also show that combining the bayesian so...

  20. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  1. Cyclotron production of Ac-225 for targeted alpha therapy.

    Science.gov (United States)

    Apostolidis, C; Molinet, R; McGinley, J; Abbas, K; Möllenbeck, J; Morgenstern, A

    2005-03-01

    The feasibility of producing Ac-225 by proton irradiation of Ra-226 in a cyclotron through the reaction Ra-226(p,2n)Ac-225 has been experimentally demonstrated for the first time. Proton energies were varied from 8.8 to 24.8 MeV and cross-sections were determined by radiochemical analysis of reaction yields. Maximum yields were reached at incident proton energies of 16.8 MeV. Radiochemical separation of Ac-225 from the irradiated target yielded a product suitable for targeted alpha therapy of cancer.

  2. An Improved AC-BM Algorithm for Monitoring Watch List

    Directory of Open Access Journals (Sweden)

    Mo Yiwen

    2013-07-01

    Full Text Available With the expanding of database of the watch list of anti-money laundering, improving the speed in matching between the watch list and the database of account holders and clients’ transaction is especially important. This paper proposes an improved AC-BM Algorithm, a matching algorithm of subsection, to improve the speed of matching. Experiment results show the time performance of the improved algorithm is better than traditional BM algorithm, AC algorithm and the AC-BM algorithm. It can improve the efficiency of on-line monitoring of anti-money laundering.  

  3. Recurrent Security Gaps In 802.11ac Routers

    OpenAIRE

    Mohammed Farik; ABM Shawkat Ali

    2015-01-01

    Abstract In comparison to earlier IEEE 802.11 standard abgn routers todays popular 802.11ac standard routers have enhanced security. However 802.11ac router still has major security vulnerabilities. The novelty of this paper is that we not only highlight multiple security vulnerabilities in 802.11ac router technologies that still have not been secured since the earlier standards but also present some new ideas with solutions. We believe that our line of thoughts on security vulnerabilities ga...

  4. Analysis of Input and Output Ripples of PWM AC Choppers

    Directory of Open Access Journals (Sweden)

    Pekik Argo Dahono

    2008-11-01

    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  5. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  6. An HST/ACS view of the inhomogeneous outer halo of M31

    Science.gov (United States)

    Richardson, J. C.; Ferguson, A. M. N.; Mackey, A. D.; Irwin, M. J.; Chapman, S. C.; Huxor, A.; Ibata, R. A.; Lewis, G. F.; Tanvir, N. R.

    2009-07-01

    We present a high precision photometric view of the stellar populations in the outer halo of M31, using data taken with the Hubble Space Telescope/Advanced Camera for Surveys. We analyse the field populations adjacent to 11 luminous globular clusters which sample the galactocentric radial range 18 ~ -0.6 to -1.0dex and considerable metallicity dispersions of 0.2 to 0.3dex (assuming a 10 Gyr population and scaled-solar abundances). The average metallicity over the range 30-60kpc is [Fe/H] = -0.80 +/- 0.14dex, with no evidence for a significant radial gradient. Metal-poor stars ([Fe/H] jcr@roe.ac.uk

  7. Combining cluster number counts and galaxy clustering

    CERN Document Server

    Lacasa, Fabien

    2016-01-01

    We present a detailed modelling of the joint covariance matrix between cluster number counts and the galaxy angular power spectrum. To this end, we use a Halo Model framework complemented by a Halo Occupation Distribution model (HOD), and we work in full-sky. We demonstrate the importance of accounting for non-Gaussianity to produce accurate covariance predictions, as the Gaussian part of the covariance can in fact become subdominant in certain configurations. We discuss in particular the case of the super-sample covariance (SSC), including the effects of galaxy shot-noise, halo second order bias and non-local bias, and demonstrating interesting mathematical properties. Using the joint covariance matrix and a Fisher matrix methodology, we examine the prospects of combining these two probes to constrain cosmological and HOD parameters. We find that the combination indeed results in noticeable better constraints, in particular because the cross-covariance introduces a synergy between the probes on small scales....

  8. Localized attack on clustering networks

    CERN Document Server

    Dong, Gaogao; Du, Ruijin; Shao, Shuai; Stanley, H Eugene; Shlomo, Havlin

    2016-01-01

    Clustering network is one of which complex network attracting plenty of scholars to discuss and study the structures and cascading process. We primarily analyzed the effect of clustering coefficient to other various of the single clustering network under localized attack. These network models including double clustering network and star-like NON with clustering and random regular (RR) NON of ER networks with clustering are made up of at least two networks among which exist interdependent relation among whose degree of dependence is measured by coupling strength. We show both analytically and numerically, how the coupling strength and clustering coefficient effect the percolation threshold, size of giant component, critical coupling point where the behavior of phase transition changes from second order to first order with the increase of coupling strength between the networks. Last, we study the two types of clustering network: one type is same with double clustering network in which each subnetwork satisfies ...

  9. Clustering of resting state networks.

    Directory of Open Access Journals (Sweden)

    Megan H Lee

    Full Text Available BACKGROUND: The goal of the study was to demonstrate a hierarchical structure of resting state activity in the healthy brain using a data-driven clustering algorithm. METHODOLOGY/PRINCIPAL FINDINGS: The fuzzy-c-means clustering algorithm was applied to resting state fMRI data in cortical and subcortical gray matter from two groups acquired separately, one of 17 healthy individuals and the second of 21 healthy individuals. Different numbers of clusters and different starting conditions were used. A cluster dispersion measure determined the optimal numbers of clusters. An inner product metric provided a measure of similarity between different clusters. The two cluster result found the task-negative and task-positive systems. The cluster dispersion measure was minimized with seven and eleven clusters. Each of the clusters in the seven and eleven cluster result was associated with either the task-negative or task-positive system. Applying the algorithm to find seven clusters recovered previously described resting state networks, including the default mode network, frontoparietal control network, ventral and dorsal attention networks, somatomotor, visual, and language networks. The language and ventral attention networks had significant subcortical involvement. This parcellation was consistently found in a large majority of algorithm runs under different conditions and was robust to different methods of initialization. CONCLUSIONS/SIGNIFICANCE: The clustering of resting state activity using different optimal numbers of clusters identified resting state networks comparable to previously obtained results. This work reinforces the observation that resting state networks are hierarchically organized.

  10. The Orion Nebula Cluster as a Paradigm of Star Formation

    Science.gov (United States)

    Robberto, Massimo

    2014-10-01

    We propose a 52-orbit Treasury Program to investigate two fundamental questions of star formation: a) the low-mass tail of the IMF, down to a few Jupiter masses; b) the dynamical evolution of clusters, as revealed by stellar proper motions. We target the Orion Nebula Cluster (ONC) using WFC3 and ACS in coordinated parallel mode to perform a synoptic survey in the 1.345micron H2O feature and Ic broad-band. Our main objectives are: 1) to discover and classify ~500 brown dwarfs and planetary-mass objects in the field, extending the IMF down to lowest masses formed by gravitational collapse. Using the latest generation of high contrast image processing we will also search for faint companions, reaching down to sub-arcsecond separations and 1E-4 flux ratios. 2) to derive high precision (~0.2km/s) relative proper motions of low-mass stars and substellar objects (about 1000 sources total), leveraging on first epoch data obtained by our previous HST Treasury Program about 10 years ago. These data will unveil the cluster dynamics: velocity dispersion vs. mass, substructures, and the fraction of escaping sources. Only HST can access the IR H2O absorption feature sensitive to the effective temperature of substellar objects, while providing the exceptionally stable PSF needed for the detection of faint companions, and the identical ACS platform for our second epoch proper-motion survey. This program will provide the definitive HST legacy dataset on the ONC. Our High-Level Science Products will be mined by the community, both statistically to constrain competing theories of star formation, and to study in depth the multitude of exotic sources harboured by the cluster.

  11. Single-Phase Four Switch Z-Source AC-AC Converters%单相四开关Z源AC-AC变换器

    Institute of Scientific and Technical Information of China (English)

    汤雨; 谢少军; 张超华

    2007-01-01

    提出了一种单相四开关Z源AC-AC变换器,它包括电压型与电流型两类.与传统脉宽调制AC-AC变换器相比,它具有如下特点:输出电压范围宽且可升可降,输出电压与输入电压可同相或反相,冲击和谐波电流小,可靠性高.针对AC-AC变换器中固有的开关管换流问题,提出了一种适用于单相四开关Z源AC-AC变换器的换流方案,无需外加缓冲吸收电路即可实现开关管的安全换流.以电压型单相四开关Z源AC-AC变换器为例,对其进行了理论分析、仿真和原理试验研究.实验结果证实了Z源变换器的特性及换流方案的可行性.

  12. Clustering via Kernel Decomposition

    DEFF Research Database (Denmark)

    Have, Anna Szynkowiak; Girolami, Mark A.; Larsen, Jan

    2006-01-01

    Methods for spectral clustering have been proposed recently which rely on the eigenvalue decomposition of an affinity matrix. In this work it is proposed that the affinity matrix is created based on the elements of a non-parametric density estimator. This matrix is then decomposed to obtain poste...

  13. Detecting alternative graph clusterings.

    Science.gov (United States)

    Mandala, Supreet; Kumara, Soundar; Yao, Tao

    2012-07-01

    The problem of graph clustering or community detection has enjoyed a lot of attention in complex networks literature. A quality function, modularity, quantifies the strength of clustering and on maximization yields sensible partitions. However, in most real world networks, there are an exponentially large number of near-optimal partitions with some being very different from each other. Therefore, picking an optimal clustering among the alternatives does not provide complete information about network topology. To tackle this problem, we propose a graph perturbation scheme which can be used to identify an ensemble of near-optimal and diverse clusterings. We establish analytical properties of modularity function under the perturbation which ensures diversity. Our approach is algorithm independent and therefore can leverage any of the existing modularity maximizing algorithms. We numerically show that our methodology can systematically identify very different partitions on several existing data sets. The knowledge of diverse partitions sheds more light into the topological organization and helps gain a more complete understanding of the underlying complex network.

  14. Extended Fuzzy Clustering Algorithms

    NARCIS (Netherlands)

    U. Kaymak (Uzay); M. Setnes

    2000-01-01

    textabstractFuzzy clustering is a widely applied method for obtaining fuzzy models from data. It has been applied successfully in various fields including finance and marketing. Despite the successful applications, there are a number of issues that must be dealt with in practical applications of fuz

  15. Cluster headaches simulating parasomnias.

    Science.gov (United States)

    Isik, Ugur; D'Cruz, O 'Neill F

    2002-09-01

    Nocturnal episodes of agitated arousal in otherwise healthy young children are often related to nonrapid eye movement parasomnias (night terrors). However, in patients with acute onset or increased frequency of parasomnias, organic causes of discomfort must be excluded. We report four young children whose parasomnias were caused by nocturnal cluster headaches and who responded to indomethacin dramatically.

  16. Dettagli utilizzo cluster INTEL

    OpenAIRE

    2012-01-01

    Dall'inizio dell'anno 2004 il CILEA ospita e gestisce un cluster di processori Intel a 32 bit denominato avogadro. Esso é costituito da 128 nodi biprocessori Intel Xeon 3.06 GHz. L'articolo intende presentare le problematiche relative all'utilizzo della macchina processore fornendo le istruzioni operative necessarie all'uso più efficace.

  17. Fuzzy clustering of mechanisms

    Indian Academy of Sciences (India)

    Amitabha Ghosh; Dilip Kumar Pratihar; M V V Amarnath; Guenter Dittrich; Jorg Mueller

    2012-10-01

    During the course of development of Mechanical Engineering, a large number of mechanisms (that is, linkages to perform various types of tasks) have been conceived and developed. Quite a few atlases and catalogues were prepared by the designers of machines and mechanical systems. However, often it is felt that a clustering technique for handling the list of large number of mechanisms can be very useful,if it is developed based on a scientific principle. In this paper, it has been shown that the concept of fuzzy sets can be conveniently used for this purpose, if an adequate number of properly chosen attributes (also called characteristics) are identified. Using two clustering techniques, the mechanisms have been classified in the present work and in future, it may be extended to develop an expert system, which can automate type synthesis phase of mechanical design. To the best of the authors’ knowledge, this type of clustering of mechanisms has not been attempted before. Thus, this is the first attempt to cluster the mechanisms based on some quantitative measures. It may help the engineers to carry out type synthesis of the mechanisms.

  18. Emergence of regional clusters

    DEFF Research Database (Denmark)

    Dahl, Michael S.; Østergaard, Christian Richter; Dalum, Bent

    2010-01-01

    The literature on regional clusters has increased considerably during the last decade. The emergence and growth patterns are usually explained by such factors as unique local culture, regional capabilities, tacit knowledge or the existence of location-specific externalities (knowledge spillovers,...

  19. PVM Support for Clusters

    Science.gov (United States)

    Springer, P.

    2000-01-01

    The latest version of PVM (3.4.3) now contains support for a PC cluster running Linux, also known as a Beowulf system. A PVM user of a computer outside the Beowulf system can add the Beowulf as a single machine.

  20. Hybrid cluster identification

    Science.gov (United States)

    Martín-Herrero, J.

    2004-10-01

    I present a hybrid method for the labelling of clusters in two-dimensional lattices, which combines the recursive approach with iterative scanning to reduce the stack size required by the pure recursive technique, while keeping its benefits: single pass and straightforward cluster characterization and percolation detection parallel to the labelling. While the capacity to hold the entire lattice in memory is usually regarded as the major constraint for the applicability of the recursive technique, the required stack size is the real limiting factor. Resorting to recursion only for the transverse direction greatly reduces the recursion depth and therefore the required stack. It also enhances the overall performance of the recursive technique, as is shown by results on a set of uniform random binary lattices and on a set of samples of the Ising model. I also show how this technique may replace the recursive technique in Wolff's cluster algorithm, decreasing the risk of stack overflow and increasing its speed, and the Hoshen-Kopelman algorithm in the Swendsen-Wang cluster algorithm, allowing effortless characterization during generation of the samples and increasing its speed.

  1. Resolved SZE Cluster Count

    Institute of Scientific and Technical Information of China (English)

    Jia-Yu Tang; Zu-Hui Fan

    2003-01-01

    We study the counts of resolved SZE (Sunyaev-Zel'dovich effect) clus-ters expected from an interferometric survey in different cosmological models underdifferent conditions. The self-similar universal gas model and Press-Schechter massfunction are used. We take the observing frequency to be 90 GHz, and consider twodish diameters, 1.2 m and 2.5 m. We calculate the number density of the galaxyclusters dN/(dΩdz) at a high flux limit Slimv = 100mJy and at a relative lowSlimv = 10 mJy. The total numbers of SZE clusters N in two low-Ω0 models arecompared. The results show that the influence of the resolved effect depends notonly on D, but also on Slimv: at a given D, the effect is more significant for a highthan for a low Slim Also, the resolved effect for a flat universe is more impressivethan that for an open universe. For D = 1.2m and Slimv= 10mJy, the resolvedeffect is very weak. Considering the designed interferometers which will be used tosurvey SZE clusters, we find that the resolved effect is insignificant when estimatingthe expected yield of the SZE cluster surveys.

  2. Clustering under Perturbation Resilience

    CERN Document Server

    Balcan, Maria Florina

    2011-01-01

    Recently, Bilu and Linial \\cite{BL} formalized an implicit assumption often made when choosing a clustering objective: that the optimum clustering to the objective should be preserved under small multiplicative perturbations to distances between points. They showed that for max-cut clustering it is possible to circumvent NP-hardness and obtain polynomial-time algorithms for instances resilient to large (factor $O(\\sqrt{n})$) perturbations, and subsequently Awasthi et al. \\cite{ABS10} considered center-based objectives, giving algorithms for instances resilient to O(1) factor perturbations. In this paper, we greatly advance this line of work. For the $k$-median objective, we present an algorithm that can optimally cluster instances resilient to $(1 + \\sqrt{2})$-factor perturbations, solving an open problem of Awasthi et al.\\cite{ABS10}. We additionally give algorithms for a more relaxed assumption in which we allow the optimal solution to change in a small $\\epsilon$ fraction of the points after perturbation. ...

  3. Data clustering algorithms and applications

    CERN Document Server

    Aggarwal, Charu C

    2013-01-01

    Research on the problem of clustering tends to be fragmented across the pattern recognition, database, data mining, and machine learning communities. Addressing this problem in a unified way, Data Clustering: Algorithms and Applications provides complete coverage of the entire area of clustering, from basic methods to more refined and complex data clustering approaches. It pays special attention to recent issues in graphs, social networks, and other domains.The book focuses on three primary aspects of data clustering: Methods, describing key techniques commonly used for clustering, such as fea

  4. Quartile Clustering: A quartile based technique for Generating Meaningful Clusters

    CERN Document Server

    Goswami, Saptarsi

    2012-01-01

    Clustering is one of the main tasks in exploratory data analysis and descriptive statistics where the main objective is partitioning observations in groups. Clustering has a broad range of application in varied domains like climate, business, information retrieval, biology, psychology, to name a few. A variety of methods and algorithms have been developed for clustering tasks in the last few decades. We observe that most of these algorithms define a cluster in terms of value of the attributes, density, distance etc. However these definitions fail to attach a clear meaning/semantics to the generated clusters. We argue that clusters having understandable and distinct semantics defined in terms of quartiles/halves are more appealing to business analysts than the clusters defined by data boundaries or prototypes. On the samepremise, we propose our new algorithm named as quartile clustering technique. Through a series of experiments we establish efficacy of this algorithm. We demonstrate that the quartile clusteri...

  5. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  6. Hydrolysis of polycarbonate catalyzed by ionic liquid [Bmim][Ac].

    Science.gov (United States)

    Song, Xiuyan; Liu, Fusheng; Li, Lei; Yang, Xuequn; Yu, Shitao; Ge, Xiaoping

    2013-01-15

    Hydrolysis of polycarbonate (PC) was studied using ionic liquid 1-butyl-3-methylimidazolium acetate ([Bmim][Ac]) as a catalyst. The influences of temperature, time, water dosage and [Bmim][Ac] dosage on the hydrolysis reaction were examined. Under the conditions of temperature 140°C, reaction time 3.0 h, m([Bmim][Ac]):m(PC)=1.5:1 and m(H(2)O):m(PC)=0.35:1, the conversion of PC was nearly 100% and the yield of bisphenol A (BPA) was over 96%. The ionic liquid could be reused up to 6 times without apparent decrease in the conversion of PC and yield of BPA. The kinetics of the reaction was also investigated. The results showed that the hydrolysis of PC in [Bmim][Ac] was a first-order kinetic reaction with an activation energy of 228 kJ/mol.

  7. Methanolysis of polycarbonate catalysed by ionic liquid [Bmim][Ac].

    Science.gov (United States)

    Liu, Fusheng; Li, Lei; Yu, Shitao; Lv, Zhiguo; Ge, Xiaoping

    2011-05-15

    The methanolysis of polycarbonate (PC) was studied using ionic liquid [Bmim][Ac] as a catalyst. The effects of temperature, time, methanol dosage and [Bmim][Ac] dosage on the methanolysis reaction were examined. It was shown that the conversion of PC was nearly 100%, and the yield of bisphenol A (BPA) was over 95% under the following conditions: m([Bmim][Ac]):m(PC) = 0.75:1;m(methanol):m(PC) = 0.75:1; a reaction temperature of 90 °C and a total time of 2.5h. The ionic liquid could be reused up to 6 times with no apparent decrease in the conversion of PC and yield of BPA. The kinetics of the reaction was also investigated. The results indicated that the methanolysis of PC in [Bmim][Ac] was a first-order kinetic reaction with an activation energy of 167 kJ/mol.

  8. Alternating current(AC) corrosion analyzed by electrochemical impedance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Ha, Tae Hyun; Kim, Dae Kyeong; Bae, Jeong Hyo; Lee, Hyun Goo; Lee, Sung Jin [Korea Electrotechnology Research Institute, Changwon (Korea, Republic of)

    2002-12-15

    So far, many research results on AC corrosion have been reported but each one is not consistent with another. In order to understand the characteristics and factors affecting on AC corrosion, Electrochemical impedance spectroscopy (E.I.S) was used and changes in kinetics and surface properties was analyzed. Generally, E.I.S. test has been used mainly for the diagnosis of the concrete corrosion and coating material. However, considering the outstanding functions of E.I.S. test, it can be adopted as a good method to study AC corrosion. Electrolyte resistance (R{sub sol}), double layer capacitance (C{sub dl}) and polarization resistance (R{sub p}) are the basic circuit elements. Using the model which is consist of these basic elements, various results of E.I.S. test can be interpreted. And through this method the mechanism and characteristics of AC corrosion can be explained

  9. ACS Algorithm in Discrete Ordinates for Pressure Vessel Dosimetry

    Directory of Open Access Journals (Sweden)

    Walters William

    2016-01-01

    Full Text Available The Adaptive Collision Source (ACS method can solve the Linear Boltzmann Equation (LBE more efficiently by adaptation of the angular quadrature order. This is similar to, and essentially an extension of, the first collision source method. Previously, the ACS methodology has been implemented into the TITAN discrete ordinates code, and has shown speedups of 2–4 on a simple test problem, with very little loss of accuracy (within a provided adaptive tolerance. This work examines the use of the ACS method for a more realistic problem: pressure vessel dosimetry with the VENUS-2 MOX-fuelled reactor dosimetry benchmark. The ACS method proved to be able to obtain accurate results while being approximately twice as efficient as using a constant quadrature in a standard source iteration scheme.

  10. Fabrication of alumina films with laminated structures by ac anodization

    Directory of Open Access Journals (Sweden)

    Hiroyo Segawa

    2014-01-01

    Full Text Available Anodization techniques by alternating current (ac are introduced in this review. By using ac anodization, laminated alumina films are fabricated. Different types of alumina films consisting of 50–200 nm layers were obtained by varying both the ac power supply and the electrolyte. The total film thickness increased with an increase in the total charge transferred. The thickness of the individual layers increased with the ac voltage; however, the anodization time had little effect on the film thickness. The laminated alumina films resembled the nacre structure of shells, and the different morphologies exhibited by bivalves and spiral shells could be replicated by controlling the rate of increase of the applied potentials.

  11. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment....

  12. A hybrid electromechanical solid state switch for ac power control

    Science.gov (United States)

    1972-01-01

    Bidirectional thyristor coupled to a series of actuator driven electromechanical contacts generates hybrid electromechanical solid state switch for ac power control. Device is useful in power control applications where zero crossover switching is required.

  13. A precursor of β-delayed fission:230Ac

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The 230Ra has been produced via multinucleon transfer and dissipativefragmentation of heavy target in the 60 MeV/u 18O ion reaction with natural thorium.The radium was radiochemically separated from irradiated thorium targets. 230Acwas obtained by 230Ra β-→ 230Ac. Thin Ra sources were prepared for observing fissionfragments from β-delayed fission of 230Ac. The sources were exposed to the micafission track detectors and measured by a HPGe γ detector. The two fission eventswere obtained and could been assigned to theβ-delayed fission of 230Ac. The β-delayedfission probability of 230Ac was determined to be (1.19+0.85) × 10-8.

  14. Cluster-lensing: A Python Package for Galaxy Clusters & Miscentering

    OpenAIRE

    Ford, Jes; VanderPlas, Jake

    2016-01-01

    We describe a new open source package for calculating properties of galaxy clusters, including NFW halo profiles with and without the effects of cluster miscentering. This pure-Python package, cluster-lensing, provides well-documented and easy-to-use classes and functions for calculating cluster scaling relations, including mass-richness and mass-concentration relations from the literature, as well as the surface mass density $\\Sigma(R)$ and differential surface mass density $\\Delta\\Sigma(R)$...

  15. The rotation of Galaxy Clusters

    CERN Document Server

    Tovmassian, Hrant M

    2015-01-01

    The method for detection of the galaxy cluster rotation based on the study of distribution of member galaxies with velocities lower and higher of the cluster mean velocity over the cluster image is proposed. The search for rotation is made for flat clusters with $a/b>1.8$ and BMI type clusters which are expected to be rotating. For comparison there were studied also round clusters and clusters of NBMI type, the second by brightness galaxy in which does not differ significantly from the cluster cD galaxy. Seventeen out of studied 65 clusters are found to be rotating. It was found that the detection rate is sufficiently high for flat clusters, over 60\\%, and clusters of BMI type with dominant cD galaxy, ~ 35%. The obtained results show that clusters were formed from the huge primordial gas clouds and preserved the rotation of the primordial clouds, unless they did not have merging with other clusters and groups of galaxies, in the result of which the rotation has been prevented.

  16. Photoionization of rare gas clusters

    Science.gov (United States)

    Zhang, Huaizhen

    This thesis concentrates on the study of photoionization of van der Waals clusters with different cluster sizes. The goal of the experimental investigation is to understand the electronic structure of van der Waals clusters and the electronic dynamics. These studies are fundamental to understand the interaction between UV-X rays and clusters. The experiments were performed at the Advanced Light Source at Lawrence Berkeley National Laboratory. The experimental method employs angle-resolved time-of-flight photoelectron spectrometry, one of the most powerful methods for probing the electronic structure of atoms, molecules, clusters and solids. The van der Waals cluster photoionization studies are focused on probing the evolution of the photoelectron angular distribution parameter as a function of photon energy and cluster size. The angular distribution has been known to be a sensitive probe of the electronic structure in atoms and molecules. However, it has not been used in the case of van der Waals clusters. We carried out outer-valence levels, inner-valence levels and core-levels cluster photoionization experiments. Specifically, this work reports on the first quantitative measurements of the angular distribution parameters of rare gas clusters as a function of average cluster sizes. Our findings for xenon clusters is that the overall photon-energy-dependent behavior of the photoelectrons from the clusters is very similar to that of the corresponding free atoms. However, distinct differences in the angular distribution point at cluster-size-dependent effects were found. For krypton clusters, in the photon energy range where atomic photoelectrons have a high angular anisotropy, our measurements show considerably more isotropic angular distributions for the cluster photoelectrons, especially right above the 3d and 4p thresholds. For the valence electrons, a surprising difference between the two spin-orbit components was found. For argon clusters, we found that the

  17. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Directory of Open Access Journals (Sweden)

    Kerry N. Allahar

    2014-01-01

    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  18. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Directory of Open Access Journals (Sweden)

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  19. Development of the Field of Flexible AC Transmission Systems (FACTS)

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ Theoretical and technological development of large capacity power electronics and flexible AC transmission systems are one of the most important projects developed by Tsinghua University. The Flexible AC Transmission System (FACTS) technology which uses power electronics to improve the efficiency and quality of the electrical generation, transmission and distribution system is considered to be one of the most significant technological innovations for power systems in the 20th century. The advanced static var generator (ASVG) is a key FACTS device.

  20. The topological AC effect on non-commutative phase space

    Energy Technology Data Exchange (ETDEWEB)

    Li, Kang [Hangzhou Teachers College, Department of Physics, Hangzhou (China); The Abdus Salam International Center for Theoretical Physics, Trieste (Italy); Wang, Jianhua [Shaanxi University of Technology, Department of Physics, Hanzhong (China); The Abdus Salam International Center for Theoretical Physics, Trieste (Italy)

    2007-05-15

    The Aharonov-Casher (AC) effect in non-commutative (NC) quantum mechanics is studied. Instead of using the star product method, we use a generalization of Bopp's shift method. After solving the Dirac equations both on non-commutative space and non-commutative phase space by the new method, we obtain corrections to the AC phase on NC space and NC phase space, respectively. (orig.)