Energy Technology Data Exchange (ETDEWEB)
Jesus, Sergio Luis de
2007-07-01
Pipelines, fuel storage tanks and other metallic structures are in permanent contact and exposed to different types of soils, of horizons or layers, or of soil aggressiveness. This interaction may cause expressive damages to the environment and to the planned work. Contamination may occur due to leakage of stored products, splitting during transportation, accidents caused by pipelines without extensive maintenance. The result of these accidents could be, among others, some financial losses. In order to recognize the dynamic interactions between metallic surfaces and the environment it is crucial to have preventive actions and to develop better-applied materials. API steel 5L X70 has been used in structures of low and high pressure with high mechanical strength and corrosion and, even so, it is susceptible to etching corrosion since it is in contact with different environments from mangrove regions to industrial environments. The present case evaluated the role of 5L X70 API steel in contact with different soil horizons representative of the Brazilian soil. This investigation correlated chemical species with solute ions in soil solution, secondary and primary phase minerals besides physical and chemical characteristics as pH, electric conductivity, total dissolved solids, among others, to the results of corrosion resistance and ways of corrosion. The evaluation was carried out using x-ray diffractometry, scanning electron microscopy, total reflection x-ray fluorescence, fuel injection flow besides texture and gravimetric analyses to soil characterization and mineralogy, identification of corrosion products, soil solution analyses, evaluation of tested materials and classification of ways and types of corrosion. This was an attempt to integrate the data to a better understanding of the process involving reagents and products. The results showed that different soil horizons such as different types of analyzed soils produce specific etching in metallic structures
Energy Technology Data Exchange (ETDEWEB)
Silva, Julio M. Silveira e; Carvalho, Ricardo N. de [Vallourec and Mannesmann Tubes - V e M do Brasil, Belo Horizonte, MG (Brazil)
2000-07-01
The demand for seamless pipes with resistance higher than those for API 5L X60 and X65 grades has increased in the last years. They are traditionally used up to now for applications on rigid risers for production and exportation and line pipes for oil and gas. In the case of seamless pipes, the great challenge is to fulfill the requirements of mechanical properties for X70 and X80 grades, quenched and tempered, with values of carbon equivalent low enough to assure a good weldability. This paper presents the results obtained by Vallourec and Mannesmann Tubes - V and M do Brazil on producing seamless pipes of X70 and X80 API grades, with outside diameter lower than 8 5/8{sup (} 219,1 mm ) and wall thickness up to 0,562{sup (} 14,3 mm ). Results of tensile, Charpy notch impact resistance and hardness tests are shown. Hydrogen-Induced and Environmental Cracking tests were also carried out, since for some applications is required a good resistance to these kinds of embrittlement mechanisms. The mechanical properties, microstructure and physical characteristics of welded joints were also evaluated. The results obtained up to now are quite promising, showing good suitability to the aimed final applications. (author)
Energy Technology Data Exchange (ETDEWEB)
Calcada, Mauricio Vieira; Voorwald, Herman Jacobus Cornelis; Nascimento, Marcelino Pereira do [UNESP, Guaratingueta, SP (Brazil). Faculdade de Engenharia
2010-07-01
The materials that stand in the manufacture of steel pipes are called API, that should have, high mechanical resistance, high corrosion resistance, high fatigue resistance, good weldability, and other properties. Thus, the purpose of this project was to evaluate the microstructure and hardness of welded joints by the HF/ERW process of API 5L X70 steel pipes. The microstructural analysis was performed using a surface finish with grit sizes from 220 to 25 {mu}m e polishing with diamond paste from 9 {mu}m to 0.05 {mu}m; the revelation was made with 3% Nital attack. The Vickers hardness was performed across the welded joint by 33 points to indentation. The results were: 80.5 {+-} 3.4% of ferrite and 19.5 {+-} 3.4% of perlite for microanalysis. As for hardness, the values were: 215.69 HV10 for weld line, 218.65 HV10 for ZTA and 218.95 HV10 for base metal. (author)
Energy Technology Data Exchange (ETDEWEB)
Araujo, Bruno Allison [Universidade Federal de Campina Grande (UFCG), PB (Brazil). Programa de Pos-Graduacao em Ciencia e Engenharia de Materiais; Silva, Antonio Almeida; Santos, Fabio Gualberto Chagas [Universidade Federal de Campina Grande (UFCG), PB (Brazil)
2008-07-01
The corrosion process allied to the fatigue, due to repetitive efforts of several natures, is the main responsible for the damages in pipeline and offshore structures that results in the appears of located faults, and by the way can results in leaks and financial and environmental loss. This phenomenon calls corrosion-fatigue, however, it is very complex, and mainly, in what it concerns the form as this it develops in the structure. The objective of this work is to present some results of experimental fatigue tests and corrosion-fatigue accomplished with specimen that the material originated a pipeline steel API 5L X60. The tests developed in a machine which could test until 12 specimens per time. For test of corrosion-fatigue was used a cell-of-corrosion especially projected, in this way simulated an aggressive environmental condition in a corrosion conditions. With the results of tests, was possible estimate the fatigue limits of the specimen when submitted to the repeated flexing, and compare it with evaluate corrosion-fatigue graphs, that as the literature comes moved down of the curve, in relation to the fatigue curve. (author)
Energy Technology Data Exchange (ETDEWEB)
Alves, R.T.P.; Albuquerque, S.F. [Universidade Federal de Campina Grande (UFCG), PB (Brazil); Maciel, T.M.; Almeida, D.M.; Santos, M.A.
2008-07-01
This study had as objective to evaluate the microstructure and microhardness of API 5L X80 steel welded joints, used for pipelines to transport oil and gas, using the Shield Metal Arc Welding process with pre- heating temperature of 200 deg C and 400 deg C and the AWS E8010G electrode as filler metal. For this, besides the microhardness of the welded joint, the weld metals percentiles of micro-constituents and of columnar and regenerated grains and the medium size and extension of the heat affected zone were evaluated. The percentage of acicular ferrite in weld metal ranged from 13% to 33% which generated values of microhardness from 114 HV to 309 HV. (author)
Induction bending of API 5L X80 pipes; Curvamento a quente de tubos API 5L X80
Energy Technology Data Exchange (ETDEWEB)
Batista, Gilmar Z. [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil)]. E-mail: g.zacca@petrobras.com.br; Naschpitz, Leonardo [Primus Processamento de Tubos S.A. - PROTUBO, Campo Grande, RJ (Brazil)]. E-mail: naschpitz@protubo.com.br
2005-07-01
The present work is a part of an extensive program to make possible the application of API 5L X80 in pipeline construction in Brazil. At this stage, the effect of the induction bending process on the microstructure and mechanical properties of the pipe is presented. For this study an API 5L X80 pipe, made by the UOE process, is used. The pipe was manufactured from a plate produced by thermo-mechanically controlled rolling without accelerated cooling. The pipe bending was carried out applying a local induction heating following by water quenching. The bend section, outer and inner curvature regions, of the pipe bend were evaluated and compared with the original pipe. The longitudinal weld and transition zones were not evaluated at this stage. Dimensional analyses, microstructural evaluation, Charpy-V impact tests, and tensile tests were performed. A significant microstructural change was verified in the bend area. The yield strength of the pipe bend was found to be lower than original pipe and standard requirements. Other tensile properties and impact properties are compatible with API 5L X80 requirements. (author)
Underwater Wet Repair Welding of API 5L X65M Pipeline Steel
National Research Council Canada - National Science Library
Grzegorz Rogalski; Dariusz Fydrych; Jerzy Łabanowski
2017-01-01
This paper presents results of the research of effect of polymer insulation of pipeline made of API 5L X65M steel as well as underwater wet welding parameters on properties of joints made by covered electrodes...
Energy Technology Data Exchange (ETDEWEB)
Castello Branco, J.F.; Bott, Ivani de S. [Pontificia Univ. Catolica do Rio de Janeiro, RJ (Brazil). Dept. de Ciencia dos Materiais e Metalurgia]. E-mails: joaofcb@uol.com.br; bott@dcmm.puc-rio.br; Fedele, R.A. [Boehler Thyssen Welding, Sao Paulo, SP (Brazil)]. E-mail: engenharia@btwbr.com.br; Souza, Luis Felipe G. de [Centro Federal de Educacao Tecnologica Celso Suckow da Fonseca (CEFET-RJ), Rio de Janeiro, RJ (Brazil). Dept. de Engenharia Industrial Mecanica]. E-mail: lfelipe@cefet-rj.br
2003-07-01
The present work is a part of an extensive program for the development of API 5L Gr.X80 grade steel , produced by the well-known UOE production process, for pipeline fabrication. The current stage of this program involves the characterization and performance evaluation/qualification of girth welds produced by Shield Metal Arc Weld (SMAW) under simulated field conditions, with tubes fixed in the horizontal position. Three types of electrodes were utilized for the basic tasks; the root pass, the hot pass and fill and cap passes. The root pass was carried out with an E-6010 electrode to avoid incomplete joint penetration. The hot pass, applied over the root pass, was performed with an E-9010-G electrode. The fill and cap passes were executed with E-10018-G electrodes. The welded joints produced were evaluated according to the API 1104 specification, which requires: side bend, nick- break and tensile tests. Additionally, non-destructive tests, Charpy-V impact tests and metallographic characterization were undertaken. It was verified that this welding procedure, based on three types of electrodes, could produce welded joints in accordance to the API 1104 specification. These results ensure the applicability of the API 5L Gr. X80 steel developed in this research project for use in pipeline construction. (author)
Energy Technology Data Exchange (ETDEWEB)
Oliveira, Ailton C. de; Rabello, Jose Mauricio B. [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil)
2005-07-01
The use of line pipes API 5L Grade X80, at the point of view of designer allows: reduction of wall thickness and pipe weight or increase of design pressure. In the pipeline construction point of view, the use of line pipes API 5L Grade X80 provide some advantages, however some difficulties must be expected in several stages of the construction and assembly. The implications in cost, productivity, inspection and integrity, with the application of these high resistance steels, complying with PETROBRAS Standard N - 464 Construcao, Montagem e Condicionamento de Dutos Terrestres (Rev. H - 2004 Dec) and the experience consolidated in pipelines construction abroad were presented. At the design stage, a comparison between pipelines designed using API 5L-X70 and API 5L-X80 was carried out approaching the aspects of variation of thickness, pressure design and design factor. An evaluation of the expected gains when choosing API 5L Grade X80 steels were done, regarding reduction of costs and pipe weight. Regarding API 5L-X80 pipe fabrication, the obtained results were reported, proving that this aspect was already overcome, showing the viability of its production in Brazil. Difficulties were detected regarding construction and assembly stage and showing the need of revision of PETROBRAS standard N-464. (author)
Underwater Wet Repair Welding of API 5L X65M Pipeline Steel
Directory of Open Access Journals (Sweden)
Rogalski Grzegorz
2017-04-01
Full Text Available This paper presents results of the research of effect of polymer insulation of pipeline made of API 5L X65M steel as well as underwater wet welding parameters on properties of joints made by covered electrodes. Effect of heat input on structure and hardness of joints during repair of underwater pipeline was analyzed. Welding defects like microcracks, micro-lacks of fusion, slag inclusions, as well as HAZ hardness increase over an assumed acceptance criterion for welded joints in pipes without anticorrosion polymer insulation, were identified. A significant effect of polimer insulation on structure and properties of welded joints, was found.
Energy Technology Data Exchange (ETDEWEB)
Bittencourt, Marcelo de Siqueira Queiroz; Fonseca, Manoel Antonio da Costa [Instituto de Engenharia Nuclear (IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil); Oliveira, Carlos Henrique Francisco de [PETROBRAS S.A., Rio de de Janeiro, RJ (Brazil)
2008-07-01
To preserve the environment and avoid financial losses resulting from leaks in the transport of natural oil and gas the industry is particularly concerned to ensure the structural integrity of their pipelines. Grounded pipes may be exposed to damages due to unstable soil movement, and in extreme cases, to failure. Then, techniques to assess stress in pipelines are of central importance. The ultrasonic birefringence technique is an efficient method to measure residual stress. It is based on the changing velocity of the shear wave when it crosses a material under stress; this phenomenon is known as acoustoelasticity. The knowledge of the parameter called acoustoelastic constant is necessary to measure stress using this technique. By the mechanical conformation in the manufacture of welded tubes, from rolled plates, different anisotropy degrees are showed around the cross section of these tubes. In this paper it was studied the acoustoelastic constant for the API-5L-X70 steel pipes, with different thicknesses, diameters and manufacturing processes so as to be able to use this technique to stress measurement in pipelines. (author)
Numerical evaluation of multipass welding temperature field in API 5L X80 steel welded joints
Directory of Open Access Journals (Sweden)
J Nóbrega
2016-10-01
Full Text Available Many are the metallurgical changes suffered by materials when subjected to welding thermal cycle, promoting a considerable influence on the welded structures thermo mechanical properties. In project phase, one alternative for evaluating the welding cycle variable, would be the employment of computational methods through simulation. So, this paper presents an evaluation of the temperature field in a multipass welding of API 5L X80 steel used for oil and gas transportation, using the ABAQUS ® software, based on Finite Elements Method (FEM. During the simulation complex phenomena are considerable including: Variation in physical and mechanical properties of materials as a function of temperature, welding speed and the different mechanisms of heat exchange with the environment (convection and radiation were used. These considerations allow a more robust mathematical modeling for the welding process. An analytical heat source proposed by Goldak, to model the heat input in order to characterize the multipass welding through the GTAW (Gas Tungsten Arc Welding process on root and the SMAW (Shielded Metal Arc Welding process for the filling passes were used. So, it was possible to evaluate the effect of each welding pass on the welded joint temperature field, through the temperature peaks and cooling rates values during the welding process.
Characterization of Mechanical Properties and Residual Stress in API 5L X80 Steel Welded Joints
de Sousa Lins, Amilton; de Souza, Luís Felipe Guimarães; Fonseca, Maria Cindra
2018-01-01
The use of high-strength and low-alloy steels, high design factors and increasingly stringent safety requirements have increased the operating pressure levels and, consequently, the need for further studies to avoid and prevent premature pipe failure. To evaluate the possibility of improving productivity in manual arc welding of this type of steel, this work characterizes the mechanical properties and residual stresses in API 5L X80 steel welded joints using the SMAW and FCAW processes. The residual stresses were analyzed using x-ray diffraction with the sin2 ψ method at the top and root of the welded joints in the longitudinal and transverse directions of the weld bead. The mechanical properties of the welded joints by both processes were characterized in terms of tensile strength, impact toughness and Vickers microhardness in the welded and shot peening conditions. A predominantly compressive residual stress was found, and shot peening increased the tensile strength and impact toughness in both welded joints.
Energy Technology Data Exchange (ETDEWEB)
Cordeiro, Wilson R.; Melo, Luis C.R.; Gomes, Igor O.; Boni, Luiz P.; Sanctis, Marco A.M. di [Apolo Tubulars, Lorena, SP (Brazil)
2009-07-01
High strength pipes can be manufactured with excellency in dimensional tolerances, rapidity and efficiency through HFIW process (High Frequency Induction Welding). API 5L 6 5/8 x 0,374 in pipes were made of thin, hot rolled and coiled plates with dimensional 9,300 x 1.040,0 x 140.000 mm. Mechanical tests, chemical and microstructural analysis were performed. For the microstructural analysis, ferrite and perlitic structure were detected. All the results obtained are according to API 5L, 44{sup th} edition, 2008 for the grade API 5L X70 PSL2 Offshore. (author)
Energy Technology Data Exchange (ETDEWEB)
Silva, Ronaldo C.; Roza, Juliana E.; Kojima, Sergio S. [TenarisConfab, Pindamonhangaba, SP (Brazil); Miranda, Lucio S.; Turani, Leonardo O. [USIMINAS, Ipatinga, MG (Brazil)
2005-07-01
The utilization of high strength steels can decrease, both, installation and operation costs of a new pipeline, since the increase of mechanical resistance can reduce the pipe wall thickness and, consequently, the weight of the pipe. For this purpose, the manufacture of electric resistance welding (ERW) pipes is recent, and it comes as an opportunity for gas pipelines, mainly onshore projects. As a function of their larger productivity, ERW pipes are more economically attractive than those produced by seamless and SAW processes. TenarisConfab and USIMINAS, through studies and investments in manufacturing processes, have been working to increase their skills, in order to supply ERW pipes in API 5L X80 PSL2 steel. The steel elaborated by USIMINAS is low C, high Mn, Nb, V and Ti microalloyed, and with additions of Cr and Mo, aiming to produce hot rolled coils with acicular microstructure, achieved as a combination between its chemical composition and higher cooling rates after hot rolling. The results in {phi}18''(457 mm) x 0,469''(11,91 mm) pipes are presented in this article. High toughness values reached at very low temperatures suggest that ERW API 5L X80 PSL2 pipes developed by TenarisConfab and USIMINAS may be an excellent option of choice for onshore projects that request pipes in diameters up to 20''(508 mm) and thickness up to 0,500'' (12,7 mm). (author)
The using of API steel in pipelines in Brazil; A utilizacao do aco API em dutos no Brasil
Energy Technology Data Exchange (ETDEWEB)
Narcisi Junior, Aldo; Torii, Paulo; Nogueira, Shirleine [BRASTUBO, Sao Paulo, SP (Brazil); Machado Filho, Fausto de Assis; Silva, Carlos Norberto Paula da; Camey, Kenji [Companhia Siderurgica Paulista (COSIPA), Cubatao, SP (Brazil)
1998-07-01
This work presents an overview of application, production technology improvements, and increased demand for API lines in Brazil. The need of more economical installation of oil and gas pipelines has forced the utilization of higher strength line pipe grades. This scenario induced the development of a highly competitive steelmaking and pipe producing industry in Brazil. (author)
Energy Technology Data Exchange (ETDEWEB)
Kojima, Sergio S.; Roza, Juliana E. [Tenaris Confab, Pindamonhangaba, SP (Brazil)
2004-07-01
High strength API X80 grade pipe constitute a new class of product manufactured either by the TMCP or TMCR process, which aim to obtain high values of yield strength, tensile strength and good toughness required by line pipe specifications, which are becoming more rigorous everyday. High strength steels have many advantages, due to low overall project costs associated principally with reduced wall thickness causing low transport and pipe installation costs. X80 material can be used in Onshore and Offshore constructions. This paper deals with X80 material produced by TMCR and welded by the longitudinal SAW process (submerged arc welding) by TENARIS CONFAB. The material was characterized by conducting tensile and Charpy impact tests, hardness measurements and metallographic analysis. The mechanical properties and microstructural features of the material are discussed and the advantages of using X80 grade steels in offshore projects are highlighted. The results obtained were found to be in accordance with the requirements of API 5L Standard (2000), 42nd edition. (author)
Directory of Open Access Journals (Sweden)
B Araújo
2016-09-01
Full Text Available This paper presents a study of susceptibility to hydrogen embrittlement of API 5L X80 steel welded joints by SMAW and GTAW processes. By varying the consumables used and the use of the same interpass temperature three different welded joints were obtained. Tests of hydrogen embrittlement susceptibility were performed according to ASTM G129-2006 with an aqueous solution (Solution A - TM0177/2005 NACE sodium thiosulfate (Na2S2O3 replacing the bubbling of H2S. From the elongation values was observed that the joint obtained in all welding conditions showed susceptibility to hydrogen embrittlement, which was determined by the elongation ratio. The joints that showed higher levels of hardness showed higher susceptibility to hydrogen embrittlement. The joints obtained with higher welding speeds for the same amount of heat input presented a reduction in the rate of hydrogen embrittlement. All joints tested in solution showed fracture surfaces with quasi cleavage zones.
Energy Technology Data Exchange (ETDEWEB)
Martínez-Ortiz, P. [Laboratorio de Evaluación No Destructiva Electromagnética (LENDE), ESIME-SEPI, Edif. Z-4, Instituto Politécnico Nacional, Zacatenco, México D.F. (Mexico); Pérez-Benítez, J.A., E-mail: japerezb@ipn.mx [Laboratorio de Evaluación No Destructiva Electromagnética (LENDE), ESIME-SEPI, Edif. Z-4, Instituto Politécnico Nacional, Zacatenco, México D.F. (Mexico); Espina-Hernández, J.H. [Laboratorio de Evaluación No Destructiva Electromagnética (LENDE), ESIME-SEPI, Edif. Z-4, Instituto Politécnico Nacional, Zacatenco, México D.F. (Mexico); Caleyo, F. [Departamento de Ingeniería Metalúrgica, ESIQIE, UPALM Edif. 7, Instituto Politécnico Nacional, Zacatenco, C.P. 07738 México D.F. (Mexico); Mehboob, N.; Grössinger, R. [Institute of Solid State Physics, Vienna University of Technology, Vienna A-1040 (Austria); Hallen, J.M. [Departamento de Ingeniería Metalúrgica, ESIQIE, UPALM Edif. 7, Instituto Politécnico Nacional, Zacatenco, C.P. 07738 México D.F. (Mexico)
2016-03-01
This work studies the influence of the maximum applied magnetic field on the angular dependence of the energy of the Magnetic Barkhausen Noise signal in three different API5L pipeline steels. The results show that the shape of the angular dependence of the Magnetic Barkhausen Noise energy changes with the increase of the amplitude of the applied magnetic field. This phenomenon is a consequence of the presence of unlike magnetization processes at different magnitudes of the applied magnetic field. The outcomes reveal the importance of controlling the value of the maximum applied field as parameter for the improvement of the MBN angular dependence measurements. - Highlights: • Study the angular dependence of MBN with applied field in three pipeline steels. • Reveals the change of this angular dependence with the increase applied field. • Explains this dependence based on the domain wall dynamics theory.
KAYNAKLI API 5L X65 BORU HATTI ÇELİKLERİNİN KlRlLMA TOKLUGU
Directory of Open Access Journals (Sweden)
HÜSEYİN UZUN
2002-06-01
Full Text Available Petrol ve dogal gaz boru hatla rında ya ygın olarak kulla nıla n ve ta ndem tozaltı ka yna k metodu ile bir leşt irilen API 5L X65 d u al fa zlı çeliğin kırılma to lduğu tespit edilmiştir. Kırılma to lduğu, çentikli üç nokta kırılma tokluğu deneyi kulla nıla ra k belirlenmiştir. Çentik, hem kayna k dikişinin or tası na hem de ısının tesiri altında ki bölgesi (IT AB içerisinin içine gelecek şekilde aç ılarak deney uygula nmıştır. Her bir nurnuneye gerilim giderme ta vlaması uygul anarak, kırılma tokluğu değerler inin nasıl etkilendiği değerlendirilmiştir. Elde edilen sonuçlara göre, gerilim giderme ta vı uygula nmamış ve uygulanmış numunelerde, kaynak dikişin in kırılma to ld u ğ u , IT AB bölgesinin kırılma to lduğundan daha yüksek çıkmıştır. Anahtar Kelimeler - API 5L X65 çeliğinin kırılma tokluğu, spira l dikişli borular, ta ndem tozaltı kaynağı. Abstract -The fra cture toughness of API 5L X65 dualphase steel welded by ta ndem submerged are welding process, which is used widely petrolenın and na tural gas pipelines, wa s investigated. The fra cture toughness values were obta ined using by three point bend fracture toughness test specimens. The notch was machined either in the center of w el d meta l or the heat affected zone (H AZ. It wa s employed stress relief annealing in order to inves tigate the effect heat treatment on the fra cture toughness va lues. The results show tha t the fracture toughness va lues of weld metal with both heat treatment and non-h eat treatment are higher than that of the heat affected zone. Keywords - Fracture toughness of API 5L X65 steel, sp ira ll y welded pipeline, tandem submerged are welding. ı. GİRİŞ Doğal gaz ve petrol taşıma borularında, sistemin emniyeti için API 5L standardına uygun sertifikalı borular tercih edilmektedir. Bu standarda göre, boyuna veya H. UZUN: Sakarya Üniversitesi, Teknik Eğitim Fak
Estudo das tensões residuais de juntas soldadas de aço API 5L X80
Directory of Open Access Journals (Sweden)
Bruno Allison Araújo
2013-09-01
Full Text Available Este trabalho teve por objetivo determinar os níveis de tensões residuais decorrentes de processos de soldagem em juntas soldadas de um aço API 5L X80. Inicialmente foram executados os procedimentos de soldagem das juntas utilizando os processos de soldagem eletrodo revestido - Shielded Metal Arc Welding (SMAW e eletrodo de tungstênio com proteção gasosa - Gas Tungsten Arc Welding (GTAW, variando-se os consumíveis utilizados e empregando-se uma temperatura de interpasse de 175ºC, obtendo-se, desta maneira, três juntas soldadas. Foram avaliadas as regiões superiores e inferiores das juntas, determinando-se os níveis de tensões residuais transversais e longitudinais. As medidas de tensão residual foram realizadas por difratometria de raios-x através de um difratômetro portátil e respectivo software para análise dos resultados. Para a região superior das juntas soldadas, foi observado que quanto mais elevado for o aporte térmico mais compressivas foram os níveis de tensões residuais transversais, e mais deslocadas ficaram os picos de tensões trativas. Na região inferior das juntas soldadas, foi verificado que para maiores aportes térmicos, maiores foram os níveis de tensões residuais trativas na região do Metal de Solda (MS e menor foi o nível de tensões residuais trativas na Zona Termicamente Afetada (ZTA.
Farzam, M.; Baghery, P.; H. R. Mardan Dezfully
2011-01-01
API 5A and 5L (grades J55, H40, N80, and K55) are used in making drill pipe and well casing. In this paper after studying the rheological and chemical properties of the mud, the effective corrosion parameters were reviewed and studied. The drill pipe corrosion management, with reference to NACE PRO 502-2002 was made and showed that for 50 drilling rigs 120 million dollars is to be spent in 21 years for corrosion damage. Potentiodynamic polarization tests were made to study the drill-pipe (API...
Directory of Open Access Journals (Sweden)
Cooper, R.
2004-08-01
Full Text Available The present work refers to the characterization of API 5L-X80 pipeline joints welded with self-shielded flux cored wire. This process was evaluated under preheating conditions, with an uniform and steady heat input. All joints were welded in flat position (IG, with the pipe turning and the torch still. Tube dimensions were 762 mm in external diameter and 16 mm in thickness. Welds were applied on single V-groove, with six weld beads, along with three levels of preheating temperatures (room temperature, 100 °C, 160 °C. These temperatures were maintained as interpass temperature. The filler metal E71T8-K6 with mechanical properties different from parent metal was used in undermatched conditions. The weld characterization is presented according to the mechanical test results of tensile strength, hardness and impact test. The mechanical tests were conducted according to API 1104, AWS and ASTM standards. API 1104 and API 51 were used as screening criteria. According to the results obtained, it was possible to remark that it is appropriate to weld API 5L-X80 steel ducts with Self-shielded Flux Cored wires, in conformance to the API standards and no preheat temperature is necessary.
Este trabajo presenta un estudio sobre la caracterización de las propiedades mecánicas de uniones soldadas con alambre tubular autoprotegido, de acero API 5L-X80. En este sentido, se evalúa la influencia de la temperatura de precalentamiento, manteniendo el aporte de calor uniforme. Todas las uniones soldadas se realizaron en la posición plana (IG, con la antorcha fíja y la tubería girando. Se utilizó un tubo de 762 mm de diámetro exterior y 16 mm de espesor. Las soldaduras se aplicaron sobre una unión de tope con bisel en V simple, utilizando 6 pasadas, con tres niveles de temperatura de precalentamiento (ambiente, 100 °C y 160 °C. Estas temperaturas se mantuvieron como temperatura entre pasadas. El metal de aporte, del tipo E71T8-K6, se utilizó en la
Directory of Open Access Journals (Sweden)
Qazi H. A. A.
2017-12-01
Full Text Available Verification and validation of welding procedure specifications for X-70 grade line pipe welding was performed as per clause 8.2, Annexure B and D of API 5L, 45th Edition to check weld integrity in its future application conditions. Hot rolled coils were imported from China, de-coiling, strip edge milling, three roller bending to from pipe, inside and outside submerged arc welding of pipe, online ultrasonic testing of weld, HAZ and pipe body, cutting at fixed random length of pipe, visual inspection of pipe, Fluoroscopic inspection of pipe, welding procedure qualification test pieces marking at weld portion of the pipe, tensile testing, guided bend testing, CVN Impact testing were performed. Detailed study was conducted to explore possible explanations and variation in mechanical properties, WPS is examined and qualified as per API 5L 45th Edition.
Al-Abbas, F.; Kakpovbia, A.; Mishra, B.; Olson, D.; Spear, J.
2012-05-01
Nondestructive electrochemical techniques were used to investigate the microbiologically influenced corrosion (MIC) by Sulfate Reducing Bacteria (SRB) corrosion of API 5L X65 linepipe steel. These techniques included Electrochemical Impedance Spectroscopy (EIS), open circuit potential (OCP) and linear polarization resistance (Rp). OCP trend showed anodic polarization of 67 mV between the biotic media with reference to abiotic media. These shifts were attributed to the cathodic side reactions produced by the metabolic activity of SRB. Through circuit modeling, EIS results were used to interpret the real time interactions between the electrode, biofilm and solution interfaces.
Energy Technology Data Exchange (ETDEWEB)
Ceglias, Rodrigo Braga; Alves, Juciane Maria; Botelho, Ramon Alves; Baeta Junior, Eustaquio de Souza; Santos, Igor Cuzzuol dos; Moraes, Nicki Robbers Darciano Cajueiro de; Oliveira, Rebeca Vieira de; Diniz, Saulo Brinco; Brandao, Luiz Paulo, E-mail: brandao@ime.eb.br [Instituto Militar de Engenharia (IME), Rio de Janeiro, RJ (Brazil). Secao de Engenharia Mecanica e de Materiais
2016-09-15
The API 5L X70 steel is used in high-pressure gas transmission pipelines. Because of this, knowledge of presence of residual stress and their magnitude is important to assess the material integrity in service. For the pipeline manufacturing, tubes need to be curved which is often made using the hot induction bending process. This process can introduce different residual stress depending of tube position. For this research, in order to evaluate the residual stress, was used an API 5L X70 tube that was previously curved by hot induction process. Samples were taken from the extrados, intrados, neutral line and straight section of the curved tube. Residual stresses were studied by two conventional methods: X-Ray Diffraction (XRD) and Hole-Drilling, which are destructive and non-destructive methods, respectively, in order to assess their qualitative responses. Each of these methods presents particular methodologies in sample preparation and material analysis, but also they differ in factors such time consumption and cost of the analysis. The qualitative responses obtained by the two different methods were comparable and satisfactory and pointed out the existence of a compressive residual stress state in steel pipe. (author)
Jacobson, Daniel; Woods, Dan
2011-01-01
Programmers used to be the only people excited about APIs, but now a growing number of companies see them as a hot new product channel. This concise guide describes the tremendous business potential of APIs, and demonstrates how you can use them to provide valuable services to clients, partners, or the public via the Internet. You'll learn all the steps necessary for building a cohesive API business strategy from experts in the trenches. Facebook and Twitter APIs continue to be extremely successful, and many other companies find that API demand greatly exceeds website traffic. This book offe
Estudio del daño por hidrógeno en uniones soldadas de un acero API 5L X52
Directory of Open Access Journals (Sweden)
Réquiz, R.
2008-04-01
Full Text Available The main objective of the present investigation was to study the susceptibility to hydrogen damage on a type API 5L X52 steel welded by electrical resistance. Several techniques, such as hydrogen permeation and cathodic charging were used. The metallic material was characterized using SEM and TEM. The base metal microstructure was very similar to that one corresponding to the welded area. This microstructure was mainly comprised by ferrite and perlite, differing only in the grain size. Therefore, the susceptibility to hydrogen damage was similar in both cases. It is worth mentioning that the welded area has very small dimensions. Indeed, the fusion zone is only 5 mm wide while the heat affected zone is 1 mm wide. The hydrogen damage observed was mainly in the form of blisters, which were associated to the presence of aluminum rich inclusions. Also, it was noticed partial inclusion dissolution and some matrix attack adjacent to the inclusions.
En la presente investigación se estudió la susceptibilidad al daño por hidrógeno en un acero API 5L X52 soldado por resistencia eléctrica. Para ello, se emplearon técnicas de permeación y de carga catódica de hidrógeno. El material fue caracterizado mediante microscopía electrónica de barrido y de transmisión. La susceptibilidad al daño por hidrógeno fue similar tanto en el metal base como en el cordón de soldadura. Este comportamiento se vincula a la microestructura homogénea constituida por perlita y ferrita, que presentan ambos, aun cuando existen diferencias en el tamaño de grano. El cordón de soldadura tenía dimensiones muy pequeñas, donde la zona de fusión y la afectada por el calor poseen espesores de 5 mm y 1 mm, respectivamente. El daño inducido por hidrógeno se presentó en forma de ampollas en la superficie del material, asociado, principalmente, a la presencia de inclusiones globulares y semiglobulares ricas en aluminio. Además, se manifestó una disoluci
Directory of Open Access Journals (Sweden)
Jailson A. Da Nóbrega
2016-01-01
Full Text Available Metallic materials undergo many metallurgical changes when subjected to welding thermal cycles, and these changes have a considerable influence on the thermo-mechanical properties of welded structures. One method for evaluating the welding thermal cycle variables, while still in the project phase, would be simulation using computational methods. This paper presents an evaluation of the temperature field and residual stresses in a multipass weld of API 5L X80 steel, which is extensively used in oil and gas industry, using the Finite Element Method (FEM. In the simulation, the following complex phenomena were considered: the variation in physical and mechanical properties of the material as a function of the temperature, welding speed and convection and radiation mechanisms. Additionally, in order to characterize a multipass weld using the Gas Tungsten Arc Welding process for the root pass and the Shielded Metal Arc Welding process for the filling passes, the analytical heat source proposed by Goldak and Chakravarti was used. In addition, we were able to analyze the influence of the mesh refinement in the simulation results. The findings indicated a significant variation of about 50% in the peak temperature values. Furthermore, changes were observed in terms of the level and profile of the welded joint residual stresses when more than one welding pass was considered.
Energy Technology Data Exchange (ETDEWEB)
Forero, Adriana [Pontificia Universidade Catolica (PUC-Rio), Rio de Janeiro, RJ (Brazil); Ponciano, Jose A. [Universidade Federal do Rio de Janeiro (COPPE/UFRJ), RJ (Brazil). Coordenacao dos Programas de Pos-graduacao em Engenharia; Bott, Ivani de S. [Pontificia Universidade Catolica do Rio de Janeiro (PUC-Rio), Rio de Janeiro, RJ (Brazil). Dept. de Ciencia dos Materiais e Metalurgia
2009-07-01
The susceptibility of pipeline steels to stress corrosion cracking (SCC) depends on a series of factors ranging from the manufacture of the steel, the pipe fabrication and the assembly of the pipeline to the type of substances to be transported. The welding procedures adopted during the production and construction of the pipelines (field welding), can modify the properties of the base metal in the heat affected zone (HAZ), potentially rendering this region susceptible to SCC. This study evaluates the resistance of girth welds, in API 5L X80 pipes, to hydrogen embrittlement and to stress corrosion cracking in the presence of sulphides. The evaluation was performed according to NACE TM0177/96, Method A, applying the criterion of fracture/no fracture, and Slow Strain Rate Tensile tests (SSRT) were undertaken using a sodium thiosulphate solution according to the ASTM G129-00 Standard. According NACE requirements, the base metal was approved. The weld metal exhibited susceptibility to SCC in the presence of sulphides, failing in a period of less than 720h. This was confirmed by SSR tensile tests, where a significant decrease in the ultimate tensile strength, the elongation and the time to fracture were observed. The mechanism of fracture was transgranular. (author)
Influencia del acabado superficial en la permeación de hidrógeno del acero API 5L-X52
Directory of Open Access Journals (Sweden)
Réquiz, R.
2004-02-01
Full Text Available The influence of surface roughness on the corrosion and hydrogen permeation behaviour was evaluated on a type API 5L-X52 steel in deaerated 0.1 M Na2SO4 at pH=2. Potentiodynamic polarization curves were employed to determine the electrochemical behaviour of the steel, while the Devanathan-Stachurski technique was used to estimate the hydrogen permeation rate. Additionally, the surface roughness profiles were obtained in order to correlate the changes in the hydrogen permeation rate with different metal surface finishings. The obtained results clearly demonstrate that when the roughness parameters have larger values, the cathodic current of hydrogen evolution increases while the hydrogen entry rate decreases. This effect can be attributed to the microstructural defects induced at the steel surface, such as dislocations, which increase the catalytic activity of the atomic hydrogen favouring its recombination. Also, these defects could allow the atomic hydrogen to remain adsorbed on the steel surface. Both effects could hinder the hydrogen diffusion into the metal since the possibility for this atom of becoming absorbed has been reduced
En el presente trabajo de investigación se evalúa la influencia del acabado superficial, tanto en la corrosión generalizada como en la permeación de hidrógeno del acero API 5L-X52 en solución de Na2SO4 0,1M, a pH=2. El comportamiento electroquímico del acero se estudió mediante las curvas de polarización potenciodinámicas, mientras que la susceptibilidad al daño por hidrógeno se evaluó mediante la técnica de permeación de Devanathan- Stachurski. Además, se determinaron los parámetros de rugosidad a las muestras de acero con diferentes acabados superficiales, para luego correlacionarlos con los cambios en las corrientes de permeación de hidrógeno. Los resultados obtenidos demuestran, claramente, que, cuando la rugosidad superficial del acero
Directory of Open Access Journals (Sweden)
Rizkiyah Ramadani
2017-01-01
Full Text Available Kekuatan sambungan las pada suatu konstruksi perlu diperhatikan dengan baik dan pengujian pun perlu dilakukan untuk mengetahui ketahanan bahan terhadap suatu beban. Dalam penelitian tugas akhir ini bertujuan untuk mengetahui pengaruh sudut bevel dan kondisi optimal akibat kombinasi pengelasan FCAW dan SMAW terhadap kekuatan impact butt joint pada material pipa API 5L grade X42. Variasi sudut bevel yang digunakan adalah 60o, 40o, dan 0o. Pengujian impact merupakan suatu upaya untuk mensimulasikan kondisi operasi material yang sering ditemui dalam perlengkapan transportasi atau konstruksi dimana beban tidak selamanya terjadi secara perlahan-lahan melainkan datang secara tiba-tiba, khususnya dalam konstruksi bangunan lepas pantai dimana beban secara tiba – tiba sangat memungkinkan untuk terjadi. Dari hasil penelitian yang dilakukan didapatkan bahwa nilai kekuatan impact pada sudut bevel 60o di bagian weld adalah sebesar 2.01 J/mm2 dan bagian HAZ sebesar 2.08 J/mm2. Sudut bevel 40o memiliki nilai pada bagian weld sebesar 2.10 J/mm2 dan bagian HAZ sebesar 2.13 J/mm2. Namun memiliki pengaruh yang jauh berbeda dengan sudut bevel 0o yaitu memiliki nilai impact sebesar 1.72 J/mm2 untuk bagian weld dan 1.13 J/mm2 untuk bagian HAZ . Kondisi optimal pengaruh sudut bevel terhadap kekutan impact adalah sudut 40o . Hal ini dikarenakan persentase ferrite metalografi struktur mikronya lebih banyak dibandingkan dengan sudut bevel 60o dan 0o dan juga memiliki nilai kekerasan yang rendah sehingga bersifat ulet menyebabkan nilai impact-nya lebih unggul. Selain itu efisensi dalam segi penghematan waktu kerja, perkerja maupun biaya produksi lebih baik.
Envelhecimento por Deformação em Juntas Soldadas de Tubos de Aço API5L X65Q sem Costura
Directory of Open Access Journals (Sweden)
Rodolfo Lisboa Batalha
2015-09-01
Full Text Available Resumo Neste trabalho, investigaram-se efeitos do fenômeno de envelhecimento por deformação em juntas obtidas por soldagem a arco elétrico com proteção gasosa (GMAW, de tubos sem costura de aço API5L X65Q. Corpos de prova (CPs obtidos a partir das juntas soldadas foram submetidos à uma deformação plástica a frio de 3% e posteriormente envelhecidas por 1h a 250°C, de forma a se induzir envelhecimento estático. Buscando avaliar o envelhecimento dinâmico, os CPs foram deformados até 3% e o carregamento foi mantido durante 1h a 250°C. Os CPs envelhecidos foram submetidos a ensaios de tração e amostras representativas foram analisadas ao microscópio óptico e microscópio eletrônico de varredura. Observou-se que o fenômeno modificou a fração volumétrica de constituintes secundários no metal de solda e na ZTA, com aumento na proporção de agregados ferrita-carbonetos. Com relação às propriedades mecânicas, constatou-se que o fenômeno reduziu a razão elástica das juntas soldadas devido a um aumento no limite de resistência, além de aumentar o alongamento total, não prejudicando, portanto, as propriedades mecânicas em tração das juntas soldadas. Ao se comparar o envelhecimento estático com o envelhecimento dinâmico, observou-se que o aumento na capacidade de deformação plástica das juntas soldadas foi maior após envelhecimento estático por deformação.
Directory of Open Access Journals (Sweden)
Lívia Carla Silva de Araújo
2015-06-01
Full Text Available ResumoAços que atendem à norma API 5L são aplicados na construção de dutos e há grande interesse naqueles de maior resistência, como o grau API 5L X70Q. Ainda são escassos os estudos relacionados a tubos sem costura. Durante a montagem, os tubos podem ser soldados por eletrodos revestidos (SMAW e eventualmente sofrer aquecimento indutivo para adequação à topografia do terreno, processos que podem alterar a microestrutura das juntas. Neste trabalho foram obtidas juntas soldadas pelo processo SMAW, a partir de tubo sem costura grau API 5L X70Q. As juntas foram submetidas a tratamentos térmicos pós-soldagem nas temperaturas 920 °C e 600 °C. Foram realizados ensaios de tração, impacto Charpy e microdureza, além de caracterização metalográfica nas amostras de metal base e nas juntas como soldadas e após os tratamentos térmicos. O tratamento térmico a 920 °C promoveu a formação de estrutura ferrita/perlita, com consequente redução na resistência mecânica das juntas a valores inferiores aos especificados para o grau X70Q. Porém, o tratamento térmico a 600 °C mostrou-se benéfico devido à redução da fração volumétrica dos constituintes martensita/austenita e martensita-austenita-bainita, sem reduzir de forma significativa a resistência mecânica e com relativo ganho na tenacidade ao impacto na ZTA e na ZF.
Directory of Open Access Journals (Sweden)
Vicente Braz Trindade
Full Text Available Resumo Características microestruturais e mecânicas foram avaliadas ao longo da seção transversal de juntas obtidas por soldagem (GMAW, de tubos sem costura de aço API 5L X65Q. Dois tipos de juntas foram obtidas a partir da confecção de chanfro V e ½ V. Dividindo-se as chapas soldadas em 8 camadas espaçadas de 3mm, no sentido transversal, corpos de prova foram confeccionados para ensaios de tração, microdureza Vickers e análise química. Foi realizada ainda caracterização metalográfica no metal base e nas juntas soldadas. Observou-se pequena alteração na composição química do metal de solda entre as camadas da junta V e junta ½ V. A maior taxa de resfriamento promoveu maior fração de ferrita acicular no chanfro ½ V. Alguns corpos de prova de tamanho reduzido não atenderam aos limites mínimos de escoamento e de resistência especificados na Norma API 5L, resultado atribuído à presença de descontinuidades em algumas regiões da solda. A maior microdureza Vickers da junta ½ V foi atribuída à maior presença de ferrita acicular. A adoção de chanfro estreito para aumento de produtividade na soldagem do aço em estudo não impactou negativamente as propriedades da junta, entretanto, aumentou a ocorrência de falta de fusão na face do bisel.
Energy Technology Data Exchange (ETDEWEB)
Ordonez, Robert E. Cooper; Silva, Jose Hilton F.; Trevisan, Roseana E. [Universidade Estadual de Campinas, SP (Brazil). Faculdade de Engenharia Mecanica. Dept. de Engenharia de Fabricacao
2003-07-01
Flux Core Arc Welding processes (FCAW) are beginning to be applied in pipeline welds, however, very limited experimental data regarding mechanical properties of pipeline weld joints with these processes are available in the literature. In this paper, the effects of preheat temperature and type of FCAW on mechanical properties (microhardness and tensile strength) of API X80 weld joint steel are presented. FCAW processes with gas protection and self-shielded were used. Multipasses welding were applied in 30'' diameter and 0,625'' thickness tubes. Influence factors were: FCAW type and preheat temperature. Acceptance criteria of welded joints were evaluated by API 1104 standard for tensile strength test and ASTM E384-99 for microhardness test. The results obtained showed that FCAW type and preheat temperature have no influence on mechanical properties of API X80 joint steel. (author)
Directory of Open Access Journals (Sweden)
Siderley Fernandes Albuquerque
2011-12-01
Full Text Available O objetivo do trabalho foi avaliar as características da zona termicamente afetada (ZTA e a microestrutura e propriedades mecânicas de metais de solda de juntas soldadas do aço API 5L X80, obtidos para quatro diferentes procedimentos de soldagem utilizando processos manuais e automatizados. Para isto, chapas do referido aço foram soldadas por processo manual ao Arco Elétrico com Eletrodo Revestido (SMAW, utilizando 473 e 673 K como temperaturas de interpasses e o eletrodo celulósico AWS E8010-G como consumível; por processo ao Arco Elétrico com Arame Tubular (FCAW robotizado, utilizando o arame AWS E71T- 1C como metal de adição e argônio com 25%CO2 como gás de proteção; por processo a Arco Elétrico com Eletrodo de Tungstênio (GTAW mecanizado na raiz da solda, usando o arame ER70S-3 e argônio como gás de proteção. As análises microestruturais foram relacionadas com os resultados de ensaios de impacto Charpy nos metais de solda e com os perfis de microdureza Vickers ao longo da junta soldada. Os resultados indicaram maiores percentuais de Ferrita Acicular e maiores valores de resistência ao impacto nos metais de solda e uma menor extensão e granulometria da ZTA, associado ao procedimento de soldagem utilizando processo automatizado com maior velocidade de soldagem.The objective of this work was to evaluate the heat affected zone characteristics and weld metals microstructure and mechanical properties of API 5L X80 steel welded joints, obtained for four different welding procedures using manual and automated processes. For this, plates of this steel were welded by manual Shielded Metal Arc Welding (SMAW process with interpasses temperatures of 473 e 673 K, and using AWS E8010-G electrode as filler metals; robotized Flux Cored Arc Welding (FCAW process, using AWS E71T-1C wire and Ar25%CO2 as consumable and mechanized Gas Tungsten Arc Welding (GTAW process, for the root pass using AWS ER70S-3 and Ar as consumable .The
Directory of Open Access Journals (Sweden)
JOSE MATOS
2012-01-01
Full Text Available El objetivo de este trabajo fue evaluar y caracterizar el comportamiento mecánico en desgaste del acero API 5L X65, revestido con niobio en comparación al desempeño del revestimiento de la aleación de inconel 625 empleados en la industria de petróleo y gas. El revestimiento de niobio fue obtenido por el proceso de aspersión térmica a plasma de arco no transferido y el revestimiento inconel 625 por soldadura con electrodo revestido. La resistencia al desgaste por abrasión fue evaluada según la norma Petrobras N-2568, en un tribómetro CTER, la rugosidad y el volumen de material desgastado se determinó a través de perfilometría y la dureza de los revestimientos por microscopia Vickers. Los revestimientos obtenidos fueron caracterizados respecto a su morfología por microscopia electrónica de barrido (MEB y microscopía óptica (MO. La mayor dureza del revestimiento con niobio obtenido puede haber contribuido a reducir la tasa de desgaste en comparación con el revestimiento de inconel 625.
U.S. Department of Health & Human Services — Pioneer ACO PUF - To address the increasing number of requests for Pioneer ACO data, the Centers for Medicare and Medicaid Services (CMS) has created a standard...
Directory of Open Access Journals (Sweden)
Rodríguez-Vanegas, N.
2011-10-01
Full Text Available The concentration of chloride ions and the partial pressure of CO2 play an important role in the degradation of low-carbon steels used for the construction of pipelines in oil and gas industry. In order to evaluate the susceptibility of carbon steel API 5L X42 to pitting corrosion electrochemical noise and linear polarization resistance measurements were carried out in aqueous solutions containing chloride ions and CO2. The concentration of chloride ions was varied between, 10000 and 18000 ppm, and the CO2 partial pressure between 10 psi and 18 psi. Experimental results pointed out that the formation of protective layer, consisting mainly of FeCO 3, depends on the partial pressure of CO2 in the system. Nevertheless, the stability of this layer was considerably affected by increasing the concentration of chloride ions causing that localized corrosion has taken place in some areas of the surface of API 5L X42, which were detected by electrochemical noise echnique.La concentración de iones cloruro y la presión parcial de CO2, tienen un papel importante en el proceso de degradación de los aceros de bajo carbono empleados en la construcción de líneas de transporte en industrias petroleras. Con el fin de evaluar la susceptibilidad del acero al carbono API 5L X42 a la corrosión por picado, se realizaron medidas de ruido electroquímico y resistencia a la polarización lineal en soluciones acuosas de iones cloruro con concentraciones entre 10.000 y 18.000 ppm, variando la presión parcial de CO2 entre 10 psi y 18 psi. Los resultados indican que la formación de una capa protectora, constituida principalmente por FeCO3, depende de la presión parcial de CO2 del sistema. No obstante, la estabilidad de dicha capa es afectada significativamente por el aumento de la concentración de iones cloruro, que producen fenómenos de corrosión localizada en algunas áreas de la superficie del acero API 5L X42, los cuales fueron detectados por la técnica de
U.S. Department of Health & Human Services — The Pioneer ACO Model is designed for health care organizations and providers that are already experienced in coordinating care for patients across care settings. It...
Directory of Open Access Journals (Sweden)
Jefferson Pinto Soares
2017-12-01
Full Text Available Resumo O propósito deste trabalho é comparar as mudanças na microestrutura e na dureza de um tubo de aço API 5L X-52, revestido internamente por soldagem com Inconel 625, após a execução dos tratamentos térmicos de normalização a 1100 °C por 60 min. e resfriamento ao ar, e de solubilização a 1030 °C com aquecimento por indução eletromagnética por 30 s. e resfriamento em água. Foram utilizadas técnicas de microscopia ótica (MO e eletrônica de varredura (MEV, análise por espectroscopia de energia dispersiva (EDS e dureza Vickers. Na condição como soldada, o metal de base (MB teve na zona termicamente afetada (ZTA a formação de zona de grãos grosseiros (ZGG com dureza média de 234 HV. A zona parcialmente diluída (ZPD se apresentou clara, sem contornos de grãos, com alto teor de ferro e dureza média de 370 HV, indicando ser constituída de martensita. No revestimento, a microestrutura é austenítica dendrítica com formação de carbetos de Nb e indícios da presença da fase Laves, com dureza média de 287 HV em suas camadas. Na condição após normalização, a ZTA foi suprimida e houve refino na microestrutura do MB; a ZPD foi mantida com sua morfologia original, porém com redução de cerca de 15% em sua dureza; no revestimento, a microestrutura tornou-se granular, com indício da dissolução da fase Laves e redução de sua dureza de cerca de 26%. Na condição após solubilização, a ZTA do MB foi eliminada, a ZPD manteve sua morfologia e microestrutura original, mas reduziu sua dureza em cerca de 30%; no revestimento, a microestrutura e precipitados foram mantidos, mas houve uma redução da dureza em cerca de 20%. Por fim, este trabalho conclui que ambos os tratamentos térmicos foram considerados benéficos às propriedades do tubo de aço API 5L X-52 revestido internamente com Inconel 625. Promoveram a homogeneização da microestrutura e a redução de dureza na ZTA do MB, significativa redução da
Financial Performance of Rural Medicare ACOs.
Nattinger, Matthew C; Mueller, Keith; Ullrich, Fred; Zhu, Xi
2018-12-01
The Centers for Medicare & Medicaid Services (CMS) has facilitated the development of Medicare accountable care organizations (ACOs), mostly through the Medicare Shared Savings Program (MSSP). To inform the operation of the Center for Medicare & Medicaid Innovation's (CMMI) ACO programs, we assess the financial performance of rural ACOs based on different levels of rural presence. We used the 2014 performance data for Medicare ACOs to examine the financial performance of rural ACOs with different levels of rural presence: exclusively rural, mostly rural, and mixed rural/metropolitan. Of the ACOs reporting performance data, we identified 97 ACOs with a measurable rural presence. We found that successful rural ACO financial performance is associated with the ACO's organizational type (eg, physician-based) and that 8 of the 11 rural ACOs participating in the Advanced Payment Program (APP) garnered savings for Medicare. Unlike previous work, we did not find an association between ACO size or experience and rural ACO financial performance. Our findings suggest that rural ACO financial success is likely associated with factors unique to rural environments. Given the emphasis CMS has placed on rural ACO development, further research to identify these factors is warranted. © 2016 National Rural Health Association.
General Services Administration — This Recalls API allows you to tap into a list of (1) drug and food safety recalls from the Food and Drug Administration, Food Safety and Inspection Service, and...
General Services Administration — This Jobs API returns job openings across the federal government and includes all current openings posted on USAJobs.gov that are open to the public and located in...
Directory of Open Access Journals (Sweden)
Gustavo L. Knop
2006-01-01
Full Text Available Los feocromocitomas cardíacos primarios (FCP son sumamente infrecuentes. Hasta el presente son menos de 50 los casos comunicados en el mundo. Presentamos el caso de un tumor intrapericárdico, que resultó ser un feocromocitoma primario, en una mujer de mediana edad, cuyo signo principal fue hipertensión arterial severa (HTAs. Los estudios diagnósticos por imágenes corroboraron la presencia de un tumor intrapericárdico como único hallazgo y los estudios bioquímicos de catecolaminas y sus metabolitos excretados por orina reafirmaron el diagnóstico etiológico. El tumor fue resecado quirúrgicamente sin complicaciones mediante cirugía cardíaca convencional con circulación extracorpórea (CEC y paro cardíaco con cardioplejía. Siete meses después de la operación, la paciente se encuentra asintomática y normotensa.
U.S. Department of Health & Human Services — The Interaction API is a web service for accessing drug-drug interactions. No license is needed to use the Interaction API. Currently, the API uses DrugBank for its...
Study of an API migration for two XML APIs
T.T. Bartholomei; K. Czarnecki; R. Lämmel (Ralf); T. van der Storm (Tijs); M.G.J. van den Brand (Mark); D. Gasevic; J. Gray
2010-01-01
htmlabstractAPI migration refers to adapting an application such that its dependence on a given API (the source API) is eliminated in favor of depending on an alternative API (the target API) with the source and target APIs serving the same domain. One may attempt to automate API migration by code
Analyzing the Change-Proneness of APIs and web APIs
Romano, D.
2015-01-01
Analyzing the Change-Proneness of APIs and web APIs APIs and web APIs are used to expose existing business logic and, hence, to ease the reuse of functionalities across multiple software systems. Software systems can use the business logic of legacy systems by binding their APIs and web APIs. With the emergence of a new programming paradigm called service-oriented, APIs are exposed as web APIs hiding the technologies used to implement legacy systems. As a consequence, web APIs establish contr...
[Transcriptional regulation of aco gene cluster in Bacillus thuringiensis].
Huang, Minzhong; Zhang, Jie; Gao, Jiguo; Song, Fuping
2015-09-04
We analyzed the transcriptional regulation of aco gene cluster and the phenotype of acoR mutant, to determine the effect of acoR deletion on sporulation efficiency and Cry protein production. Sequence of aco gene cluster in Bacillus thuringiensis was analyzed by sequence alignment. RT-PCR was carried out to reveal the transcriptional units of the aco gene cluster. acoR insertion mutant was constructed by homologous recombination. Transcriptional activity was analyzed by promoter fusions with lacZ gene. Comparison of the Cry1Ac protein production was determined by protein quantitation. The aco gene cluster was composed of four genes. The acoABCL formed one transcriptional unit. The transcriptional activity of acoA promoter sharply decreased in sigL and acoR mutants, respectively. Deletion of acoR had no effect on growth and Cry protein production, but decreased the motility of cells and sporulation efficiency. The aco gene cluster is controlled by Sigma 54 and activated by AcoR. Deletion of acoR has no effect on Cry protein production, but decreased the motility of the cells.
Analyzing the Change-Proneness of APIs and web APIs
Romano, D.
2015-01-01
Analyzing the Change-Proneness of APIs and web APIs APIs and web APIs are used to expose existing business logic and, hence, to ease the reuse of functionalities across multiple software systems. Software systems can use the business logic of legacy systems by binding their APIs and web APIs. With
U.S. Department of Health & Human Services — All of the data used on the Finder.HealthCare.gov web application is available through this API. There are multiple collections of data available through the API. 1....
Cinar, Onur
2015-01-01
The Android Quick APIs Reference is a condensed code and APIs reference for the new Google Android 5.0 SDK. It presents the essential Android APIs in a well-organized format that can be used as a handy reference. You won't find any technical jargon, bloated samples, drawn out history lessons, or witty stories in this book. What you will find is a software development kit and APIs reference that is concise, to the point and highly accessible. The book is packed with useful information and is a must-have for any mobile or Android app developer or programmer. In the Android Quick APIs Refe
Asthma-COPD overlap syndrome (ACOS): A diagnostic challenge.
Tho, Nguyen Van; Park, Hye Yun; Nakano, Yasutaka
2016-04-01
Asthma-chronic obstructive pulmonary disease (COPD) overlap syndrome (ACOS) is characterized by persistent airflow limitation with several features usually associated with asthma and several features usually associated with COPD. ACOS may be a special phenotype of a spectrum of chronic obstructive airway diseases, in which asthma and COPD are at the two opposite ends. The prevalence of ACOS varies considerably due to differing criteria being applied for diagnosis. Patients with ACOS utilize a large proportion of medical resources. They are associated with more frequent adverse outcomes than those with asthma or COPD alone. ACOS is currently a diagnostic challenge for physicians because there are no specific biomarkers to differentiate ACOS from asthma or COPD. The approach to diagnosing ACOS depends on the population from which the patient originated. The management of ACOS should be individualized to ensure the most effective treatment with minimal side effects. In this paper, we review the diagnostic criteria of ACOS used in previous studies, propose practical approaches to diagnosing and managing ACOS and raise some research questions related to ACOS. © 2015 Asian Pacific Society of Respirology.
API 5L X80M OD 34 inches cold bending
Energy Technology Data Exchange (ETDEWEB)
Moreira, Fabio; Chad, Luis; Souza, Marcos [TenarisConfab, Pindamonhangaba, SP (Brazil); Batista, Gilmar; Hippert, Eduardo [Petroleo Brasileiro S.A. (PETROBRAS), Rio de Janeiro, RJ (Brazil)
2009-07-01
One of the main factors that require special attention in a pipeline construction is the cold bending process, once depending on the region that the line will be installed the number of bends may achieve 75%, as it was observed in some areas during Campinas-Rio pipeline construction. A study was carried out to evaluate the X80 cold bending operational parameters in order to make viable the use of high strength pipes in the construction of onshore pipelines. For this analysis three pipes of 34 inches x 0.750 inches had been cold bended, the operation was carried out using a hydraulic equipment with punches applications along the pipe, recording the correspondent angles related to the elastic and plastic deformations in order to assess the material spring-back. After the bending process, samples of the weld, extrados and intrados were subjected to mechanical and metallographic tests, as well as performed dimensional inspection of the pipes. It was possible to obtain a 19 deg curve and 27D radius without presenting any evidence of wrinkles, out of roundness or any type of mechanical damage, according requirements of the project standards and specifications. All criteria established from project specifications were complied, the mechanical tests performed allowed comparing pipe mechanical properties of straight and bended regions. (author)
The Dutch xAPI Experience: xAPI Recipes
Berg, Alan; Scheffel, Maren; Drachsler, Hendrik; Ternier, Stefaan; Specht, Marcus
2017-01-01
We present the collected experiences since 2012 of the Dutch Special Interest Group (SIG) for Learning Analytics in the application of the xAPI standard and best practices around the application of xAPI in various contexts. We present three projects that apply xAPI in very different ways and publish a consistent set of xAPI recipes.
Fitzgerald, Michael
2007-01-01
Use the Google Ajax Search API to integrateweb search, image search, localsearch, and other types of search intoyour web site by embedding a simple, dynamicsearch box to display search resultsin your own web pages using a fewlines of JavaScript. For those who do not want to write code,the search wizards and solutions builtwith the Google Ajax Search API generatecode to accomplish common taskslike adding local search results to a GoogleMaps API mashup, adding videosearch thumbnails to your web site, oradding a news reel with the latest up todate stories to your blog. More advanced users can
National Aeronautics and Space Administration — This API is designed to collect image data gathered by NASA's Curiosity, Opportunity, and Spirit rovers on Mars and make it more easily available to other...
Corporate Consumer Contact API
General Services Administration — The data in the Corporate Consumer Contact API is based on the content you can find in the Corporate Consumer Contact listing in the Consumer Action Handbook (PDF)....
Directory of Open Access Journals (Sweden)
Ben Rubinger
2010-09-01
Full Text Available In recent years, there has been an explosive growth in the popularity of online social networks such as Facebook. In a new twist, third party developers are now able to create their own web applications which plug into Facebook and work with Facebook's "social" data, enabling the entire Facebook user base of more than 400 million active users to use such applications. These client applications can contain subtle errors that can be hard to debug if they misuse the Facebook API. In this paper we present an experience report on applying Microsoft's new code contract system for the .NET framework to the Facebook API.We wrote contracts for several classes in the Facebook API wrapper which allows Microsoft .NET developers to implement Facebook applications. We evaluated the usefulness of these contracts during implementation of a new Facebook application. Our experience indicates that having code contracts provides a better and quicker software development experience.
Mars Atmospheric Aggregation System API
National Aeronautics and Space Administration — The {MAAS} API is an open source REST API built to help make it easier and more efficient to build interactive applications that want to utilize the wealth of...
General Services Administration — The data.gov catalog is powered by CKAN, a powerful open source data platform that includes a robust API. Please be aware that data.gov and the data.gov CKAN API...
Ding, B; Enstone, A
2016-01-01
To understand the key characteristics of Asthma and Chronic Obstructive Pulmonary Disease Overlap Syndrome (ACOS) and to identify evidence gaps relating to the identification, treatment and management of ACOS patients. A structured literature review and 1-hour telephone interviews with specialist respiratory physicians were conducted (n=10; China, France, Germany, Japan and the USA). All 10 physicians used the term ACOS in clinical practice. ACOS was not clearly defined in the literature. Prevalence of ACOS among adult patients with COPD or asthma ranged from 12-55%. ACOS patients had severe disease, with increased exacerbations and hospitalisations compared to some asthma and COPD patients. ACOS represented a clinical challenge due to a lack of evidence-based guidelines distinguishing between asthma, COPD and ACOS. Published data quantifying ACOS costs were limited. There is a need for consensus evidence-based guidance to facilitate earlier diagnosis and to optimise the management of ACOS patients.
ALOHA Cabled Observatory (ACO): Acoustic Doppler Current Profiler (ADCP): Temperature
National Oceanic and Atmospheric Administration, Department of Commerce — The University of Hawaii's ALOHA ("A Long-term Oligotrophic Habitat Assessment") Cabled Observatory (ACO) is located 100 km north of the island of Oahu, Hawaii (22...
ALOHA Cabled Observatory (ACO): Acoustic Doppler Current Profiler (ADCP): Velocity
National Oceanic and Atmospheric Administration, Department of Commerce — The University of Hawaii's ALOHA ("A Long-term Oligotrophic Habitat Assessment") Cabled Observatory (ACO) is located 100 km north of the island of Oahu, Hawaii (22...
AUTOMATED API TESTING APPROACH
SUNIL L. BANGARE; SEEMA BORSE; PALLAVI S. BANGARE; SHITAL NANDEDKAR
2012-01-01
Software testing is an investigation conducted to provide stakeholders with information about the quality of the product or service under test. With the help of software testing we can verify or validate the software product. Normally testing will be done after development of software but we can perform the software testing at the time of development process also. This paper will give you a brief introduction about Automated API Testing Tool. This tool of testing will reduce lots of headache ...
Registro de paro cardíaco en el adulto
Directory of Open Access Journals (Sweden)
Ricardo Navarro Vargas
2005-07-01
Full Text Available En nuestro país no hay un registro estandarizado de los eventos cardíacos que requieren reanimación cerebro-cardio-pulmonar (RCCP siguiendo los lineamientos "Utstein". El propósito de este estudio fue determinar la calidad de los registros extrahospitalarios de paro cardíaco en el adulto, en Bogotá-Colombia. Entre enero y marzo de 2005 se realizó un análisis retrospectivo de los casos que correspondieron a paro cardíaco en el adulto atendidos por el "Centro Regulador de Urgencias del Distrito (CRU". El estudio reveló un registro deficiente de los eventos que requirieron RCCP realizados a nivel prehospitalario, e identificó al trauma como causa de paro cardíaco en 22% de los casos, una cifra particularmente elevada si se compara con los reportes mundiales, que oscilan entre 5% y 8%. Recomienda la estandarización del registro de paro cardíaco en el adulto, para lo cual se sugiere utilizar el formato de registro que sigue los lineamientos "Utstein".
Definition and diagnosis of asthma-COPD overlap (ACO).
Yanagisawa, Satoru; Ichinose, Masakazu
2018-02-09
It is now widely recognized that asthma and COPD can coexist as asthma-COPD overlap (ACO), but the preliminary attempts at providing universal guidelines for the diagnosis of ACO still need to be improved. We believe that a case can be made for devising guidelines for the diagnosis of this increasingly common disease that are specific to Japan. In this paper, we present our consensus-based description of ACO which we believe is realistic for use in our country. In addition, we cite the scientific evidence for our own "objective" features used to develop the criteria for COPD and asthma diagnosis. We acknowledge that they will need to be validated and updated over time, but hope the results will encourage further research on the characteristics and treatment of this commonly encountered clinical problem. Copyright © 2018 Japanese Society of Allergology. Production and hosting by Elsevier B.V. All rights reserved.
Web API Fragility : How Robust is Your Web API Client
Espinha, T.; Zaidman, A.; Gross, H.G.
2014-01-01
Web APIs provide a systematic and extensible approach for application-to-application interaction. A large number of mobile applications makes use of web APIs to integrate services into apps. Each Web API’s evolution pace is determined by their respective developer and mobile application developers
Analysis of mitochondrial DNA alteration in new phenotype ACOS
Carpagnano, G. E.; Lacedonia, D.; Malerba, M; Palmiotti, G. A.; Cotugno, G.; Carone, M.; Foschino-Barbaro, M P
2016-01-01
Background Mitochondria contain their own DNA (MtDNA) that is very sensitive to oxidative stress and as a consequence could be damaged in quantity. Oxidative stress is largely recognized to play a key role in the pathogenesis of asthma and COPD and might have a role in the new intermediate phenotype ACOS (asthma-COPD overlap syndrome). The aim of this study was to investigate MtDNA alterations, as an expression of mitochondrial dysfunction, in ACOS and to verify whether they might help in the...
Directory of Open Access Journals (Sweden)
Jialiang Kou
2013-01-01
Full Text Available Multiobjective evacuation routes optimization problem is defined to find out optimal evacuation routes for a group of evacuees under multiple evacuation objectives. For improving the evacuation efficiency, we abstracted the evacuation zone as a superposed potential field network (SPFN, and we presented SPFN-based ACO algorithm (SPFN-ACO to solve this problem based on the proposed model. In Wuhan Sports Center case, we compared SPFN-ACO algorithm with HMERP-ACO algorithm and traditional ACO algorithm under three evacuation objectives, namely, total evacuation time, total evacuation route length, and cumulative congestion degree. The experimental results show that SPFN-ACO algorithm has a better performance while comparing with HMERP-ACO algorithm and traditional ACO algorithm for solving multi-objective evacuation routes optimization problem.
Towards SLA-Driven API Gateways
Gámez Díaz, Antonio; Fernández Montes, Pablo; Ruiz Cortés, Antonio
2015-01-01
As APIs are becoming popular to build Service-Based Ap- plications (SBA), API Gateways are being increasingly used to facilitate API features management. They o er API management functionalities such as pricing plans support, user authentication, API versioning or response caching. Some parts of the information that an API Gateway needs are already included into a Service Level Agreement (SLA), that providers use to describe the rights and the obligations of involved par- ...
Sinani, Artan
2013-01-01
This is a practical, hands-on guide with illustrative examples, which will help you explore the vast universe of Bing maps.If you are a developer who wants to learn how to exploit the numerous features of Bing Maps then this book is ideal for you. It can also be useful for more experienced developers who wish to explore other areas of the APIs. It is assumed that you have some knowledge of JavaScript, HTML, and CSS. For some chapters a working knowledge of .Net and Visual Studio is also needed.
Validity of EQ-5D-5L in stroke.
Golicki, Dominik; Niewada, Maciej; Buczek, Julia; Karlińska, Anna; Kobayashi, Adam; Janssen, M F; Pickard, A Simon
2015-04-01
To assess EQ-5D-5L (5L) validity in patients with acute stroke, in comparison with EQ-5D-3L (3L). Cross-sectional study of 408 patients during index hospitalization. We compared 5L and 3L in terms of feasibility, frequency of unique health states, ceiling effect and discriminatory power (informativity). We assessed construct validity in terms of known-groups validity and convergent validity of 5L dimensions with other stroke outcome measures. The overall proportion of patients with acute stroke reporting 'no problems' with 3L-6.1 % was further reduced to 5.6 % with 5L (relative reduction of 8.2 %). The highest improvement in relative discriminatory power, when moving from 3L to 5L, was noticed in pain/discomfort and anxiety/depression dimensions (Shannon Evenness Index 0.91 for both 5L dimensions; relative increase 34.4 and 29.1 %, respectively). Known-groups validity tests confirmed prior hypotheses: Health state utilities were lower in following subpopulations-females, patients with high modified Rankin Scale (mRS) score, low Barthel Index (BI) or VAS score, patients with subarachnoid hemorrhage or intracerebral hemorrhage, and when proxy respondent was used. Convergence of EQ-5D-5L dimensions with mRS, BI and EQ VAS was improved or at least the same as for 3L dimensions. Results support the validity of the EQ-5D-5L descriptive system as a generic health outcome measure in patients with acute stroke, demonstrating some psychometric advantages in comparison with EQ-5D-3L.
Cold bending of 34'' OD API 5L X80 pipes; Curvamento a frio de tubos API 5L X80 de 34'' de diametro
Energy Technology Data Exchange (ETDEWEB)
Silva, Ronaldo; Moreira, Fabio A.; Chad, Luis; Fritz, Marcelo C. [TenarisConfab, Pindamonhangaba, SP (Brazil); Batista, Gilmar Z.; Hippert, Eduardo [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil)
2008-07-01
A key factor that demands special attention in the pipeline construction is the cold bending process, since 30 to 40% of the pipes use this process in the field. This study aimed to evaluate the X80 cold bending operational parameters, in order make viable the use of this process in the installation of future onshore pipelines. Three 34''OD x 0,750'' pipes were bended. The bending was conducted using a hydraulic equipment with application of equally spaced punches, recording the correspondent angles related to the elastic and plastic deformations in order to assess the spring-back effect and performing dimensional inspection. Samples from pipe and the weld were subjected to mechanical and metallographic tests. It was possible to obtain a 19 deg curve and 27D radius without presenting any evidence of wrinkles, out of roundness or any type of mechanical damage. After analysis, all criteria established from project specifications were complied, the mechanical tests performed allowed comparing pipe mechanical properties of straight and bended regions. The results of this study provide technical know how for future X80 onshore pipelines applications. (author)
Swaminathan, Rajeswari; Huang, Yungui; Moosavinasab, Soheil; Buckley, Ronald; Bartlett, Christopher W; Lin, Simon M
2016-01-01
The constant improvement and falling prices of whole human genome Next Generation Sequencing (NGS) has resulted in rapid adoption of genomic information at both clinics and research institutions. Considered together, the complexity of genomics data, due to its large volume and diversity along with the need for genomic data sharing, has resulted in the creation of Application Programming Interface (API) for secure, modular, interoperable access to genomic data from different applications, platforms, and even organizations. The Genomics APIs are a set of special protocols that assist software developers in dealing with multiple genomic data sources for building seamless, interoperable applications leading to the advancement of both genomic and clinical research. These APIs help define a standard for retrieval of genomic data from multiple sources as well as to better package genomic information for integration with Electronic Health Records. This review covers three currently available Genomics APIs: a) Google Genomics, b) SMART Genomics, and c) 23andMe. The functionalities, reference implementations (if available) and authentication protocols of each API are reviewed. A comparative analysis of the different features across the three APIs is provided in the Discussion section. Though Genomics APIs are still under active development and have yet to reach widespread adoption, they hold the promise to make building of complicated genomics applications easier with downstream constructive effects on healthcare.
Directory of Open Access Journals (Sweden)
Rajeswari Swaminathan
2016-01-01
Full Text Available The constant improvement and falling prices of whole human genome Next Generation Sequencing (NGS has resulted in rapid adoption of genomic information at both clinics and research institutions. Considered together, the complexity of genomics data, due to its large volume and diversity along with the need for genomic data sharing, has resulted in the creation of Application Programming Interface (API for secure, modular, interoperable access to genomic data from different applications, platforms, and even organizations. The Genomics APIs are a set of special protocols that assist software developers in dealing with multiple genomic data sources for building seamless, interoperable applications leading to the advancement of both genomic and clinical research. These APIs help define a standard for retrieval of genomic data from multiple sources as well as to better package genomic information for integration with Electronic Health Records. This review covers three currently available Genomics APIs: a Google Genomics, b SMART Genomics, and c 23andMe. The functionalities, reference implementations (if available and authentication protocols of each API are reviewed. A comparative analysis of the different features across the three APIs is provided in the Discussion section. Though Genomics APIs are still under active development and have yet to reach widespread adoption, they hold the promise to make building of complicated genomics applications easier with downstream constructive effects on healthcare.
Bluetooth API Implementation into Android
Directory of Open Access Journals (Sweden)
Konev Sergey
2017-01-01
Full Text Available Bluetooth is a popular method of communication between devices. Many smartphones today have the capability to communicate using Bluetooth. Android developers sometimes need to use Bluetooth in their projects. Android OS provides a powerful API for Bluetooth that allows to simplify scanning the environment for devices, pairing and connecting, data transfer between devices and more. However, utilizing the Bluetooth API can be difficult for first-time users. The objective of this article is to demonstrate the key points of implementing Bluetooth API in the Android application.
Directory of Open Access Journals (Sweden)
Amanda Morton
2013-04-01
Full Text Available In this lesson, you’ll learn how to use python with the Zotero API to interact with your Zotero library. The Zotero API is a powerful interface that would allow you to build a complete Zotero client from scratch if you so desired. But like most APIs, it works in small, discrete steps, so we have to build our way up to the complicated requests we might want to use to access our Zotero libraries. But this incremental building gives us plenty of time to learn as we go along.
Barbara WOŚ
2014-01-01
Api-tourism, as a form of tourism that deals with culture and traditions of rural communities could be considered as one of the most sustainable way of development and a niche tourism. Api-tourism is a form of tourism connected with beekeeping as a traditional profession and with bee products in ecological, food and medicinal aspects. The activities related to api-tourism include visits in apiaries, open-air museums and bee museums where tourists have the opportunity to observe a beekeeper...
Social Data APIs: Origin, Types, Issues
Puschmann, Cornelius; Ausserhofer, Julian
2017-01-01
In this chapter, we discuss different aspects of APIs from the perspectives of social scientists who use APIs for data collection. We describe (1) the origin of APIs in software development, (2) conduct a survey of popular Web APIs by type, and (3) discuss issues with regard to the reliability, validity and representativeness of data retrieved from APIs. We close by pointing to future developments in this area.
Joodaki, R.; Alavi Zaree, S. R.; Gheisari, Kh.; Eskandari, M.
2017-05-01
Effect of annealing treatments at 600, 800, 1000 and 1200 °C on the microstructure, texture, grain boundary characteristic and recrystallization fraction of Nb-microalloyed X60 steel is evaluated by using x-ray diffraction and EBSD techniques. The results indicate that bimodal as-received microstructure is changed to a homogeneous equiaxed grain structure above annealing at 1000 °C. Macro-texture investigations depict that increasing annealing temperature results in considerable variation of texture intensity, especially at 1200 °C. Maximum intensity corresponds to {001}, Goss, copper texture components as well as near γ-fiber at 1200 °C. Recrystallization analysis shows that volume fraction of recrystallization noticeably is increased by annealing temperature at 1200 °C. Recrystallized grains are mainly oriented along γ-fiber, especially close to {111} texture component. Moreover, coincidence site lattice (CSL) analysis shows that the effect of annealing temperature on the volume fraction of Σ3 boundary is negligible.
Directory of Open Access Journals (Sweden)
Barbara WOŚ
2014-11-01
Full Text Available Api-tourism, as a form of tourism that deals with culture and traditions of rural communities could be considered as one of the most sustainable way of development and a niche tourism. Api-tourism is a form of tourism connected with beekeeping as a traditional profession and with bee products in ecological, food and medicinal aspects. The activities related to api-tourism include visits in apiaries, open-air museums and bee museums where tourists have the opportunity to observe a beekeeper’s work, a method of making honey, its properties and specifics, to find out about other bee products, to watch how bee colony live, to recognize ecological correlation between a man and bees. The purpose of this article is to show good practice in api-tourism observed in Europe. The study is based on field research conducted in apiaries, bee museums and educational farms in the years 2012-2014.
178. Linfoma cardíaco. Una neoplasia infrecuente
Directory of Open Access Journals (Sweden)
E. Sandoval
2010-01-01
Conclusiones: Los linfomas cardíacos son de alto grado de agresividad. La localización principal es la aurícula derecha, con clínica inespecífica y variable. No existe claro consenso sobre el tratamiento de elección, pero parece haber mayor supervivencia con tratamiento combinado con quimioterapia con antraciclínicos y radioterapia.
Determinants of success in Shared Savings Programs: An analysis of ACO and market characteristics.
Ouayogodé, Mariétou H; Colla, Carrie H; Lewis, Valerie A
2017-03-01
Medicare's Accountable Care Organization (ACO) programs introduced shared savings to traditional Medicare, which allow providers who reduce health care costs for their patients to retain a percentage of the savings they generate. To examine ACO and market factors associated with superior financial performance in Medicare ACO programs. We obtained financial performance data from the Centers for Medicare and Medicaid Services (CMS); we derived market-level characteristics from Medicare claims; and we collected ACO characteristics from the National Survey of ACOs for 215 ACOs. We examined the association between ACO financial performance and ACO provider composition, leadership structure, beneficiary characteristics, risk bearing experience, quality and process improvement capabilities, physician performance management, market competition, CMS-assigned financial benchmark, and ACO contract start date. We examined two outcomes from Medicare ACOs' first performance year: savings per Medicare beneficiary and earning shared savings payments (a dichotomous variable). When modeling the ACO ability to save and earn shared savings payments, we estimated positive regression coefficients for a greater proportion of primary care providers in the ACO, more practicing physicians on the governing board, physician leadership, active engagement in reducing hospital re-admissions, a greater proportion of disabled Medicare beneficiaries assigned to the ACO, financial incentives offered to physicians, a larger financial benchmark, and greater ACO market penetration. No characteristic of organizational structure was significantly associated with both outcomes of savings per beneficiary and likelihood of achieving shared savings. ACO prior experience with risk-bearing contracts was positively correlated with savings and significantly increased the likelihood of receiving shared savings payments. In the first year, performance is quite heterogeneous, yet organizational structure does not
Regional cost and experience, not size or hospital inclusion, helps predict ACO success.
Schulz, John; DeCamp, Matthew; Berkowitz, Scott A
2017-06-01
The Medicare Shared Savings Program (MSSP) continues to expand and now includes 434 accountable care organizations (ACOs) serving more than 7 million beneficiaries. During 2014, 86 of these ACOs earned over $300 million in shared savings payments by promoting higher-quality patient care at a lower cost.Whether organizational characteristics, regional cost of care, or experience in the MSSP are associated with the ability to achieve shared savings remains uncertain.Using financial results from 2013 and 2014, we examined all 339 MSSP ACOs with a 2012, 2013, or 2014 start-date. We used a cross-sectional analysis to examine all ACOs and used a multivariate logistic model to predict probability of achieving shared savings.Experience, as measured by years in the MSSP program, was associated with success and the ability to earn shared savings varied regionally. This variation was strongly associated with differences in regional Medicare fee-for-service per capita costs: ACOs in high cost regions were more likely to earn savings. In the multivariate model, the number of ACO beneficiaries, inclusion of a hospital or involvement of an academic medical center, was not associated with likelihood of earning shared savings, after accounting for regional baseline cost variation.These results suggest ACOs are learning and improving from their experience. Additionally, the results highlight regional differences in ACO success and the strong association with variation in regional per capita costs, which can inform CMS policy to help promote ACO success nationwide.
Colla, Carrie H; Lewis, Valerie A; Shortell, Stephen M; Fisher, Elliott S
2014-06-01
The extent to which physicians lead, own, and govern accountable care organizations (ACOs) is unknown. However, physicians' involvement in ACOs will influence how clinicians and patients perceive the ACO model, how effective these organizations are at improving quality and costs, and how future ACOs will be organized. From October 2012 to May 2013 we fielded the National Survey of Accountable Care Organizations, the first such survey of public and private ACOs. We found that 51 percent of ACOs were physician-led, with another 33 percent jointly led by physicians and hospitals. In 78 percent of ACOs, physicians constituted a majority of the governing board, and physicians owned 40 percent of ACOs. The broad reach of physician leadership has important implications for the future evolution of ACOs. It seems likely that the challenge of fundamentally changing care delivery as the country moves away from fee-for-service payment will not be accomplished without strong, effective leadership from physicians. Project HOPE—The People-to-People Health Foundation, Inc.
USAJOBS Job Opportunity Announcements (JOA) SOAP API
Office of Personnel Management — The purpose of the SOAP based API is to provide the full Federal Job Opportunity Announcement (JOA) content to the consumer. It is anticipated that this API will be...
General Services Administration — The Go.USA.gov REST API allows you interact with Go.USA.gov by shortening URLs, previewing long urls, and getting the number of clicks to a Go.USA.gov URL.. An API...
Automated Ply Inspection (API) for AFP Project
National Aeronautics and Space Administration — The Automated Ply Inspection (API) system autonomously inspects layups created by high speed automated fiber placement (AFP) machines. API comprises a high accuracy...
USAJOBS Job Opportunity Announcements (JOA) REST API
Office of Personnel Management — This REST-based API is designed to support lightweight Federal Job Opportunity Announcement (JOA) content consumption by consumers. It is anticipated that this API...
Restful API Architecture Based on Laravel Framework
Chen, Xianjun; Ji, Zhoupeng; Fan, Yu; Zhan, Yongsong
2017-10-01
Web service has been an industry standard tech for message communication and integration between heterogeneous systems. RESTFUL API has become mainstream web service development paradigm after SOAP, how to effectively construct RESTFUL API remains a research hotspots. This paper presents a development model of RESTFUL API construction based on PHP language and LARAVEL framework. The key technical problems that need to be solved during the construction of RESTFUL API are discussed, and implementation details based on LARAVEL are given.
Energy Technology Data Exchange (ETDEWEB)
Roman, J. H. (Jorge H.)
2001-01-01
As programmers we have worked with many Application Development Interface API development kits. They are well suited for interaction with a particular system. A vast source of information can be made accessible by using the http protocol through the web as an API. This setup has many advantages including the vast knowledge available on setting web servers and services. Also, these tools are available on most hardware and operating system combinations. In this paper I will cover the various types of systems that can be developed this way, their advantages and some drawbacks of this approach. Index Terms--Application Programmer Interface, Distributed applications, Hyper Text Transfer Protocol, Web.
Mechanical Characteristics of Submerged Arc Weldment in API Gas Pipeline Steel of Grade X65
Hashemi, S. H.; Mohammadyani, D.
2011-01-01
The mechanical properties of submerged arc weldment (SAW) in gas transportation pipeline steel of grade API X65 (65 ksi yield strength) were investigated. This steel is produced by thermo mechanical control rolled (TMC), and is largely used in Iran gas piping systems and networks. The results from laboratory study on three different regions; i.e. base metal (BM), fusion zone (FZ) and heat affected zone (HAZ) were used to compare weldment mechanical characteristics with those specified by API 5L (revision 2004) standard code. Different laboratory experiments were conducted on test specimens taken from 48 inch outside diameter and 14.3 mm wall thickness gas pipeline. The test results showed a gradient of microstructure and Vickers hardness data from the centerline of FZ towards the unaffected MB. Similarly, lower Charpy absorbed energy (compared to BM) was observed in the FZ impact specimens. Despite this, the API specifications were fulfilled in three tested zones, ensuring pipeline structural integrity under working conditions.
Dolor mandibular de origen cardíaco
MR Sáez Yuguero; Bermejo Fenoll, A.; JL Calvo Guirado; E. Álvarez Martínez
2003-01-01
En las complejas estructuras anatómicas orofaciales, asientan muchos procesos dolorosos. Las algias orofaciales más comunes tienen su origen a nivel dental, periodontal o en estructuras musculoesqueleticas. Sin embargo, el paciente puede manifestar dolor en esta región, bien en dientes o estructuras musculoesqueleticas, y la fuente originaria localizarse a distancia. A este tipo de dolor se le llama dolor heterotópico. Una posible fuente de dolor heterotópico es el dolor de origen cardíaco. E...
Directory of Open Access Journals (Sweden)
Eduardo Salazar Hornig
2009-08-01
Full Text Available ACO es una metaheurística inspirada en el comportamiento de las colonias de hormigas para solucionar problemas de optimización combinatoria, por medio de la utilización de agentes computacionales simples que trabajan de manera cooperativa y se comunican mediante rastros de feromona artificiales. En este trabajo se presenta un modelo para resolver el Problema de Recolección de Residuos Domiciliarios por Contenedores, el que aplica un concepto de secuencias parciales de recolección que deben ser unidas para minimizar la distancia total de recolección. El problema de unir las secuencias parciales se representa como un TSP, el que es resuelto mediante un algoritmo ACO. En base a recomendaciones de la literatura, se calibran experimentalmente los parámetros del algoritmo y se recomiendan rangos de valores que representan buenos rendimientos promedio. El modelo se aplica a un sector de recolección de la comuna de San Pedro de la Paz, Chile, obteniéndose rutas de recolección que reducen la distancia total recorrida respecto de la actual ruta utilizada y de la solución obtenida con otro modelo desarrollado previamente.ACO is a metaheuristic inspired in the behavior of natural ant colonies to solve combinatorial optimization problems, based on simple agents that work cooperatively communicating by artificial pheromone trails. In this paper a model to solve the municipal waste collection problem by containers is presented, which applies a concept of partial collection sequences that must be joined to minimize the total collection distance. The problem to join the partial collection sequences is represented as a TSP, which is solved by an ACO algorithm. Based on the literature, algorithm parameters are experimentally calibrated and range of variations that represents good average solutions are recommended. The model is applied to a waste collection sector of the San Pedro de la Paz commune in Chile, obtaining recollection routes with less total
ENHANCED HYBRID PSO – ACO ALGORITHM FOR GRID SCHEDULING
Directory of Open Access Journals (Sweden)
P. Mathiyalagan
2010-07-01
Full Text Available Grid computing is a high performance computing environment to solve larger scale computational demands. Grid computing contains resource management, task scheduling, security problems, information management and so on. Task scheduling is a fundamental issue in achieving high performance in grid computing systems. A computational GRID is typically heterogeneous in the sense that it combines clusters of varying sizes, and different clusters typically contains processing elements with different level of performance. In this, heuristic approaches based on particle swarm optimization and ant colony optimization algorithms are adopted for solving task scheduling problems in grid environment. Particle Swarm Optimization (PSO is one of the latest evolutionary optimization techniques by nature. It has the better ability of global searching and has been successfully applied to many areas such as, neural network training etc. Due to the linear decreasing of inertia weight in PSO the convergence rate becomes faster, which leads to the minimal makespan time when used for scheduling. To make the convergence rate faster, the PSO algorithm is improved by modifying the inertia parameter, such that it produces better performance and gives an optimized result. The ACO algorithm is improved by modifying the pheromone updating rule. ACO algorithm is hybridized with PSO algorithm for efficient result and better convergence in PSO algorithm.
Comorbidome, pattern and impact of asthma-COPD overlap syndrome (ACOS) in real-life
van Boven, Job F. M.; Roman-Rodriguez, Miguel; Palmer, Josep F.; Toledo-Pons, Nuria; Cosio, Borja G.; Soriano, Joan B.
BACKGROUND: Asthma-COPD overlap syndrome (ACOS) has been described and acknowledged as a distinct clinical entity; however, its characteristics in daily clinical practice are largely unknown. The aim of this study was to identify the prevalence of ACOS in the real-life population, its pattern of
Substantial Physician Turnover And Beneficiary 'Churn' In A Large Medicare Pioneer ACO.
Hsu, John; Vogeli, Christine; Price, Mary; Brand, Richard; Chernew, Michael E; Mohta, Namita; Chaguturu, Sreekanth K; Weil, Eric; Ferris, Timothy G
2017-04-01
Alternative payment models, such as accountable care organizations (ACOs), attempt to stimulate improvements in care delivery by better alignment of payer and provider incentives. However, limited attention has been paid to the physicians who actually deliver the care. In a large Medicare Pioneer ACO, we found that the number of beneficiaries per physician was low (median of seventy beneficiaries per physician, or less than 5 percent of a typical panel). We also found substantial physician turnover: More than half of physicians either joined (41 percent) or left (18 percent) the ACO during the 2012-14 contract period studied. When physicians left the ACO, most of their attributed beneficiaries also left the ACO. Conversely, about half of the growth in the beneficiary population was because of new physicians affiliating with the ACO; the remainder joined after switching physicians. These findings may help explain the muted financial impact ACOs have had overall, and they raise the possibility of future gaming on the part of ACOs to artificially control spending. Policy refinements include coordinated and standardized risk-sharing parameters across payers to prevent any dilution of the payment incentives or confusion from a cacophony of incentives across payers. Project HOPE—The People-to-People Health Foundation, Inc.
Report on the 10th International Conference of the Asian Clinical Oncology Society (ACOS 2012).
Kim, Yeul Hong; Yang, Han-Kwang; Kim, Tae Won; Lee, Jung Shin; Seong, Jinsil; Lee, Woo Yong; Ahn, Yong Chan; Lim, Ho Yeong; Won, Jong-Ho; Park, Kyong Hwa; Cho, Kyung Sam
2013-04-01
The 10th International Conference of the Asian Clinical Oncology Society (ACOS 2012) in conjunction with the 38th Annual Meeting of the Korean Cancer Association, was held on June 13 to 15 (3 days) 2012 at COEX Convention and Exhibition Center in Seoul, Korea. ACOS has a 20-year history starting from the first conference in Osaka, Japan, which was chaired by Prof. Tetsuo Taguchi and the ACOS conferences have since been conducted in Asian countries every 2 years. Under the theme of "Work Together to Make a Difference for Cancer Therapy in Asia", the 10th ACOS was prepared to discuss various subjects through a high-quality academic program, exhibition, and social events. The ACOS 2012 Committee was composed of the ACOS Organizing Committee, Honorary Advisors, Local Advisors, and ACOS 2012 Organizing Committee. The comprehensive academic program had a total of 92 sessions (3 Plenary Lectures, 1 Award Lectures, 1 Memorial Lectures, 9 Special Lectures, 15 Symposia, 1 Debate & Summary Sessions, 1 Case Conferences, 19 Educational Lectures, 1 Research & Development Session, 18 Satellite Symposia, 9 Meet the Professors, 14 Oral Presentations) and a total 292 presentations were delivered throughout the entire program. Amongst Free Papers, 462 research papers (110 oral presentations and 352 poster presentations) were selected to be presented. This conference was the largest of all ACOS conferences in its scale with around 1,500 participants from 30 countries. Furthermore, despite strict new financial policies and requirements governing fundraising alongside global economic stagnation, a total of 14 companies participated as sponsors and an additional 35 companies purchased 76 exhibition booths. Lastly, the conference social events provided attendees with a variety of opportunities to experience and enjoy Korea's rich culture and traditions during the Opening Ceremony, Welcome Reception, Invitee Dinner, Banquet, and Closing Ceremony. Overall, ACOS 2012 reinforced and promoted
National Aeronautics and Space Administration — The ACOS Lite files contain bias-corrected XCO2 along with other select fields aggregated as daily files. Orbital granules of the ACOS Level 2 standard product...
Swaminathan, Rajeswari; Huang, Yungui; Moosavinasab, Soheil; Buckley, Ronald; Bartlett, Christopher W.; Lin, Simon M.
2015-01-01
The constant improvement and falling prices of whole human genome Next Generation Sequencing (NGS) has resulted in rapid adoption of genomic information at both clinics and research institutions. Considered together, the complexity of genomics data, due to its large volume and diversity along with the need for genomic data sharing, has resulted in the creation of Application Programming Interface (API) for secure, modular, interoperable access to genomic data from different applications, plat...
ACO-Based Sweep Coverage Scheme in Wireless Sensor Networks
Directory of Open Access Journals (Sweden)
Peng Huang
2015-01-01
Full Text Available Coverage problem is one of the major issues in wireless sensor networks (WSN. In order to optimize the network coverage, different coverage formulations have been proposed. Recently, a newly emerging coverage scheme in wireless sensor networks, sweep coverage, which uses mobile sensors to monitor certain points of interest (POIs, is proposed. However, the data delivery to sink, an important problem in WSN, is not considered in original sweep coverage and many of the existing works did not consider it yet. In this work, a novel algorithm named ACOSC (ACO-based sweep coverage to solve the sweep coverage problem considering periodical coverage of POIs and delivery of data simultaneously is proposed. The evaluation results show that our algorithm has better performance than existing schemes.
Layered ACO-OFDM for intensity-modulated direct-detection optical wireless transmission.
Wang, Qi; Qian, Chen; Guo, Xuhan; Wang, Zhaocheng; Cunningham, David G; White, Ian H
2015-05-04
Layered asymmetrically clipped optical orthogonal frequency division multiplexing (ACO-OFDM) with high spectral efficiency is proposed in this paper for optical wireless transmission employing intensity modulation with direct detection. In contrast to the conventional ACO-OFDM, which only utilizes odd subcarriers for modulation, leading to an obvious spectral efficiency loss, in layered ACO-OFDM, the subcarriers are divided into different layers and modulated by different kinds of ACO-OFDM, which are combined for simultaneous transmission. In this way, more subcarriers are used for data transmission and the spectral efficiency is improved. An iterative receiver is also proposed for layered ACO-OFDM, where the negative clipping distortion of each layer is subtracted once it is detected so that the signals from different layers can be recovered. Theoretical analysis shows that the proposed scheme can improve the spectral efficiency by up to 2 times compared with conventional ACO-OFDM approaches with the same modulation order. Meanwhile, simulation results confirm a considerable signal-to-noise ratio gain over ACO-OFDM at the same spectral efficiency.
MOEA/D-ACO: a multiobjective evolutionary algorithm using decomposition and AntColony.
Ke, Liangjun; Zhang, Qingfu; Battiti, Roberto
2013-12-01
Combining ant colony optimization (ACO) and the multiobjective evolutionary algorithm (EA) based on decomposition (MOEA/D), this paper proposes a multiobjective EA, i.e., MOEA/D-ACO. Following other MOEA/D-like algorithms, MOEA/D-ACO decomposes a multiobjective optimization problem into a number of single-objective optimization problems. Each ant (i.e., agent) is responsible for solving one subproblem. All the ants are divided into a few groups, and each ant has several neighboring ants. An ant group maintains a pheromone matrix, and an individual ant has a heuristic information matrix. During the search, each ant also records the best solution found so far for its subproblem. To construct a new solution, an ant combines information from its group's pheromone matrix, its own heuristic information matrix, and its current solution. An ant checks the new solutions constructed by itself and its neighbors, and updates its current solution if it has found a better one in terms of its own objective. Extensive experiments have been conducted in this paper to study and compare MOEA/D-ACO with other algorithms on two sets of test problems. On the multiobjective 0-1 knapsack problem,MOEA/D-ACO outperforms the MOEA/D with conventional genetic operators and local search on all the nine test instances. We also demonstrate that the heuristic information matrices in MOEA/D-ACO are crucial to the good performance of MOEA/D-ACO for the knapsack problem. On the biobjective traveling salesman problem, MOEA/D-ACO performs much better than the BicriterionAnt on all the 12 test instances. We also evaluate the effects of grouping, neighborhood, and the location information of current solutions on the performance of MOEA/D-ACO. The work in this paper shows that reactive search optimization scheme, i.e., the "learning while optimizing" principle, is effective in improving multiobjective optimization algorithms.
Building API manufacturing in South Africa
CSIR Research Space (South Africa)
Loots, Glaudina
2017-10-01
Full Text Available advantage • Waste elimination, recycling, re-use • Contract research and process development • Engineering and commercial focused Current academic program (Universities) • Basic synthetic chemistry • Drug discovery • Drug delivery • Therapeutic.... • Lack of national API focus – needs to demonstrate capability in either producing new/modern APIs cost competitively or achieves radical innovation in existing high demand APIs – silo approach by researchers (own publications, patents or pet...
Trauma penetrante cardíaco en la unidad de emergencia del Hospital Carlos Van Buren
GÓMEZ C,GONZALO; Hola B,José
2009-01-01
El trauma penetrante cardíaco representa una de las mayores causas de muerte por motivo de violencia urbana y se clasifica en penetrante o contuso. La causa más común de trauma cardíaco penetrante es la herida por arma blanca o de fuego. La principal causa de trauma penetrante cardíaco en nuestra serie fue la lesión por arma blanca, siendo el ventrículo derecho la principal cámara cardíaca afectada. Los resultados quirúrgicos son comparables con otras series, con una mortalidad del 16,6% y un...
Karampitsakos, Theodoros; Gourgoulianis, Konstantinos I
2016-06-01
Asthma and chronic obstructive pulmonary disease (COPD) represent two major public health problems. However, there is a significant proportion of patients with a mixed asthma-COPD phenotype. This condition is defined as asthma-COPD overlap syndrome (ACOS). Since there are no internationally accepted criteria for the diagnosis of that syndrome, its management remains difficult. Given the fact that patients with ACOS have an increased risk of exacerbation and hospitalization, there is a pressing need for a more targeted approach and better management. We propose that fractional exhaled nitric oxide (FeNO), a marker of eosinophilic inflammation, could help clinicians differentiate ACOS from asthma and COPD. We evaluate this hypothesis, using data derived from the existing literature. Copyright © 2016 Elsevier Ltd. All rights reserved.
An R2RML Mapping Management API in Java : Making an API Independent of its Dependencies
Strandhaug, Marius
2014-01-01
When developing an Application Programming Interface (API), there is often a need to use other libraries to implement some of the functionality. However, using an external library will make the API dependent on it. There may be several libraries that implement the needed functionality. A problem arises if the user needs to use a different library than what the API supports. The user should be able to choose which underlying library the API will use. To achieve this, the API will have to be ma...
Tumores cardíacos malignos Malignant cardiac tumours
Directory of Open Access Journals (Sweden)
Paulo Ruiz Lucio de Lima
2004-03-01
Full Text Available Os tumores do sistema cardiovascular são afecções raras. Manifestam-se por sinais e sintomas inespecíficos, na maioria das vezes. O tratamento de alterações de ritmo cardíaco, das doenças que acarretam disfunção no sistema de condução Hiss-Purkinje e das síndromes que podem acometer o coração (isquêmica, particularmente devem levar em consideração a possibilidade de neoplasias cardíacas. Os tumores do músculo cardíaco são os rabdomiossarcomas, que se desenvolvem com maior freqüência nas cavidades cardíacas esquerdas, principalmente no ventrículo esquerdo. Dentre os tumores endovasculares, o mais freqüente é o mixoma de átrio esquerdo e suas possíveis variantes. Os tumores metastáticos do coração, entre eles o melanoma maligno, são descritos com maior freqüência acometendo o ventrículo direito (parede anterior e septal, com invasão do ventrículo esquerdo, nas formas de doença não disseminada. O diagnóstico tardio implica em altas taxas de morbidade e mortalidade, associada ou não ao tratamento cirúrgico. Os autores descrevem caso de paciente com melanoma localizado no ventrículo direito, a abordagem diagnóstica e terapêutica realizada, comparando-as com os dados da literatura. A revisão da literatura é inconclusiva quanto ao tratamento de escolha dos tumores malignos do músculo cardíaco (primários ou metastáticos. Os autores sugerem a realização de estudos retrospectivos com metanálise na tentativa de estabelecer critérios diagnósticos e terapêuticos para os tumores malignos do coração, devido à pequena incidência desta doença.Neoplasms of the cardiovascular system are rare pathologies associated with non-specific signs and symptoms. Cardiac neoplasms should be considered when treating cardiac arrhythmia, Hiss-Purkinje conduction system dysfunction and ischemic syndromes. Tumors of the cardiac muscle are rhabdomyosarcomas that develop frequently in the left chambers, mainly the left
Presenting Provenance Based on User Roles - Experiences from the ACOS System
West, P.; Michaelis, J.; Fox, P. A.; Zednik, S.; McGuinness, D. L.
2010-12-01
One goal of provenance is to provide users an understanding of the steps a system took to generate data products. Here, the level of detail captured by provenance becomes an important consideration. As detail is added, more questions can be hypothetically addressed. However, presenting significant provenance detail may also overwhelm end users, for one of two reasons: (i) the detail presented is irrelevant to the objectives, or (ii) the detail requires background knowledge a user lacks. Both of these challenges are present for data generated by the Mauna Loa Solar Observatory’s (MLSO) Advanced Coronal Observing System (ACOS). In ACOS, photometer-based readings are taken of solar activity and subsequently processed into data products consumable by end users. To fully understand these sequences of steps, background knowledge corresponding to various areas (e.g., astronomy, digital imaging, and ACOS specific techniques) is required by end users. This makes reviewing provenance difficult for users outside the ACOS development team, where varying degrees of background may be expected (ranging from outside domain experts in Solar Physics to citizen scientists). Likewise, even when steps taken by ACOS are understandable, they may provide undesired detail to an end user if presented. The work with ACOS involved the development of a Semantic Web based framework to selectively present provenance detail for data products in ACOS. Here, provenance is captured according to two sets of ontologies, the Proof Markup Language, which is an ontology based domain-independent provenance model, and a step ontology, designed to capture hierarchies of provenance steps. Used in combination, these ontology sets enable the creation of multiple levels of provenance, ranging from coarse to fine grained detail. In this setting, users may choose to expand/collapse provenance steps to view desired details. However, the specific provenance details a user initially sees is defined through
Validation of the Parlay API through prototyping
Hellenthal, J.W.; Planken, F.J.M.; Wegdam, M.
2001-01-01
The desire within the telecommunications world for new and faster business growth has been a major drive towards the development of open network API. Over the past 7 years several (semi) standardization groups have announced work on network API, including TINA-C, JAIN, IEEE P1520, INforum, 3GPP,
Statistical analysis for validating ACO-KNN algorithm as feature selection in sentiment analysis
Ahmad, Siti Rohaidah; Yusop, Nurhafizah Moziyana Mohd; Bakar, Azuraliza Abu; Yaakub, Mohd Ridzwan
2017-10-01
This research paper aims to propose a hybrid of ant colony optimization (ACO) and k-nearest neighbor (KNN) algorithms as feature selections for selecting and choosing relevant features from customer review datasets. Information gain (IG), genetic algorithm (GA), and rough set attribute reduction (RSAR) were used as baseline algorithms in a performance comparison with the proposed algorithm. This paper will also discuss the significance test, which was used to evaluate the performance differences between the ACO-KNN, IG-GA, and IG-RSAR algorithms. This study evaluated the performance of the ACO-KNN algorithm using precision, recall, and F-score, which were validated using the parametric statistical significance tests. The evaluation process has statistically proven that this ACO-KNN algorithm has been significantly improved compared to the baseline algorithms. The evaluation process has statistically proven that this ACO-KNN algorithm has been significantly improved compared to the baseline algorithms. In addition, the experimental results have proven that the ACO-KNN can be used as a feature selection technique in sentiment analysis to obtain quality, optimal feature subset that can represent the actual data in customer review data.
Mining usage patterns for the Android API
Directory of Open Access Journals (Sweden)
Hudson S. Borges
2015-07-01
Full Text Available API methods are not used alone, but in groups and following patterns. However, despite being a key information for API users, most usage patterns are not described in official API documents. In this article, we report a study that evaluates the feasibility of automatically enriching API documents with information on usage patterns. For this purpose, we mine and analyze 1,952 usage patterns, from a set of 396 Android applications. As part of our findings, we report that the Android API has many undocumented and non-trivial usage patterns, which can be inferred using association rule mining algorithms. We also describe a field study where a version of the original Android documentation is instrumented with the extracted usage patterns. During 17 months, this documentation received 77,863 visits from professional Android developers.
Sekeli, Rogayah; Abdullah, Janna Ong; Namasivayam, Parameswari; Muda, Pauziah; Abu Bakar, Umi Kalsom; Yeong, Wee Chien; Pillai, Vilasini
2014-06-19
The purpose of this study was to evaluate the effectiveness of using RNA interference in down regulating the expression of 1-aminocyclopropane-1-carboxylic acid oxidase gene in Eksotika papaya. One-month old embryogenic calli were separately transformed with Agrobacterium strain LBA 4404 harbouring the three different RNAi pOpOff2 constructs bearing the 1-aminocyclopropane-1-carboxylic acid oxidase gene. A total of 176 putative transformed lines were produced from 15,000 calli transformed, selected, then regenerated on medium supplemented with kanamycin. Integration and expression of the targeted gene in putatively transformed lines were verified by PCR and real-time RT-PCR. Confined field evaluation of a total of 31 putative transgenic lines planted showed a knockdown expression of the targeted ACO1 and ACO2 genes in 13 lines, which required more than 8 days to achieve the full yellow colour (Index 6). Fruits harvested from lines pRNAiACO2 L2-9 and pRNAiACO1 L2 exhibited about 20 and 14 days extended post-harvest shelf life to reach Index 6, respectively. The total soluble solids contents of the fruits ranged from 11 to 14° Brix, a range similar to fruits from non-transformed, wild type seed-derived plants.
Directory of Open Access Journals (Sweden)
Rogayah Sekeli
2014-06-01
Full Text Available The purpose of this study was to evaluate the effectiveness of using RNA interference in down regulating the expression of 1-aminocyclopropane-1-carboxylic acid oxidase gene in Eksotika papaya. One-month old embryogenic calli were separately transformed with Agrobacterium strain LBA 4404 harbouring the three different RNAi pOpOff2 constructs bearing the 1-aminocyclopropane-1-carboxylic acid oxidase gene. A total of 176 putative transformed lines were produced from 15,000 calli transformed, selected, then regenerated on medium supplemented with kanamycin. Integration and expression of the targeted gene in putatively transformed lines were verified by PCR and real-time RT-PCR. Confined field evaluation of a total of 31 putative transgenic lines planted showed a knockdown expression of the targeted ACO1 and ACO2 genes in 13 lines, which required more than 8 days to achieve the full yellow colour (Index 6. Fruits harvested from lines pRNAiACO2 L2-9 and pRNAiACO1 L2 exhibited about 20 and 14 days extended post-harvest shelf life to reach Index 6, respectively. The total soluble solids contents of the fruits ranged from 11 to 14° Brix, a range similar to fruits from non-transformed, wild type seed-derived plants.
Rundall, Thomas G.; Wu, Frances M.; Lewis, Valerie A.; Schoenherr, Karen E.; Shortell, Stephen M.
2017-01-01
Background The accountable care organization (ACO) is a new type of health care organization incentivized to improve quality of care, improve population health, and reduce the total cost of care. An ACO’s success in meeting these objectives will depend greatly upon its ability to improve patient care management. Numerous studies have found relational coordination to be positively associated with key measures of organizational performance in health care organizations, including quality and efficiency. Purpose The purpose of this paper is twofold: (1) identify the extent to which ACO leaders are aware of the dimensions of relational coordination, and (2) identify the ways these leaders believe the dimensions influenced care management practices in their organization. Methodology/Approach We performed content analysis of interviews with managerial and clinical leaders from a diverse group of 11 ACOs to assess awareness of relational coordination and identify the ways that dimensions of relational coordination were perceived to influence development of care management practices. Findings ACO leaders mentioned four relational coordination dimensions: shared goals, frequency of communication, timeliness of communication, and problem solving communication. Three dimensions – shared knowledge of team members’ tasks, mutual respect, and accuracy of communication – were not mentioned. Our analysis identified numerous ways leaders believed the four mentioned dimensions contributed to the development of care management, including contributions to standardization of care, patient engagement, coordination of care, and care planning. Discussion We propose two hypotheses for future research on relational coordination and care management. Practice Implications If relational coordination is to have a beneficial influence on ACO performance, organizational leaders must become more aware of relational coordination and its various dimensions and become cognizant of relational
Asthma-COPD overlap syndrome (ACOS) vs 'pure' COPD: a distinct phenotype?
Caillaud, D; Chanez, P; Escamilla, R; Burgel, P-R; Court-Fortune, I; Nesme-Meyer, P; Deslee, G; Perez, T; Paillasseur, J-L; Pinet, C; Jebrak, G; Roche, N
2017-01-01
Some studies suggest that asthma-COPD overlap syndrome (ACOS) is associated with worse outcomes than chronic obstructive pulmonary disease (COPD). The goal of this study was to further explore the clinical characteristics and survival of patients with ACOS identified in a real-life cohort of patients with COPD. Data from the French COPD cohort 'INITIATIVES BronchoPneumopathie Chronique Obstructive' (n = 998 patients) were analyzed to assess the frequency of ACOS defined as a physician diagnosis of asthma before the age of 40 years and to analyze its impact. Univariate analyses were performed to assess the relationship between ACOS and sociodemographic characteristics, risk factors (smoking, occupational exposure, atopic diseases), symptoms (chronic bronchitis, dyspnea-modified Medical Research Council scale and baseline dyspnea index), quality of life (QoL), mood disorders, exacerbations, comorbidities, lung function, prescribed treatment, and survival. ACOS was diagnosed in 129 patients (13%). In multivariate analyses, ACOS was associated negatively with cumulative smoking (odds ratio [OR]: 0.992; 95% CI 0.984-1.000 per pack-year) and positively with obesity: OR: 1.97 [1.22-3.16], history of atopic disease (hay fever: OR: 5.50 [3.42-9.00] and atopic dermatitis: OR 3.76 [2.14-6.61]), and drug use (LABA + ICS: 1.86 [1.27-2.74], antileukotrienes 4.83 [1.63-14.34], theophylline: 2.46 [1.23-4.91], and oral corticosteroids: [2.99;.1.26-7.08]). No independent association was found with dyspnea, QoL, exacerbations, and mortality. Compared to 'pure' COPD patients, patients with ACOS exhibit lower cumulative smoking, suffer more from obesity and atopic diseases, and use more asthma treatments. Disease severity (dyspnea, QoL, exacerbations, comorbidities) and prognosis (mortality) are not different from 'pure' COPD patients. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Web API Growing Pains : Loosely Coupled yet Strongly Tied
Espinha, T.; Zaidman, A.; Gross, H.G.
2014-01-01
Web APIs provide a systematic and extensible approach for application-toapplication interaction. Developers using web APIs are forced to accompany the API providers in their software evolution tasks. In order to understand the distress caused by this imposition on web API client developers we
Internet SCADA Utilizing API's as Data Source
Robles, Rosslin John; Kim, Haeng-Kon; Kim, Tai-Hoon
An Application programming interface or API is an interface implemented by a software program that enables it to interact with other software. Many companies provide free API services which can be utilized in Control Systems. SCADA is an example of a control system and it is a system that collects data from various sensors at a factory, plant or in other remote locations and then sends this data to a central computer which then manages and controls the data. In this paper, we designed a scheme for Weather Condition in Internet SCADA Environment utilizing data from external API services. The scheme was designed to double check the weather information in SCADA.
DySectAPI: Scalable Prescriptive Debugging
DEFF Research Database (Denmark)
Jensen, Nicklas Bo; Karlsson, Sven; Quarfot Nielsen, Niklas
We present the DySectAPI, a tool that allow users to construct probe trees for automatic, event-driven debugging at scale. The traditional, interactive debugging model, whereby users manually step through and inspect their application, does not scale well even for current supercomputers. While...... lightweight debugging models scale well, they can currently only debug a subset of bug classes. DySectAPI fills the gap between these two approaches with a novel user-guided approach. Using both experimental results and analytical modeling we show how DySectAPI scales and can run with a low overhead...
U.S. Department of Health & Human Services — The ChemSpell Web Service API provides chemical name spell checking and chemical name synonym look-up. ChemSpell contains more than 1.3 million chemical names...
Online maps with APIs and webservices
Peterson, Michael P
2014-01-01
With the Internet now the primary method of accessing maps, this volume examines developments in the world of online map delivery, focusing in particular on application programmer interfaces such as the Google Maps API, and their utility in thematic mapping.
Real World Uses For Nagios APIs
Singh, Janice
2014-01-01
This presentation describes the Nagios 4 APIs and how the NASA Advanced Supercomputing at Ames Research Center is employing them to upgrade its graphical status display (the HUD) and explain why it's worth trying to use them yourselves.
System for Award Management (SAM) API
General Services Administration — The SAM API is a RESTful method of retrieving public information about the businesses, organizations, or individuals (referred to as entities) within the SAM entity...
BARABÁŠ, Vít
2013-01-01
The work (the bachelor´s thesis) deals with a new way of web application management via the "drag and drop" technique in the HTML5 programming language. The work is divided into two parts. The first part consists of DND API description in HTML5. The support analysis within common web browsers is included as a part of this description. The second, practical part of the thesis focuses on a concept and the following realisation of a photogallery using DND API.
CDC5L Promotes hTERT Expression and Colorectal Tumor Growth
Directory of Open Access Journals (Sweden)
Jia Li
2017-05-01
Full Text Available Background/Aims: Colorectal cancer (CRC is the third leading cause of cancer-related death worldwide because the survival rate remains low. Cell division cycle 5-like (CDC5L is highly expressed in some cancer cells, but the mechanism requires clarification. Human telomerase reverse transcriptase (hTERT plays important roles in CRC. Methods: This study aimed to identify a link between CDC5L and hTERT and to determine their effects on the signaling pathways, migration and prognosis of CRC cells. We first treated LoVo cells with biotin-labeled hTERT and identified CDC5L. Then, pulldown and ChIP assays were used to verify whether CDC5L was a promoter of hTERT. The roles of CDC5L and hTERT in cell growth and migration were studied using siRNA in vivo and in vitro. 130 human CRC specimens were analyzed using immunohistochemistry. Western blot and wound scratch analyses were used to determine the signaling pathway for CDC5L-mediated activation of CRC growth and migration. Results: We identified CDC5L as a new hTERT promoter-binding protein. Clinically, CDC5L and hTERT expression levels were key factors in the prognosis of CRC patients. CDC5L knockdown inhibited tumor growth by down-regulating hTERT expression, and CDC5L was shown to be a transcriptional activator of hTERT in a luciferase reporter assay. Conclusion: Altogether, the above results demonstrated that CDC5L was positively correlated with hTERT as a key promoter of CRC cells. To some extent, our findings suggest that CDC5L may serve as a novel therapeutic target for human colorectal cancer.
van Boven, Job FM; Roman-Rodriguez, Miguel; Palmer, José F; Toledo Pons, Nuria; Cosío, Borja G; Soriano, Joan B.
2015-01-01
Introduction: Comorbidities are known to be frequent in COPD patients. However, less is known about the prevalence of comorbidities in patients with the asthma-COPD overlap syndrome (ACOS). Aims: To estimate the prevalence of comorbidities in patients with ACOS in comparison with patients with COPD.
Michel, Y; McIntyre, M; Ginglinger, H; Ollert, M; Cifuentes, L; Blank, S; Spillner, E
2012-01-01
Immunoglobulin (Ig) E-mediated reactions to honeybee venom can cause severe anaphylaxis, sometimes with fatal consequences. Detailed knowledge of the allergic potential of all venom components is necessary to ensure proper diagnosis and treatment of allergy and to gain a better understanding of the allergological mechanisms of insect venoms. Our objective was to undertake an immunochemical and structural evaluation of the putative low-molecular-weight serine protease inhibitor Api m 6, a component of honeybee venom. We recombinantly produced Api m 6 as a soluble protein in Escherichia coli and in Spodoptera frugiperda (Sf9) insect cells.We also assessed specific IgE reactivity of venom-sensitized patients with 2 prokaryotically produced Api m 6 variants using enzyme-linked immunosorbent assay. Moreover, we built a structural model ofApi m 6 and compared it with other protease inhibitor structures to gain insights into the function of Api m 6. In a population of 31 honeybee venom-allergic patients, 26% showed specific IgE reactivity with prokaryotically produced Api m 6, showing it to be a minor but relevant allergen. Molecular modeling of Api m 6 revealed a typical fold of canonical protease inhibitors, supporting the putative function of this venom allergen. Although Api m 6 has a highly variant surface charge, its epitope distribution appears to be similar to that of related proteins. Api m 6 is a honeybee venom component with IgE-sensitizing potential in a fraction of venom-allergic patients. Recombinant Api m 6 can help elucidate individual component-resolved reactivity profiles and increase our understanding of immune responses to low-molecular-weight allergens
The Application Programming Interface (API) for Uncertainty Analysis, Sensitivity Analysis, and Parameter Estimation (UA/SA/PE API) tool development, here fore referred to as the Calibration, Optimization, and Sensitivity and Uncertainty Algorithms API (COSU-API), was initially d...
Advanced API security securing APIs with OAuth 2.0, OpenID Connect, JWS, and JWE
Siriwardena, Prabath
2014-01-01
Advanced API Security is a complete reference to the next wave of challenges in enterprise security--securing public and private APIs. API adoption in both consumer and enterprises has gone beyond predictions. It has become the 'coolest' way of exposing business functionalities to the outside world. Both your public and private APIs, need to be protected, monitored and managed. Security is not an afterthought, but API security has evolved a lot in last five years. The growth of standards, out there, has been exponential. That's where AdvancedAPI Security comes in--to wade through the weeds
Relationship of C5L2 receptor to skeletal muscle substrate utilization.
Directory of Open Access Journals (Sweden)
Christian Roy
Full Text Available OBJECTIVE: To investigate the role of Acylation Stimulating Protein (ASP receptor C5L2 in skeletal muscle fatty acid accumulation and metabolism as well as insulin sensitivity in both mice and human models of diet-induced insulin resistance. DESIGN AND METHODS: Male wildtype (WT and C5L2 knockout (KO mice were fed a low (LFD or a high (HFD fat diet for 10 weeks. Intramyocellular lipid (IMCL accumulation (by oil red O staining and beta-oxidation HADH enzyme activity were determined in skeletal muscle. Mitochondria were isolated from hindleg muscles for high-resolution respirometry. Muscle C5L2 protein content was also determined in obese type 2 diabetics and age- and BMI matched men. RESULTS: IMCL levels were increased by six-fold in C5L2KO-HFD compared to WT-HFD mice (p<0.05 and plasma insulin levels were markedly increased in C5L2KO-HFD mice (twofold, p<0.05. Muscle HADH activity was elevated in C5L2KO-LFD mice (+75%, p<0.001 vs. WT-LFD and C5L2KO-HFD displayed increased mitochondrial fatty acid oxidative capacity compared to WT-HFD mice (+23%, p<0.05. In human subjects, C5L2 protein content was reduced (-48%, p<0.01 in type 2 diabetic patients when compared to obese controls. Further, exercise training increased C5L2 (+45%, p = 0.0019 and ASP (+80%, p<0.001 in obese insulin-resistant men. CONCLUSION: The results suggest that insulin sensitivity may be permissive for coupling of C5L2 levels to lipid storage and utilization.
Trasplante cardíaco pediátrico: pasado, presente y futuro
Directory of Open Access Journals (Sweden)
María-Teresa González-López
2017-01-01
Conclusión: El trasplante cardíaco pediátrico presenta óptimos resultados en nuestro medio, superponibles a series mundiales. Aunque el perfil de riesgo está incrementándose, los resultados actuales reflejan los avances en el manejo de estos pacientes.
Postharvest Analysis of Lowland Transgenic Tomato Fruits Harboring hpRNAi-ACO1 Construct
Directory of Open Access Journals (Sweden)
Bita Behboodian
2012-01-01
Full Text Available The plant hormone, ethylene, is an important regulator which involved in regulating fruit ripening and flower senescence. In this study, RNA interference (RNAi technology was employed to silence the genes involved in ethylene biosynthetic pathway. This was achieved by blocking the expression of specific gene encoding the ACC oxidase. Initially, cDNA corresponding to ACO1 of lowland tomato cultivar (MT1, which has high identity with ACO1 of Solanum lycopersicum in GenBank, was cloned through RT-PCR. Using a partial coding region of ACO1, one hpRNAi transformation vector was constructed and expressed ectopically under the 35S promoter. Results showed that transgenic lines harboring the hpRNA-ACO1 construct had lower ethylene production and a longer shelf life of 32 days as compared to 10 days for wild-type fruits. Changes in cell wall degrading enzyme activities were also investigated in cases where the transgenic fruits exhibited reduced rates of firmness loss, which can be associated with a decrease in pectin methylesterase (PME and polygalacturonase (PG activities. However, no significant change was detected in both transgenic and wild-type fruits in terms of β-galactosidase (β-Gal activity and levels of total soluble solid, titratable acid and ascorbic acid.
288. Feocromocitoma Cardíaco a Nivel Del Surco Interauricular
Directory of Open Access Journals (Sweden)
C. Iglesias Gil
2012-04-01
La localización extraadrenal de los feocromocitomas es infrecuente, siendo la torácica inferior al 2% y la intrapericárdica excepcional. Dado que son escasos los reportes de tumores secretores de catecolaminas a nivel cardíaco, presentamos este caso.
Martinez, Vanesa G; Escoda-Ferran, Cristina; Tadeu Simões, Inês; Arai, Satoko; Orta Mascaró, Marc; Carreras, Esther; Martínez-Florensa, Mario; Yelamos, José; Miyazaki, Toru; Lozano, Francisco
2014-07-01
Apoptosis inhibitor of macrophages (AIMs), a homologue of human Spα, is a mouse soluble member of the scavenger receptor cysteine-rich superfamily (SRCR-SF). This family integrates a group of proteins expressed by innate and adaptive immune cells for which no unifying function has yet been described. Pleiotropic functions have been ascribed to AIM, from viability support in lymphocytes during thymic selection to lipid metabolism and anti-inflammatory effects in autoimmune pathologies. In the present report, the pathogen binding properties of AIM have been explored. By using a recombinant form of AIM (rAIM) expressed in mammalian cells, it is shown that this protein is able to bind and aggregate Gram-positive and Gram-negative bacteria, as well as pathogenic and saprophytic fungal species. Importantly, endogenous AIM from mouse serum also binds to microorganisms and secretion of AIM was rapidly induced in mouse spleen macrophages following exposure to conserved microbial cell wall components. Cytokine release induced by well-known bacterial and fungal Toll-like receptor (TLR) ligands on mouse splenocytes was also inhibited in the presence of rAIM. Furthermore, mouse models of pathogen-associated molecular patterns (PAMPs)-induced septic shock of bacterial and fungal origin showed that serum AIM levels changed in a time-dependent manner. Altogether, these data suggest that AIM plays a general homeostatic role by supporting innate humoral defense during pathogen aggression.
Directory of Open Access Journals (Sweden)
Vargas-Arista, Benjamín
2014-09-01
Full Text Available A characterization study was done to analyze how microstructural regions affect the mechanical properties, corrosion and fractography of the Heat Affected Zone (HAZ, weld bead and base metal for pipe naturally aged for 21 years at 30 °C. Results showed that microstructures exhibited damage and consequently decrease in properties, resulting in over-aged due to service. SEM analysis showed that base metal presented coarse ferrite grain. Tensile test indicated that microstructures showed discontinuous yield. Higher tensile strength was obtained for weld bead, which exhibited a lower impact energy in comparison to that of HAZ and base metal associated with brittle fracture by trans-granular cleavage. The degradation of properties was associated with the coarsening of nano-carbides observed through TEM images analysis, which was confirmed by SEM fractography of tensile and impact fracture surfaces. The weld bead reached the largest void density and highest susceptibility to corrosion in H2S media when compared to those of the HAZ and base metal.Se realizó un estudio de caracterización para analizar cómo la microestructura afecta a las propiedades mecánicas, corrosión y fractura de la zona afectada por calor (ZAC, soldadura y metal base para tubería envejecida naturalmente durante 21 años a 30 °C. Los resultados indicaron que las microestructuras presentaron daño y consecuentemente reducción en propiedades mecánicas, como consecuencia del envejecimiento por servicio. El estudio mediante MEB mostró que el metal base presenta grano ferrítico grueso. La prueba de tensión indicó que las microestructuras mostraron fluencia discontinua. La mayor resistencia a la tracción se presentó en la soldadura, la cual alcanzó menor energía de impacto en comparación con la ZAC y metal base asociado con fractura frágil por clivaje transgranular. La degradación de las propriedades está en relación con el engrosamiento de nanocarburos observados a través del análisis de imágenes por MET, lo que se confirmó mediante fractografía por MEB de superfícies de fractura bajo tensión e impacto. La soldadura alcanzó la mayor densidad de microhuecos y la mayor susceptibilidad a la corrosión en un medio conteniendo H2S que cuando se compara con la ZAC y metal base.
A framework for API solubility modelling
DEFF Research Database (Denmark)
Conte, Elisa; Gani, Rafiqul; Crafts, Peter
. In addition, most of the models are not predictive and requires experimental data for the calculation of the needed parameters. This work aims at developing an efficient framework for the solubility modelling of Active Pharmaceutical Ingredients (API) in water and organic solvents. With this framework......-SAFT) are used for solubility calculations when the needed interaction parameters or experimental data are available. The CI-UNIFAC is instead used when the previous models lack interaction parameters or when solubility data are not available. A new GC+ model for APIs solvent selection based...... on the hydrophobicity, hydrophilicity and polarity information of the API and solvent is also developed, for performing fast solvent selection and screening. Eventually, all the previous developments are integrated in a framework for their efficient and integrated use. Two case studies are presented: the first...
MODAPS Web Services API for LANCE-MODIS
National Aeronautics and Space Administration — MODAPS Web Services API for LANCE-MODIS. This Application Programming Interface (API) encompasses a library of functions that provides programmatic data access to...
Unified Medical Language System Terminology Services (UTS) API
U.S. Department of Health & Human Services — The UTS API is intended for application developers to perform Web service calls and retrieve UMLS data within their own applications. The UTS API provides the...
Milbrath, Meghan O; van Tran, Toan; Huang, Wei-Fong; Solter, Leellen F; Tarpy, David R; Lawrence, Frank; Huang, Zachary Y
2015-02-01
Honey bees (Apis mellifera) are infected by two species of microsporidia: Nosema apis and Nosemaceranae. Epidemiological evidence indicates that N. ceranae may be replacing N. apis globally in A. mellifera populations, suggesting a potential competitive advantage of N. ceranae. Mixed infections of the two species occur, and little is known about the interactions among the host and the two pathogens that have allowed N. ceranae to become dominant in most geographical areas. We demonstrated that mixed Nosema species infections negatively affected honey bee survival (median survival=15-17days) more than single species infections (median survival=21days and 20days for N. apis and N. ceranae, respectively), with median survival of control bees of 27days. We found similar rates of infection (percentage of bees with active infections after inoculation) for both species in mixed infections, with N. apis having a slightly higher rate (91% compared to 86% for N. ceranae). We observed slightly higher spore counts in bees infected with N. ceranae than in bees infected with N. apis in single microsporidia infections, especially at the midpoint of infection (day 10). Bees with mixed infections of both species had higher spore counts than bees with single infections, but spore counts in mixed infections were highly variable. We did not see a competitive advantage for N. ceranae in mixed infections; N. apis spore counts were either higher or counts were similar for both species and more N. apis spores were produced in 62% of bees inoculated with equal dosages of the two microsporidian species. N. ceranae does not, therefore, appear to have a strong within-host advantage for either infectivity or spore growth, suggesting that direct competition in these worker bee mid-guts is not responsible for its apparent replacement of N. apis. Copyright © 2014 Elsevier Inc. All rights reserved.
Quality of care and racial disparities in medicare among potential ACOs.
Anderson, Ryan E; Ayanian, John Z; Zaslavsky, Alan M; McWilliams, J Michael
2014-09-01
The Medicare Accountable Care Organization (ACO) programs encourage integration of providers into large groups and reward provider groups for improving quality, but not explicitly for reducing health care disparities. Larger group size and better overall quality may or may not be associated with smaller disparities. To examine differences in patient characteristics between provider groups sufficiently large to participate in ACO programs and smaller groups; the association between group size and racial disparities in quality; and the association between quality and disparities among larger groups. Using 2009 Medicare claims for 3.1 million beneficiaries with cardiovascular disease or diabetes and linked data on provider groups, we compared racial differences in quality by provider group size, adjusting for patient characteristics. Among larger groups, we used multilevel models to estimate correlations between group performance on quality measures for white beneficiaries and black-white disparities within groups. Four process measures of quality, hospitalization for ambulatory care-sensitive conditions (ACSCs) related to cardiovascular disease or diabetes, and hospitalization for any ACSC. Beneficiaries served by larger groups were more likely to be white and live in areas with less poverty and more education. Larger group size was associated with smaller disparities in low-density lipoprotein (LDL) cholesterol testing and retinal exams, but not in other process measures or hospitalization for ACSCs. Among larger groups, better quality for white beneficiaries in one measure (hospitalization for ACSCs related to cardiovascular disease or diabetes) was correlated with smaller racial disparities (r = 0.28; P = 0.02), but quality was not correlated with disparities in other measures. Larger provider group size and better performance on quality measures were not consistently associated with smaller racial disparities in care for Medicare beneficiaries with
Energy Technology Data Exchange (ETDEWEB)
Lima, Alan M.M. de; Freire, Fernando S.; Nicolau, Andressa S.; Schirru, Roberto, E-mail: alan@lmp.ufrj.br, E-mail: andressa@lmp.ufrj.br, E-mail: schirru@lmp.ufrj.br, E-mail: ffreire@eletronuclear.gov.br [Coordenacao de Pos-Graduacao e Pesquisa de Engenharia (PEN/COPPE/UFRJ), Rio de Janeiro, RJ (Brazil); Eletrobras Termonuclear S.A. (ELETRONUCLEAR), Rio de Janeiro, RJ (Brazil)
2017-11-01
The Nuclear reload of a Pressurized Water Reactor (PWR) occurs whenever the burning of the fuel elements can no longer maintain the criticality of the reactor, that is, it cannot maintain the Nuclear power plant operates within its nominal power. Nuclear reactor reload optimization problem consists of finding a loading pattern of fuel assemblies in the reactor core in order to minimize the cost/benefit ratio, trying to obtain maximum power generation with a minimum of cost, since in all reloads an average of one third of the new fuel elements are purchased. This loading pattern must also satisfy constraints of symmetry and security. In practice, it consists of the placing 121 fuel elements in 121 core positions, in the case of the Angra 1 Brazilian Nuclear Power Plant (NPP), making this new arrangement provide the best cost/benefit ratio. It is an extremely complex problem, since it has around 1% of great places. A core of 121 fuel elements has approximately 10{sup 13} combinations and 10{sup 11} great locations. With this number of possible combinations it is impossible to test all, in order to choose the best. In this work a system called ACO-GENES is proposed in order to optimization the Nuclear Reactor Reload Problem. ACO is successfully used in combination problems, and it is expected that ACO-GENES will show a robust optimization system, since in addition to optimizing ACO, it allows important prior knowledge such as K infinite, burn, etc. After optimization by ACO-GENES, the best results will be validated by a licensed reactor physics code and will be compared with the actual results of the cycle. (author)
Pro REST API development with nodejs
Doglio, Fernando
2015-01-01
Pro REST API Development with Node.js is your guide to managing and understanding the full capabilities of successful REST development. API design is a hot topic in the programming world, but not many resources exist for developers to really understand how you can leverage the advantages. This book will provide a brief background on REST and the tools it provides (well known and not so well known). Understand how there is more to REST than just JSON and URLs. You will then cover and compare the maintained modules currently available in the npm community, including Express, Restify, Vatican,
National Research Council Canada - National Science Library
Paxton, Robert J; Klee, Julia; Korpela, Seppo; Fries, Ingemar
2007-01-01
Nosema ceranae, a microsporidian formerly regarded as confined to its Asiatic host Apis cerana, has recently been shown to parasitise Apis mellifera and to have spread throughout most of the world in the past few years...
47 CFR 61.46 - Adjustments to the API.
2010-10-01
... 47 Telecommunication 3 2010-10-01 2010-10-01 false Adjustments to the API. 61.46 Section 61.46... Rules for Dominant Carriers § 61.46 Adjustments to the API. (a) Except as provided in paragraphs (d) and... carrier must calculate an API for each affected basket pursuant to the following methodology: APIt = APIt...
Prp19 Arrests Cell Cycle via Cdc5L in Hepatocellular Carcinoma Cells.
Huang, Renzheng; Xue, Ruyi; Qu, Di; Yin, Jie; Shen, Xi-Zhong
2017-04-07
Pre-mRNA processing factor 19 (Prp19) is involved in many cellular events including pre-mRNA processing and DNA damage response. Recently, it has been identified as a candidate oncogene in hepatocellular carcinoma (HCC). However, the role of Prp19 in tumor biology is still elusive. Here, we reported that Prp19 arrested cell cycle in HCC cells via regulating G2/M transition. Mechanistic insights revealed that silencing Prp19 inhibited the expression of cell division cycle 5-like (Cdc5L) via repressing the translation of Cdc5L mRNA and facilitating lysosome-mediated degradation of Cdc5L in HCC cells. Furthermore, we found that silencing Prp19 induced cell cycle arrest could be partially resumed by overexpressing Cdc5L. This work implied that Prp19 participated in mitotic progression and thus could be a promising therapeutic target of HCC.
Integrated platform and API for electrophysiological data
Directory of Open Access Journals (Sweden)
Andrey eSobolev
2014-04-01
Full Text Available Recent advancements in technology and methodology have led to growing amounts of increasingly complex neuroscience data recorded from various species, modalities, and levels of study. The rapid data growth has made efficient data access and flexible, machine-readable data annotation a crucial requisite for neuroscientists. Clear and consistent annotation and organization of data is not only an important ingredient for reproducibility of results and re-use of data, but also essential for collaborative research and data sharing. In particular, efficient data management and interoperability requires a unified approach that integrates data and metadata and provides a common way of accessing this information.In this paper we describe GNData, a data management platform for neurophysiological data. GNData provides a storage system based on a data representation that is suitable to organize data and metadata from any electrophysiological experiment, with a functionality exposed via a common application programming interface (API. Data representation and API structure are compatible with existing approaches for data and metadata representation in neurophysiology. The API implementation is based on the Representational State Transfer (REST pattern, which enables data access integration in software applications and facilitates the development of tools that communicate with the service. Client libraries that interact with the API provide direct data access from computing environments like Matlab or Python, enabling integration of data management into the scientist's experimental or analysis routines.
Integrated platform and API for electrophysiological data.
Sobolev, Andrey; Stoewer, Adrian; Leonhardt, Aljoscha; Rautenberg, Philipp L; Kellner, Christian J; Garbers, Christian; Wachtler, Thomas
2014-01-01
Recent advancements in technology and methodology have led to growing amounts of increasingly complex neuroscience data recorded from various species, modalities, and levels of study. The rapid data growth has made efficient data access and flexible, machine-readable data annotation a crucial requisite for neuroscientists. Clear and consistent annotation and organization of data is not only an important ingredient for reproducibility of results and re-use of data, but also essential for collaborative research and data sharing. In particular, efficient data management and interoperability requires a unified approach that integrates data and metadata and provides a common way of accessing this information. In this paper we describe GNData, a data management platform for neurophysiological data. GNData provides a storage system based on a data representation that is suitable to organize data and metadata from any electrophysiological experiment, with a functionality exposed via a common application programming interface (API). Data representation and API structure are compatible with existing approaches for data and metadata representation in neurophysiology. The API implementation is based on the Representational State Transfer (REST) pattern, which enables data access integration in software applications and facilitates the development of tools that communicate with the service. Client libraries that interact with the API provide direct data access from computing environments like Matlab or Python, enabling integration of data management into the scientist's experimental or analysis routines.
Standard methods for Apis mellifera propolis research
Propolis is one of the most fascinating honey bee (Apis mellifera L.) products. It is a plant derived product that bees produce from resins that they collect from different plant organs and with which they mix beeswax. Propolis is a building material and a protective agent in the beehive. It also pl...
Using USNO's API to Obtain Data
Lesniak, Michael V.; Pozniak, Daniel; Punnoose, Tarun
2015-01-01
The U.S. Naval Observatory (USNO) is in the process of modernizing its publicly available web services into APIs (Application Programming Interfaces). Services configured as APIs offer greater flexibility to the user and allow greater usage. Depending on the particular service, users who implement our APIs will receive either a PNG (Portable Network Graphics) image or data in JSON (JavaScript Object Notation) format. This raw data can then be embedded in third-party web sites or in apps.Part of the USNO's mission is to provide astronomical and timing data to government agencies and the general public. To this end, the USNO provides accurate computations of astronomical phenomena such as dates of lunar phases, rise and set times of the Moon and Sun, and lunar and solar eclipse times. Users who navigate to our web site and select one of our 18 services are prompted to complete a web form, specifying parameters such as date, time, location, and object. Many of our services work for years between 1700 and 2100, meaning that past, present, and future events can be computed. Upon form submission, our web server processes the request, computes the data, and outputs it to the user.Over recent years, the use of the web by the general public has vastly changed. In response to this, the USNO is modernizing its web-based data services. This includes making our computed data easier to embed within third-party web sites as well as more easily querying from apps running on tablets and smart phones. To facilitate this, the USNO has begun converting its services into APIs. In addition to the existing web forms for the various services, users are able to make direct URL requests that return either an image or numerical data.To date, four of our web services have been configured to run with APIs. Two are image-producing services: "Apparent Disk of a Solar System Object" and "Day and Night Across the Earth." Two API data services are "Complete Sun and Moon Data for One Day" and "Dates
How Do Developers Use APIs? A Case Study in Concurrency
DEFF Research Database (Denmark)
Blom, Stefan; Kiniry, Joseph; Huisman, Marieke
2013-01-01
With the omnipresent usage of APIs in software development, it has become important to analyse how the routines and functionalities of APIs are actually used. This information is in particular useful for API developers, to make decisions about future updates of the API. However, also for developers...... of static analysis and verification tools this information is highly important, because it indicates where and how to put the most efficient effort in annotating APIs, to make them usable for the static analysis and verification tools. This paper presents an analysis of the usage of the routines...
Linked Vocabulary API for the Earth Sciences Community
Zednik, S.; Fox, P. A.; Fu, L.; West, P.; Ma, X.
2014-12-01
The Linked Vocabulary API is a specification for publishing RESTful APIs of vocabularies represented in the Simple Knowledge Organization System (SKOS) as Linked Data on the web. This work began as part of the Coastal and Marine Spatial Planning Vocabularies (CMSPV) project in response to the need for a standard manner for agencies to publish and consume hierarchical vocabularies on the web. The RESTful architecture of the API provides a simple mechanism for consumption of full vocabularies, single vocabulary terms, related terms, and searches on terms. The Linked Data nature of the API promotes interoperability by exposing vocabulary resources as resolvable URIs that may be referenced from other vocabularies or sources of Linked Data and by allowing the published vocabulary to contain references as links to terms from other vocabularies. The Linked Vocabulary API is formally defined in a Linked Data API specification and may be deployed using standard implementations of the Linked Data API such as the Epimorphics Linked Data API (ELDA). Recent presentations of work done with the Linked Vocabulary API as part of the CMSPV project have resulted in the API receiving growing interest from the broader scientific community. In this contribution we present the Linked Vocabulary API design and deployment process.
Energy Technology Data Exchange (ETDEWEB)
Arenas-Martinez, L.F [Universidad Autonoma de Coahuila, Coahuila (Mexico)]. E-mail: fernando.arenas@uadec.edu.mx; Garcia-Cerecero, G. [Corporacion Mexicana de Investigacion en Materiales S.A. de C.V., Saltillo, Coahuila (Mexico)]. E-mail: ggarcia@comimsa.com
2012-10-15
The corrosion behavior of gas metal arc welding (GMAW) regions has been studied using potentiodynamic polarization and polarization resistance (LPR) techniques. Experiments were conducted in hydrogen sulfide (H{sub 2}S)-containing brine and in H{sub 2}S-free brine. Welds were made on API 5L X52 steel. Due to differences in their microstructure, chemical composition and residual stress level, weld regions exhibited different responses under H{sub 2}S corrosion. Base metal exhibited the highest corrosion rate (CR) and the most cathodic corrosion potential. [Spanish] Se estudio el comportamiento ante la corrosion de las regiones de soldadura de un cordon realizado por arco metalico con gas (GMAW) sobre un acero grado API X52 mediante las tecnicas de polarizacion potencio dinamica y resistencia a la polarizacion (LPR). Los experimentos se realizaron utilizando salmuera con 300 ppm de acido sulfhidrico (H{sub 2}S) y salmuera libre de H{sub 2}S como electrolitos. Debido a las diferencias en su microestructura, composicion quimica y el nivel de esfuerzos residuales, las regiones de soldadura mostraron diferentes respuestas a la corrosion por H{sub 2}S. El metal base exhibio la velocidad de corrosion (VC) mas alta y el potencial de corrosion mas catodico.
Trasplante cardíaco en pacientes con enfermedad de Chagas. Experiencia de un único centro
Fiorelli,Alfredo Inácio; Groppo Stolf, Noedir Antonio; Bonno zambrano, Juan Antonio; Da Silva, Marcelo Fiorelli Alexandrino; Conceicao souza, Germano Elias; Bacal, Fernando; Brocchi, Edimar Alcides
2011-01-01
La enfermedad de Chagas es un problema de salud pública en América Latina con repercusión mundial por la globalización. Objetivo: Presentar la experiencia acumulada después de 25 años de un único centro con trasplante cardíaco en la cardiomiopatía chagásica. Método y casuística: De 417 pacientes sometidos a trasplante cardíaco desde marzo de 1985 hasta marzo de 2010, 111 (26,6%) eran portadores de cardiomiopatía chagásica: 77 (69,3%) estaban en clase funcional IV; 34 (30,6%) usaban agen...
A Hybrid Algorithm Based on ACO and PSO for Capacitated Vehicle Routing Problems
Directory of Open Access Journals (Sweden)
Yucheng Kao
2012-01-01
Full Text Available The vehicle routing problem (VRP is a well-known combinatorial optimization problem. It has been studied for several decades because finding effective vehicle routes is an important issue of logistic management. This paper proposes a new hybrid algorithm based on two main swarm intelligence (SI approaches, ant colony optimization (ACO and particle swarm optimization (PSO, for solving capacitated vehicle routing problems (CVRPs. In the proposed algorithm, each artificial ant, like a particle in PSO, is allowed to memorize the best solution ever found. After solution construction, only elite ants can update pheromone according to their own best-so-far solutions. Moreover, a pheromone disturbance method is embedded into the ACO framework to overcome the problem of pheromone stagnation. Two sets of benchmark problems were selected to test the performance of the proposed algorithm. The computational results show that the proposed algorithm performs well in comparison with existing swarm intelligence approaches.
Trauma cardíaco penetrante. Experiencia en el Hospital Nacional Cayetano Heredia 1984-1993.
Castañeda, Enrique; BAZAN, Noé; VASQUEZ, Julio; Delgado, Hugo
2013-01-01
Se revisaron las historias clínicas de 21 pacientes que sufrieron traumatismo cardíaco penetrante, atendidos entre enero de 1984 y diciembre de 1993 en el Hospital Nacional Cayetano Heredia de Lima – Perú. Todos los pacientes fueron de sexo masculino y correspondieron en el 76%, a la segunda y tercera década de la vida. La mayoría de traumatismos fueron por herida cortopunzante (85.7%) y la forma de presentación más frecuente fué taponamiento cardíaco (77.8%). El ventrículo derecho (47.6%) e ...
Protocolo del manejo y selección del donante cardíaco
Directory of Open Access Journals (Sweden)
José Elizalde
2008-01-01
Full Text Available El trasplante cardíaco es una terapia aceptada en grupos de pacientes afectos de insuficiencia cardíaca terminal. El envejecimiento progresivo de los donantes y la reducción del número de traumatismos craneoencefálicos mortales obliga a una valoración exhaustiva en cada caso. La ecocardiografía es, hoy en día, una exploración obligada en la valoración del donante. La Organización Nacional de Trasplantes ha elaborado un protocolo de manejo del donante torácico para optimizar su aprovechamiento. Se revisan los criterios de selección del donante cardíaco insistiendo en las contraindicaciones, en el despistaje de enfermedad coronaria y el mantenimiento durante el proceso de selección.
Update Strength in EDAs and ACO: How to Avoid Genetic Drift
DEFF Research Database (Denmark)
Sudholt, Dirk; Witt, Carsten
2016-01-01
, there is a general trade-off: too strong updates can lead to genetic drift and poor performance. We demonstrate this trade-off for the cGA and a simple MMAS ACO algorithm on the OneMax function. More precisely, we obtain lower bounds on the expected runtime of Ω(K√n + nlogn) and Ω(√n/ρ + nlogn), respectively...
Mulqueen, John; Maples, C. Dauphne; Fabisinski, Leo, III
2012-01-01
This paper provides an overview of Systems Engineering as it is applied in a conceptual design space systems department at the National Aeronautics and Space Administration (NASA) Marshall Spaceflight Center (MSFC) Advanced Concepts Office (ACO). Engineering work performed in the NASA MFSC's ACO is targeted toward the Exploratory Research and Concepts Development life cycle stages, as defined in the International Council on Systems Engineering (INCOSE) System Engineering Handbook. This paper addresses three ACO Systems Engineering tools that correspond to three INCOSE Technical Processes: Stakeholder Requirements Definition, Requirements Analysis, and Integration, as well as one Project Process Risk Management. These processes are used to facilitate, streamline, and manage systems engineering processes tailored for the earliest two life cycle stages, which is the environment in which ACO engineers work. The role of systems engineers and systems engineering as performed in ACO is explored in this paper. The need for tailoring Systems Engineering processes, tools, and products in the ever-changing engineering services ACO provides to its customers is addressed.
Maside, Xulio; Gómez-Moracho, Tamara; Jara, Laura; Martín-Hernández, Raquel; De la Rúa, Pilar; Higes, Mariano; Bartolomé, Carolina
2015-01-01
Two microsporidians are known to infect honey bees: Nosema apis and Nosema ceranae. Whereas population genetics data for the latter have been released in the last few years, such information is still missing for N. apis. Here we analyze the patterns of nucleotide polymorphism at three single-copy loci (PTP2, PTP3 and RPB1) in a collection of Apis mellifera isolates from all over the world, naturally infected either with N. apis (N = 22) or N. ceranae (N = 23), to provide new insights into the genetic diversity, demography and evolution of N. apis, as well as to compare them with evidence from N. ceranae. Neutral variation in N. apis and N. ceranae is of the order of 1%. This amount of diversity suggests that there is no substantial differentiation between the genetic content of the two nuclei present in these parasites, and evidence for genetic recombination provides a putative mechanism for the flow of genetic information between chromosomes. The analysis of the frequency spectrum of neutral variants reveals a significant surplus of low frequency variants, particularly in N. ceranae, and suggests that the populations of the two pathogens are not in mutation-drift equilibrium and that they have experienced a population expansion. Most of the variation in both species occurs within honey bee colonies (between 62%-90% of the total genetic variance), although in N. apis there is evidence for differentiation between parasites isolated from distinct A. mellifera lineages (20%-34% of the total variance), specifically between those collected from lineages A and C (or M). This scenario is consistent with a long-term host-parasite relationship and contrasts with the lack of differentiation observed among host-lineages in N. ceranae (< 4% of the variance), which suggests that the spread of this emergent pathogen throughout the A. mellifera worldwide population is a recent event. PMID:26720131
Processing time tolerance-based ACO algorithm for solving job-shop scheduling problem
Luo, Yabo; Waden, Yongo P.
2017-06-01
Ordinarily, Job Shop Scheduling Problem (JSSP) is known as NP-hard problem which has uncertainty and complexity that cannot be handled by a linear method. Thus, currently studies on JSSP are concentrated mainly on applying different methods of improving the heuristics for optimizing the JSSP. However, there still exist many problems for efficient optimization in the JSSP, namely, low efficiency and poor reliability, which can easily trap the optimization process of JSSP into local optima. Therefore, to solve this problem, a study on Ant Colony Optimization (ACO) algorithm combined with constraint handling tactics is carried out in this paper. Further, the problem is subdivided into three parts: (1) Analysis of processing time tolerance-based constraint features in the JSSP which is performed by the constraint satisfying model; (2) Satisfying the constraints by considering the consistency technology and the constraint spreading algorithm in order to improve the performance of ACO algorithm. Hence, the JSSP model based on the improved ACO algorithm is constructed; (3) The effectiveness of the proposed method based on reliability and efficiency is shown through comparative experiments which are performed on benchmark problems. Consequently, the results obtained by the proposed method are better, and the applied technique can be used in optimizing JSSP.
A performance improvement and cost-efficient ACO-OFDM scheme for visible light communications
Zhang, Tiantian; Zhou, Ji; Zhang, Zhenshan; Qiao, Yaojun; Su, Fei; Yang, Aiying
2017-11-01
In this paper, we propose a performance improvement and cost-efficient discrete Hartley transform (DHT)-based asymmetrically clipped optical orthogonal frequency division multiplexing (ACO-OFDM) scheme for visible light communications (VLC). The simple one-dimensional modulation constellation and simplified encoding structure reduce the complexity of system considerably. The DHT-spreading technique is employed to reduce peak-to-average power ratio (PAPR) of ACO-OFDM signals. Moreover, the intra-symbol frequency-domain averaging (ISFA) technique is used to increase the accuracy of channel estimation by removing the effect of ambient noise in the VLC channel effectively. To verify the feasibility of the proposed scheme, we study its performance via simulation. This scheme reduces the requirement to the resolution of DAC and increases the tolerance to the nonlinear characteristics of LED, both of which are cost-efficient. At forward error correction (FEC) limit (BER = 1 × 10-3), simulation results illustrate that compared with DHT-based ACO-OFDM without the ISFA technique, our scheme has 3.2 dB and 2.7 dB improvement of the required Eb /N0 when BPSK and 4-PAM are modulated, respectively.
Yoink: An interaction-based partitioning API.
Zheng, Min; Waller, Mark P
2018-01-05
Herein, we describe the implementation details of our interaction-based partitioning API (application programming interface) called Yoink for QM/MM modeling and fragment-based quantum chemistry studies. Interactions are detected by computing density descriptors such as reduced density gradient, density overlap regions indicator, and single exponential decay detector. Only molecules having an interaction with a user-definable QM core are added to the QM region of a hybrid QM/MM calculation. Moreover, a set of molecule pairs having density-based interactions within a molecular system can be computed in Yoink, and an interaction graph can then be constructed. Standard graph clustering methods can then be applied to construct fragments for further quantum chemical calculations. The Yoink API is licensed under Apache 2.0 and can be accessed via yoink.wallerlab.org. © 2018 Wiley Periodicals, Inc. © 2018 Wiley Periodicals, Inc.
Charbonneau, Lise R; Hillier, Neil Kirk; Rogers, Richard E L; Williams, Geoffrey R; Shutler, Dave
2016-03-10
Western honey bees (Apis mellifera) face an increasing number of challenges that in recent years have led to significant economic effects on apiculture, with attendant consequences for agriculture. Nosemosis is a fungal infection of honey bees caused by either Nosema apis or N. ceranae. The putative greater virulence of N. ceranae has spurred interest in understanding how it differs from N. apis. Little is known of effects of N. apis or N. ceranae on honey bee learning and memory. Following a Pavlovian model that relies on the proboscis extension reflex, we compared acquisition learning and long-term memory recall of uninfected (control) honey bees versus those inoculated with N. apis, N. ceranae, or both. We also tested whether spore intensity was associated with variation in learning and memory. Neither learning nor memory differed among treatments. There was no evidence of a relationship between spore intensity and learning, and only limited evidence of a negative effect on memory; this occurred only in the co-inoculation treatment. Our results suggest that if Nosema spp. are contributing to unusually high colony losses in recent years, the mechanism by which they may affect honey bees is probably not related to effects on learning or memory, at least as assessed by the proboscis extension reflex.
Directory of Open Access Journals (Sweden)
M. Masachs
2007-08-01
Full Text Available Introducción: se ha sugerido una potencial asociación entre la enfermedad celíaca y la enfermedad inflamatoria intestinal, que puede justificar que ambas enfermedades puedan presentarse en un mismo enfermo o en sus familiares de primer orden con mayor frecuencia de lo esperado. Objetivo: determinar la prevalencia de la enfermedad de Crohn y la colitis ulcerosa en los enfermos celíacos y en sus familiares. Método: estudio epidemiológico prospectivo transversal en un grupo de pacientes celíacos, sus familiares de primer grado y un grupo control de características epidemiológicas similares, constituido por familiares de pacientes que acuden al Servicio de Urgencias por un problema agudo. Para detectar la existencia de colitis ulcerosa y enfermedad de Crohn en los celíacos y sus familiares, se realizó una entrevista semiestructurada. Resultados: se han incluido 86 celíacos y 432 familiares, que se han comparado con 809 controles (129 pacientes con una enfermedad aguda y 680 familiares de primer grado suyos. Se han detectado 3 casos de enfermedad de Crohn en el grupo de los enfermos celíacos y 4 casos de enfermedad de Crohn en sus familiares. Sólo se ha detectado 1 caso de enfermedad de Crohn en el grupo control (p Introduction: a potential association between celic disease and inflammatory bowel disease hs been suggested, which may explain the fact that both disorders occasionally present in one patient or in his/her first-degree relatives more frequently than expected. Objective: to establish the prevalence of Crohn's disease and ulcerative colitis in celiac patients and their relatives. Method: a cross-sectional, prospective epidemiological study in a group of celiac patients, their first-degree relatives, and a control group with similar epidemiological characteristics including the relatives of patients presenting at the ER for acute conditions. A semistructured interview was used to identify the presence of Crohn's disease and
Application of EQ-5D-5L questionnaire in patients suffering from urinary incontinence.
Garcia-Gordillo, M A; Collado-Mateo, D; Olivares, P R; Adsuar, J C
2016-09-01
Urinary incontinence is associated with reduced quality of life and given the high prevalence of people with this condition, it could be useful to know the impact of having urinary incontinence on physical, psychological and social aspects. The Spanish value set of EQ-5D was used to assign single scores to the EQ-5D-5L health states. EQ-5D-5L is a health-related quality of life questionnaire, which allows assessing health status. The aim of this study was to provide normative values of EQ-5D-5L in a population sample with urinary incontinence. Cross-sectional study. A total of 965 people with urinary incontinence (297 men and 668 women) were included in this study. EQ-5D-5L index, VAS and health status are showed in the current study considering gender, age group, region, marital status, smoking status, net monthly incomes of household and educational level. Higher prevalence was observed in women (69.22%) compared with men (30.78%). Mean (SD) EQ-5D-5L utility index and VAS score were 0.58 (0.40) and 53.91 (22.16), respectively, for overall population. The 16.1% (155 people) reported perfect health status (11111). The utility equivalent to set values 55555 was not reported by anyone. This study provides normative values of EQ-5D-5L in a Spanish population sample with urinary incontinence. Copyright © 2016 AEU. Publicado por Elsevier España, S.L.U. All rights reserved.
Brummel, Amanda; Lustig, Adam; Westrich, Kimberly; Evans, Michael A; Plank, Gary S; Penso, Jerry; Dubois, Robert W
2014-12-01
One of the most important and often overlooked challenges for accountable care organizations (ACOs) is ensuring the optimal use of pharmaceuticals, which can be accomplished by utilizing pharmacists' skillsets and leveraging their full clinical expertise. Developing capabilities that support, monitor, and ensure appropriate medication use, efficacy, and safety is critical to achieving optimal patient outcomes and, ultimately, to an ACO's success. The program described in this article highlights the best practices of Fairview Pharmacy Services' Medication Therapy Management (MTM) program with additional thoughts and considerations on this and similar MTM programs provided by The Working Group on Optimizing Medication Therapy in Value-Based Healthcare. Fairview Pharmacy Services utilizes 23 MTM pharmacists (approximately 18 full-time equivalents) working in 30 locations, who conduct pharmacotherapy workups as part of the MTM services that Fairview provides. Pharmacists focus on patients in a comprehensive manner and assess all of their diseases and medications. Responsibilities include (a) identification of a patient's drug-related needs with a commitment to meet those needs; (b) an assessment and confirmation that all of a patient's drug therapy is appropriately indicated, effective and safe, and that the patient is compliant; (c) achievement of therapy outcomes and ensuring documentation of those outcomes; and (d) collaboration with all members of a patient's care team. Since 1998, pharmacists have cared for more than 20,000 patients and resolved more than 107,000 medication-related problems which, if left unresolved, could have led to hospital readmissions and emergency visits. Since becoming a Pioneer ACO, Fairview pharmacists have focused on the highest-risk members and have seen over 670 ACO patients, resolving over 2,780 medication-related problems. In terms of clinical outcomes, MTM contributed to optimal care in complex patients with diabetes. A review of
A More Accurate Model for Finding Tutorial Segments Explaining APIs
Jiang, He; Zhang, Jingxuan; Li, Xiaochen; Ren, Zhilei; Lo, David
2017-01-01
Developers prefer to utilize third-party libraries when they implement some functionalities and Application Programming Interfaces (APIs) are frequently used by them. Facing an unfamiliar API, developers tend to consult tutorials as learning resources. Unfortunately, the segments explaining a specific API scatter across tutorials. Hence, it remains a challenging issue to find the relevant segments. In this study, we propose a more accurate model to find the exact tutorial fragments explaining...
APIs for QoS configuration in Software Defined Networks
DEFF Research Database (Denmark)
Caba, Cosmin Marius; Soler, José
2015-01-01
such as configuration of devices, ports, queues, etc. An Application Programming Interface (API) for dynamic configuration of QoS resources in the network devices is implemented herein, by using the capabilities of OVSDB. Further, the paper demonstrates the possibility to create network services with coarse granularity...... on top of the fine granular services exposed by the QoS configuration API at the SDNC. A series of tests emphasize the capabilities and the performance of the implemented QoS configuration API....
BEE VENOM TRAP DESIGN OF APIS MELLIFERA L. AND APIS CERANA F. HONEY BEES
Budiaman
2015-01-01
The nectar and pollen of flowers which are abundance have not been taken into account for any purpose in forest, agriculture and plantation area. Honey bees such as Apis mellifera L. and Apis cerana F. had known as biological pollinators which could converted the flower components to be high economy products in the forms of honey, royal jelly, propolis, bee wax and bee venom. Among the products, bee venom has the best selling value, but the method of it???s optimal production has not been ext...
QHY (5L-II-M) CCD camera for video meteor observation
Korec, M.
2015-01-01
A new digital camera and lens has been tested for video meteor observing. A Tamron M13VG308 lens combined with a QHY 5L-II-M digital camera proved to be the best combination. Test observations have shown this to be superior to the best analog Watec 902H2 Ultimate camera.
Data of evolutionary structure change: 1AIGM-2UX5L [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1AIGM-2UX5L 1AIG 2UX5 M L YQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYLGSLGVL...FSLEPPAPEYGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFLSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSL...1AIG M 1AIGM IADRG-----TAAER...1AIG M 1AIGM TVVDN-----WYVWG...1AIG M 1AIGM VGPFSTLLGWFG
Survey of Public IaaS Cloud Computing API
Yamato, Yoji; Moriya, Takaaki; Ogawa, Takeshi; Akahani, Junichi
Recently, Cloud computing is spread rapidly and many Cloud providers start their Cloud services. One of the Cloud computing problems is Cloud provider Lock In” for users. Actually, Cloud computing management APIs such as ordering or provisioning are different in each Cloud provider, so that users need to study and implement new APIs when they change Cloud providers. OGF and DMTF start the discussions of standardization of Cloud computing APIs, but there is no standard now. In this technical note, to clarify what APIs cloud providers should provide, we study common APIs for Cloud computing. We survey and compare Cloud computing APIs such as Rackspace Cloud Server, Sun Cloud, GoGrid, ElasticHosts, Amazon EC2 and FlexiScale which are currently provided as public IaaS Cloud APIs in the market. From the survey, the common APIs should support REST access style and provide account management, virtual server management, storage management, network management and resource usage management capabilities. We also show an example of OSS to provide these common APIs compared to normal hosting services OSS.
Hardware-efficient signal generation of layered/enhanced ACO-OFDM for short-haul fiber-optic links.
Wang, Qibing; Song, Binhuang; Corcoran, Bill; Boland, David; Zhu, Chen; Zhuang, Leimeng; Lowery, Arthur J
2017-06-12
Layered/enhanced ACO-OFDM is a promising candidate for intensity modulation and direct-detection based short-haul fiber-optic links due to its both power and spectral efficiency. In this paper, we firstly demonstrate a hardware-efficient real-time 9.375 Gb/s QPSK-encoded layered/enhanced asymmetrical clipped optical OFDM (L/E-ACO-OFDM) transmitter using a Virtex-6 FPGA. This L/E-ACO-OFDM signal is successfully transmitted over 20-km uncompensated standard single-mode fiber (S-SMF) using a directly modulated laser. Several methods are explored to reduce the FPGA's logic resource utilization by taking advantage of the L/E-ACO-OFDM's signal characteristics. We show that the logic resource occupation of L/E-ACO-OFDM transmitter is almost the same as that of DC-biased OFDM transmitter when they achieve the same spectral efficiency, proving its great potential to be used in a real-time short-haul optical transmission link.
Directory of Open Access Journals (Sweden)
Imen Châari
2014-07-01
Full Text Available Path planning is a fundamental optimization problem that is crucial for the navigation of a mobile robot. Among the vast array of optimization approaches, we focus in this paper on Ant Colony Optimization (ACO and Genetic Algorithms (GA for solving the global path planning problem in a static environment, considering their effectiveness in solving such a problem. Our objective is to design an efficient hybrid algorithm that takes profit of the advantages of both ACO and GA approaches for the sake of maximizing the chance to find the optimal path even under real-time constraints. In this paper, we present smartPATH, a new hybrid ACO-GA algorithm that relies on the combination of an improved ACO algorithm (IACO for efficient and fast path selection, and a modified crossover operator to reduce the risk of falling into a local minimum. We demonstrate through extensive simulations that smartPATH outperforms classical ACO (CACO, GA algorithms. It also outperforms the Dijkstra exact method in solving the path planning problem for large graph environments. It improves the solution quality up to 57% in comparison with CACO and reduces the execution time up to 83% as compared to Dijkstra for large and dense graphs. In addition, the experimental results on a real robot shows that smartPATH finds the optimal path with a probability up to 80% with a small gap not exceeding 1m in 98%.
Beebread from Apis mellifera and Apis dorsata. Comparative Chemical Composition and Bioactivity
Directory of Open Access Journals (Sweden)
Otilia BOBIS
2017-05-01
Full Text Available Beebread is a valuable bee product, both for bee nutrition and for humans. The high nutritional and bioactive properties of beebread were evaluated by chemical composition analysis of beebread from Apis mellifera and Apis dorsata. Bee bread harvested from Romania and India, coming from Apis mellifera and Apis dorsata bees, were evaluated for their chemical composition. Analyses were made in APHIS Laboratory from USAMV Cluj, using validated methods for bee products. Lipids were determined by the Soxhlet extraction method, total protein content was determined by Kjehldahl method, sugar spectrum was determined by high performance liquid chromatography with refractive index detection (HPLC-IR. Water content of beebread samples were situated between 11.45 and 16.46%, total protein content between 16.84 and 19.19% and total lipids between 6.36 and 13.47%. Beebread has high bioactive properties which can be expressed as antioxidant and/or antibacterial activity. Chemical composition and bioactive properties of beebread is influenced by floral origin of the pollen which the bees collect and place in combs for fermentation. Also the climatic conditions have an important role in developing different fermentation compounds, that may act as antioxidants or antibacterial agents.
A REVIEW ON THE DETECTION OF HEART ATTACK USING DATA MINING BY ACO TECHNIQUE
Pise Satish Prakashrao*1, Anoop Singh 2 & Ritesh Kumar Yadav3
2018-01-01
The goal of data mining is to extract knowledge from huge amount of data. Now a day’s data mining technique used in the field of medical diagnose of critical diesis and clinical data. In this research propose model give a solution to predict heart diseases. In this paper proposes a novel approach of applying the Ant Colony Optimization technique (ACO) for extracting the Association Rules (AR) from the database to detect heart attack. This algorithm is broadly are many types of heart disease ...
Cateterismo cardíaco esquerdo: lacunas nas informações transmitidas aos pacientes
Cavalcanti,Taciana de Castilhos; Sarmento-Leite, Rogério; Carlos A.M. Gottschall; de Quadros, Alexandre Schaan; Goldmeier,Sílvia; De Souza, Emiliane Nogueira; de Moraes, Maria Antonieta Pereira
2008-01-01
INTRODUÇÃO: A prática dos procedimentos na Cardiologia Intervencionista está marcada por grandes avanços, mas o mesmo não se verifica no trato das informações e conhecimento dos pacientes acerca do tema. É imperativa a necessidade de consolidar as orientações transmitidas aos pacientes, instruindo-os sobre os benefícios alcançados pela sua compreensão sobre os exames invasivos. OBJETIVO: Verificar o conhecimento dos pacientes submetidos a cateterismo cardíaco em um hospital especializado em C...
Tumores cardíacos em criança: análise retrospectiva
Directory of Open Access Journals (Sweden)
Juliano Gomes Penha
2013-02-01
Full Text Available FUNDAMENTO: Avanço dos métodos não invasivos de imagem proporcionou o aumento no número de diagnóstico de tumores cardíacos. Apesar disso, a literatura apresenta poucos trabalhos envolvendo tumores cardíacos primários em crianças. OBJETIVO: Avaliar retrospectivamente casos de tumores cardíacos primários em crianças, considerando manifestações clínicas iniciais, exames utilizados para o diagnóstico, indicação cirúrgica, tipos histopatológicos encontrados e evolução pós-operatória imediata. MÉTODOS: O estudo foi retrospectivo, baseado na avaliação de prontuários no período de 1983 a 2011. Incluímos somente casos que foram orientados para tratamento cirúrgico no período. Avaliaram-se a idade na admissão, o diagnóstico pré-natal, a história familial, os sintomas iniciais e os resultados de exames realizados. Foram coletados, ainda, a data e indicação de cirurgia, os achados intraoperatórios, o resultado do exame histopatológico, assim como as complicações imediatas no pós-operatório. RESULTADOS: Dos 18 pacientes estudados, as manifestações clínicas mais encontradas foram dispneia e sopro cardíaco (7 e 6 pacientes, respectivamente; o método de complemento diagnóstico mais usado foi o ecocardiograma (18 pacientes; a obstrução cavitária ou do trato de entrada ou saída ventricular foi a principal indicação de cirurgia (12 casos; o perfil histológico mais encontrado foi rabdomioma (7 pacientes; a maioria dos pacientes apresentou boa evolução clínica. CONCLUSÃO: Neste estudo o diagnóstico por imagem foi basicamente ecocardiográfico, com boa correlação com os achados intraoperatórios. Os achados histopatológicos foram concordantes com a literatura, com o rabdomioma apresentando-se como o tumor mais comum em crianças. A evolução após tratamento cirúrgico mostrou-se favorável na maior parte dos casos.
Impact of Model Resolution in ACOS-xCO2 Observation Assimilation
Weidner, R. J.; Lee, M.; Miller, C. E.; Duren, R. M.
2013-12-01
Assimilation techniques are generally employed in two major applications, to fill the gaps in sparsely sampled observations or to improve the uncertainties in a model system. Both applications rely on estimating optimal states that minimize the total deviation between the observation and model forecast. In order to compute the deviation, the model forecast is transformed into observation space via an observation operator which represents sampling geometry, sounding profile, measurement sensitivity, and processing error of an observing system. Ideally, the observation space transformation implies the spatial and temporal resolution of the transformed model forecast matches those of the observation. However, current global chemistry-transport models (CTM) cannot deliver the required observation resolution of ACOS-XCO2 whose foorprint diameter ranges between 10 km and 50 km and sampling frequency is less than a minute. The quality of the assimilation degrades as the resolution mismatch increases, but the degrade level varies depending on the surface emssion property of the region, observation period, and assimilation duration. In this study, we present the impact of model resolution in ACOS-xCO2 observation assimilation based on two types of statistical analyses: 1) sample-level comparison between the bias-corrected V3.3 ACOS-xCO2 observations and the model forecasts in three spatial/temporal resolutions (2°x2.5° in 15 min, 1°x1.25° in 5 min, and 0.5°x0.625° in 2.5 min) over one year period (2010); 2) Evaluation of the model runs before and after assimilating V3.3 ACOS-xCO2 observations in the above three spatial/temporal resolutions compared to the HIPPO and TCCON data sets. The CO2 flux inventory developed by the NASA's Carbon Monitoring System-Flux (CMS-Flux) task and GEOS-5/MERRA meteorology fields developed by the NASA's Global Modeling and Assimilatoin Office (GMAO) were employed for the study.
Rare royal families in honeybees, Apis mellifera
Moritz, Robin F. A.; Lattorff, H. Michael G.; Neumann, Peter; Kraus, F. Bernhard; Radloff, Sarah E.; Hepburn, H. Randall
2005-10-01
The queen is the dominant female in the honeybee colony, Apis mellifera, and controls reproduction. Queen larvae are selected by the workers and are fed a special diet (royal jelly), which determines caste. Because queens mate with many males a large number of subfamilies coexist in the colony. As a consequence, there is a considerable potential for conflict among the subfamilies over queen rearing. Here we show that honeybee queens are not reared at random but are preferentially reared from rare “royal” subfamilies, which have extremely low frequencies in the colony's worker force but a high frequency in the queens reared.
Adaptive runtime for a multiprocessing API
Antao, Samuel F.; Bertolli, Carlo; Eichenberger, Alexandre E.; O'Brien, John K.
2016-11-15
A computer-implemented method includes selecting a runtime for executing a program. The runtime includes a first combination of feature implementations, where each feature implementation implements a feature of an application programming interface (API). Execution of the program is monitored, and the execution uses the runtime. Monitor data is generated based on the monitoring. A second combination of feature implementations are selected, by a computer processor, where the selection is based at least in part on the monitor data. The runtime is modified by activating the second combination of feature implementations to replace the first combination of feature implementations.
Directory of Open Access Journals (Sweden)
Dr. Suruchi Chawla
2015-08-01
Full Text Available Abstract In this paper hybrid of Ant Colony OptimizationACO and trust has been used for domainwise web page optimization in clustered query sessions for effective Information retrieval. The trust of the web page identifies its degree of relevance in satisfying specific information need of the user. The trusted web pages when optimized using pheromone updates in ACO will identify the trusted colonies of web pages which will be relevant to users information need in a given domain. Hence in this paper the hybrid of Trust and ACO has been used on clustered query sessions for identifying more and more relevant number of documents in a given domain in order to better satisfy the information need of the user. Experiment was conducted on the data set of web query sessions to test the effectiveness of the proposed approach in selected three domains Academics Entertainment and Sports and the results confirm the improvement in the precision of search results.
grlc Makes GitHub Taste Like Linked Data APIs
Merono Penuela, A.; Hoekstra, R.J.
2016-01-01
Building Web APIs on top of SPARQL endpoints is becoming common practice. It enables universal access to the integration favorable data space of Linked Data. In the majority of use cases, users cannot be expected to learn SPARQL to query this data space. Web APIs are the most common way to enable
Interfacing RASCAL with Java APIs. Automated mapping with Apache POI
G. Marmanidis (George)
2013-01-01
htmlabstractInterfacing RASCAL with Java APIs and reusing existing implementations is a required functionality in order to reduce effort and time in contrast with implementing a new one from scratch. In this study we are trying to interface RASCAL with Apache POI, a Java implemented API in order to
grlc Makes GitHub Taste Like Linked Data APIs
Meroño-Peñuela, A.; Hoekstra, R.
2016-01-01
Building Web APIs on top of SPARQL endpoints is becoming a common practice to enable universal access to the integration favorable dataspace of Linked Data. However, the Linked Data community cannot expect users to learn SPARQL to query this dataspace, and Web APIs are the most common way of
grlc Makes GitHub Taste Like Linked Data APIs
Meroño-Peñuela, A.; Hoekstra, Rinke; Sack, H; Rizzo, G; Steinmetz, N; Mladenić, D; Auer, S; Lange, C
2016-01-01
Building Web APIs on top of SPARQL endpoints is becoming a common practice to enable universal access to the integration favorable dataspace of Linked Data. However, the Linked Data community cannot expect users to learn SPARQL to query this dataspace, and Web APIs are the most extended way of
Experience API: Flexible, Decentralized and Activity-Centric Data Collection
Kevan, Jonathan M.; Ryan, Paul R.
2016-01-01
This emerging technology report describes the Experience API (xAPI), a new e-learning specification designed to support the learning community in standardizing and collecting both formal and informal distributed learning activities. Informed by Activity Theory, a framework aligned with constructivism, data is collected in the form of activity…
A Web API ecosystem through feature-based reuse
Verborgh, Ruben; Dumontier, Michel
2016-01-01
The current Web API landscape does not scale well: every API requires its own hardcoded clients in an unusually short-lived, tightly coupled relationship of highly subjective quality. This directly leads to inflated development costs, and prevents the design of a more intelligent generation of
Directory of Open Access Journals (Sweden)
Ronald Matthew Clouse
2014-06-01
Full Text Available The PIN and ACO gene families present interesting questions about the evolution of plant physiology, including testing hypotheses about the ecological drivers of their diversification and whether unrelated genes have been recruited for similar functions. The PIN-formed proteins contribute to the polar transport of auxin, a hormone which regulates plant growth and development. PIN loci are categorized into groups according to their protein length and structure, as well as subcellular localization. An interesting question with PIN genes is the nature of the ancestral form and location. ACOs are members of a superfamily of oxygenases and oxidases that catalyze the last step of ethylene synthesis, which regulates many aspects of the plant life cycle. We used publicly available PIN and ACO sequences to conduct phylogenetic analyses. Third codon positions of these genes in monocots have a high GC content, which could be historical but is more likely due to a mutational bias. Thus we developed methods to extract phylogenetic information from nucleotide sequences while avoiding this convergent feature. One method consisted in using only A-T transformations, and another used only the first and second codon positions for serine, which can only take A or T and G or C, respectively. We also conducted tree-searches for both gene families using unaligned amino acid sequences and dynamic homology. PIN genes appear to have diversified earlier than ACOs, with monocot and dicot copies more mixed in the phylogeny. However, gymnosperm PINs appear to be derived and not closely related to those from primitive plants. We find strong support for a long PIN gene ancestor with short forms subsequently evolving one or more times. ACO genes appear to have diversified mostly since the dicot-monocot split, as most genes cluster into a small number of monocot and dicot clades when the tree is rooted by genes from mosses. Gymnosperm ACOs were recovered as closely related and
The geospatial data quality REST API for primary biodiversity data.
Otegui, Javier; Guralnick, Robert P
2016-06-01
We present a REST web service to assess the geospatial quality of primary biodiversity data. It enables access to basic and advanced functions to detect completeness and consistency issues as well as general errors in the provided record or set of records. The API uses JSON for data interchange and efficient parallelization techniques for fast assessments of large datasets. The Geospatial Data Quality API is part of the VertNet set of APIs. It can be accessed at http://api-geospatial.vertnet-portal.appspot.com/geospatial and is already implemented in the VertNet data portal for quality reporting. Source code is freely available under GPL license from http://www.github.com/vertnet/api-geospatial javier.otegui@gmail.com or rguralnick@flmnh.ufl.edu Supplementary data are available at Bioinformatics online. © The Author 2016. Published by Oxford University Press.
Investigating an API for resilient exascale computing.
Energy Technology Data Exchange (ETDEWEB)
Stearley, Jon R.; Tomkins, James; VanDyke, John P.; Ferreira, Kurt Brian; Laros, James H.,; Bridges, Patrick
2013-05-01
Increased HPC capability comes with increased complexity, part counts, and fault occurrences. In- creasing the resilience of systems and applications to faults is a critical requirement facing the viability of exascale systems, as the overhead of traditional checkpoint/restart is projected to outweigh its bene ts due to fault rates outpacing I/O bandwidths. As faults occur and propagate throughout hardware and software layers, pervasive noti cation and handling mechanisms are necessary. This report describes an initial investigation of fault types and programming interfaces to mitigate them. Proof-of-concept APIs are presented for the frequent and important cases of memory errors and node failures, and a strategy proposed for lesystem failures. These involve changes to the operating system, runtime, I/O library, and application layers. While a single API for fault handling among hardware and OS and application system-wide remains elusive, the e ort increased our understanding of both the mountainous challenges and the promising trailheads. 3
Marcadores cardíacos na medicina veterinária Cardiac markers in veterinary medicine
Directory of Open Access Journals (Sweden)
Letícia Andreza Yonezawa
2010-02-01
Full Text Available Os marcadores cardíacos são utilizados com o intuito de auxiliar no diagnóstico clínico de animais com doença cardíaca com maior acurácia e em menor tempo possível, possibilitando o estabelecimento do prognóstico e a terapia precocemente. Entretanto, em medicina veterinária, no Brasil, sua aplicabilidade ainda é, em geral, restrita a pesquisas. Esta revisão tem como objetivo abordar os principais marcadores cardíacos para que futuramente estes possam se tornar índices essenciais na avaliação cardíaca.Cardiac markers have been used in order to assist clinical diagnosis of animals with heart disease, more accurately, enabling the establishment of earlier prognosis and therapy. However, in Brazilian veterinary medicine, these markers are generally still restricted to researches. This review aims to approach the major cardiac markers, which further may become essential indexes in heart assessment.
Sarcoidosis cardíaca: trasplante cardíaco y recidiva de la enfermedad
Directory of Open Access Journals (Sweden)
César A. Belziti
2010-01-01
Full Text Available RESUMENLa sarcoidosis cardíaca es una enfermedad granulomatosa multisistémica de causa desconocida.El compromiso aislado del corazón es poco frecuente y el pronóstico se correlacionacon el grado de afectación de este órgano. El tratamiento inmunosupresor y el trasplantecardíaco han demostrado que prolongan la sobrevida; no obstante, existen comunicacionesde recidiva de la enfermedad en el órgano implantado. En esta presentación se describe uncaso de recidiva de sarcoidosis cardíaca en un paciente con miocardiopatía dilatada coninsuficiencia cardíaca avanzada, sometido a un trasplante cardíaco y en quien el diagnósticode sarcoidosis cardíaca se estableció por el estudio anatomopatológico del corazón explantado.La evolución clínica fue favorable a pesar de la recidiva de la sarcoidosis en el órgano implantado.REV ARGENT CARDIOL 2010;78:358-360.
A Family of ACO Routing Protocols for Mobile Ad Hoc Networks.
Rupérez Cañas, Delfín; Sandoval Orozco, Ana Lucila; García Villalba, Luis Javier; Kim, Tai-Hoon
2017-05-22
In this work, an ACO routing protocol for mobile ad hoc networks based on AntHocNet is specified. As its predecessor, this new protocol, called AntOR, is hybrid in the sense that it contains elements from both reactive and proactive routing. Specifically, it combines a reactive route setup process with a proactive route maintenance and improvement process. Key aspects of the AntOR protocol are the disjoint-link and disjoint-node routes, separation between the regular pheromone and the virtual pheromone in the diffusion process and the exploration of routes, taking into consideration the number of hops in the best routes. In this work, a family of ACO routing protocols based on AntOR is also specified. These protocols are based on protocol successive refinements. In this work, we also present a parallelized version of AntOR that we call PAntOR. Using programming multiprocessor architectures based on the shared memory protocol, PAntOR allows running tasks in parallel using threads. This parallelization is applicable in the route setup phase, route local repair process and link failure notification. In addition, a variant of PAntOR that consists of having more than one interface, which we call PAntOR-MI (PAntOR-Multiple Interface), is specified. This approach parallelizes the sending of broadcast messages by interface through threads.
IMPROVED LS-SVM USING ACO TO ESTIMATE FLASHOVER VOLTAGE OF POLLUTED INSULATORS
Directory of Open Access Journals (Sweden)
SID AHMED BESSEDIK
2017-01-01
Full Text Available The reliability of insulators under polluted environment is one of the guiding factors in the insulation coordination of high voltage transmission lines. In order to improve understanding of the flashover phenomenon in polluted insulators, several experimental studies and mathematical approaches have been made in last year’s. In this paper, the critical flashover voltage behavior of polluted insulators has been calculated and a hybrid model between machine Learning (ML and optimization technique has been proposed. For this purpose, firstly the ant colony optimization (ACO technique is utilized to optimize the hyper-parameters needed in least squares support vector machines (LS-SVM. Then, a LS-SVM-ACO model is designed to establish a nonlinear model between the characteristics of the insulator and the critical flashover voltage. The data used to train the model and test its performance is derived from experimental measurements and a mathematical model. The results obtained from the proposed model are in good accord with other mathematical and experimental results of previous researchers.
Optimization of Vibration Reduction Ability of Ladder Tracks by FEM Coupled with ACO
Directory of Open Access Journals (Sweden)
Hao Jin
2015-01-01
Full Text Available Ladder track, which has drawn increased attention in scientific communities, is an effective method for reducing vibrations from underground railways. In order to optimize the vibration reduction ability of ladder track, a new method, that is, the finite element method (FEM coupled with ant colony optimization (ACO, has been proposed in this paper. We describe how to build the FEM model verified by the vibration tests in the Track Vibration Abatement and Control Laboratory and how to couple the FEM with ACO. The density and elasticity modulus of the sleeper pad are optimized using this method. After optimization, the vibration acceleration level of the supporting platform in the 1–200 Hz range was reduced from 102.8 dB to 94.4 dB. The optimized density of the sleeper pad is 620 kg/m3, and the optimized elasticity modulus of the sleeper pad is 6.25 × 106 N/m2.
Directory of Open Access Journals (Sweden)
J. Rex
2016-01-01
Full Text Available The lightweight aggregate is an aggregate that weighs less than the usual rock aggregate and the quarry dust is a rock particle used in the concrete for the experimentation. The significant intention of the proposed technique is to frame a mathematical modeling with the aid of the optimization techniques. The mathematical modeling is done by minimizing the cost and time consumed in the case of extension of the real time experiment. The proposed mathematical modeling is utilized to predict four output parameters such as compressive strength (Mpa, split tensile strength (Mpa, flexural strength (Mpa, and deflection (in mm. Here, the modeling is carried out with three different optimization techniques like genetic algorithm (GA, particle swarm optimization (PSO, and ant colony optimization (ACO with 80% of data from experiment utilized for the training and the remaining 20% for the validation. Finally, while testing, the error value is minimized and the performance obtained in the ACO for the parameters such as compressive strength, split tensile strength, flexural strength, and deflection is 91%, 98%, 87%, and 94% of predicted values, respectively, in the mathematical modeling.
A hybrid ACO/PSO based algorithm for QoS multicast routing problem
Directory of Open Access Journals (Sweden)
Manoj Kumar Patel
2014-03-01
Full Text Available Many Internet multicast applications such as videoconferencing, distance education, and online simulation require to send information from a source to some selected destinations. These applications have stringent Quality-of-Service (QoS requirements that include delay, loss rate, bandwidth, and delay jitter. This leads to the problem of routing multicast traffic satisfying QoS requirements. The above mentioned problem is known as the QoS constrained multicast routing problem and is NP Complete. In this paper, we present a swarming agent based intelligent algorithm using a hybrid Ant Colony Optimization (ACO/Particle Swarm Optimization (PSO technique to optimize the multicast tree. The algorithm starts with generating a large amount of mobile agents in the search space. The ACO algorithm guides the agents’ movement by pheromones in the shared environment locally, and the global maximum of the attribute values are obtained through the random interaction between the agents using PSO algorithm. The performance of the proposed algorithm is evaluated through simulation. The simulation results reveal that our algorithm performs better than the existing algorithms.
Coming 5th Edition of the API Standard 618: major changes compared to the API 618, 4th edition
Pyle, A.; Eijk, A.; Elferink, H.
2003-01-01
This paper will present the highlights of changes that will be found in the 5th Edition of API 618, which is expected to be published in late 2003 or early 2004. Approximately every 5 years the API Standards are revised in such a way that the latest field experiences and proven designs are included
fine-GRAPE : Fine-grained APi usage extractor – an approach and dataset to investigate API usage
Sawant, A.A.; Bacchelli, A.
An Application Programming Interface (API) provides a set of functionalities to a developer with the aim of enabling reuse. APIs have been investigated from different angles such as popularity usage and evolution to get a better understanding of their various characteristics. For such studies,
Pérez de Llano, Luis; Cosío, Borja G; Miravitlles, Marc; Plaza, Vicente
2017-12-08
We aimed to characterize the clinical, functional and inflammatory features of patients diagnosed diagnosed with ACO according to a new algorithm and to compare them with those of other chronic obstructive airway disease (COAD) categories (asthma and COPD). ACO was diagnosed in a cohort of COAD patients in those patients with COPD who were either diagnosed with current asthma or showed significant blood eosinophilia (≥300cells/μl) and/or a very positive bronchodilator response (>400ml and >15% in FEV1). Eighty-seven (29.8%) out of 292 patients fulfilled the ACO diagnostic criteria (12.8% asthmatics who smoked 200eosinophils/μl in blood and none with non-eosinophilic COPD). ACO, asthma and COPD patients showed no differences in symptoms or exacerbation rate. Mean pre-bronchodilator FEV1 in ACO and asthma were similar (1741 vs 1771ml), higher than in COPD (1431ml, p<0.05). DLCO was lower in ACO than in asthma (68.1 vs 84.1%) and similar to COPD (64.5%). Mean blood eosinophil count was similar in ACO and asthma (360 vs 305cells/μl) and higher than in COPD (170cells/μl). Periostin levels were similar in ACO to COPD (36.6 and 36.5IU/ml) and lower than in asthma (41.5IU/ml, p<0.05), whereas FeNO levels in ACO were intermediate. This algorithm classifies as ACO all smoking asthmatics with non-fully reversible airway obstruction and a considerable proportion of e-COPD patients, highlighting those who can benefit from inhaled corticosteroids. Copyright © 2017 SEPAR. Publicado por Elsevier España, S.L.U. All rights reserved.
Valuation and Modeling of EQ-5D-5L Health States Using a Hybrid Approach.
Ramos-Goñi, Juan M; Pinto-Prades, Jose L; Oppe, Mark; Cabasés, Juan M; Serrano-Aguilar, Pedro; Rivero-Arias, Oliver
2017-07-01
The EQ-5D instrument is the most widely used preference-based health-related quality of life questionnaire in cost-effectiveness analysis of health care technologies. Recently, a version called EQ-5D-5L with 5 levels on each dimension was developed. This manuscript explores the performance of a hybrid approach for the modeling of EQ-5D-5L valuation data. Two elicitation techniques, the composite time trade-off, and discrete choice experiments, were applied to a sample of the Spanish population (n=1000) using a computer-based questionnaire. The sampling process consisted of 2 stages: stratified sampling of geographic area, followed by systematic sampling in each area. A hybrid regression model combining composite time trade-off and discrete choice data was used to estimate the potential value sets using main effects as starting point. The comparison between the models was performed using the criteria of logical consistency, goodness of fit, and parsimony. Twenty-seven participants from the 1000 were removed following the exclusion criteria. The best-fitted model included 2 significant interaction terms but resulted in marginal improvements in model fit compared to the main effects model. We therefore selected the model results with main effects as a potential value set for this methodological study, based on the parsimony criteria. The results showed that the main effects hybrid model was consistent, with a range of utility values between 1 and -0.224. This paper shows the feasibility of using a hybrid approach to estimate a value set for EQ-5D-5L valuation data.
Brummel, Amanda; Lustig, Adam; Westrich, Kimberly; Evans, Michael A; Plank, Gary S; Penso, Jerry; Dubois, Robert W
2014-12-01
One of the most important and often overlooked challenges for accountable care organizations (ACOs) is ensuring the optimal use of pharmaceuticals, which can be accomplished by utilizing pharmacists' skillsets and leveraging their full clinical expertise. Developing capabilities that support, monitor, and ensure appropriate medication use, efficacy, and safety is critical to achieving optimal patient outcomes and, ultimately, to an ACO's success. The program described in this article highlights the best practices of Fairview Pharmacy Services' Medication Therapy Management (MTM) program with additional thoughts and considerations on this and similar MTM programs provided by The Working Group on Optimizing Medication Therapy in Value-Based Healthcare. Fairview Pharmacy Services utilizes 23 MTM pharmacists (approximately 18 full-time equivalents) working in 30 locations, who conduct pharmacotherapy workups as part of the MTM services that Fairview provides. Pharmacists focus on patients in a comprehensive manner and assess all of their diseases and medications. Responsibilities include (a) identification of a patient's drug-related needs with a commitment to meet those needs; (b) an assessment and confirmation that all of a patient's drug therapy is appropriately indicated, effective and safe, and that the patient is compliant; (c) achievement of therapy outcomes and ensuring documentation of those outcomes; and (d) collaboration with all members of a patient's care team. Since 1998, pharmacists have cared for more than 20,000 patients and resolved more than 107,000 medication-related problems which, if left unresolved, could have led to hospital readmissions and emergency visits. Since becoming a Pioneer ACO, Fairview pharmacists have focused on the highest-risk members and have seen over 670 ACO patients, resolving over 2,780 medication-related problems. In terms of clinical outcomes, MTM contributed to optimal care in complex patients with diabetes. A review of
Compositional Mining of Multiple Object API Protocols through State Abstraction
Directory of Open Access Journals (Sweden)
Ziying Dai
2013-01-01
Full Text Available API protocols specify correct sequences of method invocations. Despite their usefulness, API protocols are often unavailable in practice because writing them is cumbersome and error prone. Multiple object API protocols are more expressive than single object API protocols. However, the huge number of objects of typical object-oriented programs poses a major challenge to the automatic mining of multiple object API protocols: besides maintaining scalability, it is important to capture various object interactions. Current approaches utilize various heuristics to focus on small sets of methods. In this paper, we present a general, scalable, multiple object API protocols mining approach that can capture all object interactions. Our approach uses abstract field values to label object states during the mining process. We first mine single object typestates as finite state automata whose transitions are annotated with states of interacting objects before and after the execution of the corresponding method and then construct multiple object API protocols by composing these annotated single object typestates. We implement our approach for Java and evaluate it through a series of experiments.
Compositional mining of multiple object API protocols through state abstraction.
Dai, Ziying; Mao, Xiaoguang; Lei, Yan; Qi, Yuhua; Wang, Rui; Gu, Bin
2013-01-01
API protocols specify correct sequences of method invocations. Despite their usefulness, API protocols are often unavailable in practice because writing them is cumbersome and error prone. Multiple object API protocols are more expressive than single object API protocols. However, the huge number of objects of typical object-oriented programs poses a major challenge to the automatic mining of multiple object API protocols: besides maintaining scalability, it is important to capture various object interactions. Current approaches utilize various heuristics to focus on small sets of methods. In this paper, we present a general, scalable, multiple object API protocols mining approach that can capture all object interactions. Our approach uses abstract field values to label object states during the mining process. We first mine single object typestates as finite state automata whose transitions are annotated with states of interacting objects before and after the execution of the corresponding method and then construct multiple object API protocols by composing these annotated single object typestates. We implement our approach for Java and evaluate it through a series of experiments.
NHETS - Estudo de Necrópsias de Pacientes Submetidos a Transplante Cardíaco
Directory of Open Access Journals (Sweden)
Thiago Ninck Valette
2014-06-01
Full Text Available Fundamento: Discordâncias entre diagnóstico pre e post-mortem são relatadas na literatura, podendo variar de 4,1 a 49,8% dentre os casos encaminhados para exame necroscópico, com importante repercussão no tratamento dos pacientes. Objetivo: Analisar pacientes com óbito após o transplante cardíaco e confrontar os diagnósticos pre e post-mortem. Métodos: Por meio da revisão de prontuários, foram analisados dados clínicos, presença de comorbidades, esquema de imunossupressão, exames laboratoriais, causa clínica do óbito e causa do óbito à necrópsia. Foram confrontadas, então, a causa clínica e a causa necroscópica do óbito de cada paciente. Resultados: Foram analisados 48 óbitos submetidos à necrópsia no período de 2000 a 2010; 29 (60,4% tiveram diagnósticos clínico e necroscópico concordantes, 16 (33,3% tiveram diagnósticos discordantes e três (6,3% tiveram diagnóstico não esclarecido. Entre os discordantes, 15 (31,3% apresentaram possível impacto na sobrevida e um (2,1% não apresentou impacto na sobrevida. O principal diagnóstico clínico feito equivocadamente foi o de infecção, com cinco casos (26,7% dos discordantes, seguido por rejeição hiperaguda, com quatro casos (20% dos discordantes, e tromboembolismo pulmonar, com três casos (13,3% dos discordantes. Conclusão: Discordâncias entre o diagnóstico clínico e achados da necrópsia são comumente encontradas no transplante cardíaco. Novas estratégias no aperfeiçoamento do diagnóstico clínico devem ser introduzidas, considerando-se os resultados da necrópsia para melhoria do tratamento da insuficiência cardíaca por meio do transplante cardíaco.
Isetts, Brian
2017-10-16
(1) Background: As the U.S. healthcare system evolves from fee-for-service financing to global population-based payments designed to be accountable for both quality and total cost of care, the effective and safe use of medications is gaining increased importance. The purpose of this project was to determine the feasibility of integrating medication therapy management (MTM) services provided by community pharmacists into the clinical care teams and the health information technology (HIT) infrastructure for Minnesota Medicaid recipients of a 12-county community-based accountable care organization (ACO). (2) Methods: The continuous quality improvement evaluation methodology employed in this project was the context + mechanism = outcome (CMO) model to account for the fact that programs only work insofar as they introduce promising ideas, solutions and opportunities in the appropriate social and cultural contexts. Collaborations between a 12-county ACO and 15 community pharmacies in Southwest Minnesota served as the social context for this feasibility study of MTM referrals to community pharmacists. (3) Results: All 15 community pharmacy sites were integrated into the HIT infrastructure through Direct Secure Messaging, and there were 32 recipients who received MTM services subsequent to referrals from the ACO at 5 of the 15 community pharmacies over a 1-year implementation phase. (4) Conclusion: At the conclusion of this project, an effective electronic communication and MTM referral system was activated, and consideration was given to community pharmacists providing MTM in future ACO shared savings agreements.
Directory of Open Access Journals (Sweden)
Oscar Castillo
2013-01-01
Full Text Available Ant Colony Optimization (ACO is a population-based constructive meta-heuristic that exploits a form of past performance memory inspired by the foraging behaviour of real ants. The behaviour of the ACO algorithm is highly dependent on the values defined for its parameters. Adaptation and parameter control are recurring themes in the field of bio-inspired algorithms. The present paper explores a new approach to diversity control in ACO. The central idea is to avoid or slow down full convergence through the dynamic variation of certain parameters. The performance of different variants of the ACO algorithm was observed to choose one as the basis for the proposed approach. A convergence fuzzy logic controller with the objective of maintaining diversity at some level to avoid premature convergence was created. Encouraging results have been obtained on its application to the design of fuzzy controllers. In particular, the optimization of membership functions for a unicycle mobile robot trajectory control is presented with the proposed method.
Equilibrio de disociacion del amoníaco como base débil en medio acuoso
Milla González, Miguel; Bellido Milla, Dolores
2010-01-01
El amoníaco se comporta como una base débil en disolución acuosa, en la que las moléculas de agua actúan como ácido. Se presenta una animación del equilibrio protolítico de esta especie, mostrando la naturaleza dinámica de dicho proceso
Open-Source Neural Machine Translation API Server
Directory of Open Access Journals (Sweden)
Tars Sander
2017-10-01
Full Text Available We introduce an open-source implementation of a machine translation API server. The aim of this software package is to enable anyone to run their own multi-engine translation server with neural machine translation engines, supporting an open API for client applications. Besides the hub with the implementation of the client API and the translation service providers running in the background we also describe an open-source demo web application that uses our software package and implements an online translation tool that supports collecting translation quality comparisons from users.
Data Management API within the GridRPC
Caniou, Yves; Caron, Eddy; Le Mahec, Gaël; Nakada, Hidemoto
2011-01-01
Copyright (c) Open Grid Forum (2006-2011). Some Rights Reserved. Distribution is unlimited.; standardization; This document follows the document produced by the GridRPC-WG on GridRPC Model and API for End-User applications. This new document aims to complete the GridRPC API with Data Management mechanisms and API.This document is not intended to provide features and capabilities for building data management middle- ware. Its goal is to complete the GridRPC set of functions and definitions to ...
Building Hypermedia APIs with HTML5 and Node
Amundsen, Mike
2011-01-01
With this concise book, you'll learn the art of building hypermedia APIs that don't simply run on the Web, but that actually exist in the Web. You'll start with the general principles and technologies behind this architectural approach, and then dive hands-on into three fully-functional API examples. Too many APIs rely on concepts rooted in desktop and local area network patterns that don't scale well-costly solutions that are difficult to maintain over time. This book shows system architects and web developers how to design and implement human- and machine-readable web services that remain
Comparing responsiveness of the EQ-5D-5L, EQ-5D-3L and EQ VAS in stroke patients
D. Golicki (Dominik); M. Niewada (Maciej); A. Karlińska (Anna); J. Buczek (Julia); A. Kobayashi (Adam); M.F. Janssen (Bas); A.S. Pickard (Simon)
2015-01-01
textabstractAims: To date, evidence to support the construct validity of the EQ-5D-5L has primarily focused on cross-sectional data. The aims of this study were to examine the responsiveness of EQ-5D-5L in patients with stroke and to compare it with responsiveness of EQ-5D-3L and visual analogue
STAT5A-mediated NOX5-L expression promotes the proliferation and metastasis of breast cancer cells
Energy Technology Data Exchange (ETDEWEB)
Dho, So Hee [Aging Research Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon 305-806 (Korea, Republic of); Radioisotope Research Division, Department of Research Reactor Utilization, Korea Atomic Energy Research Institute, Daejeon 305-353 (Korea, Republic of); Kim, Ji Young; Lee, Kwang-Pyo; Kwon, Eun-Soo [Aging Research Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon 305-806 (Korea, Republic of); Lim, Jae Cheong [Radioisotope Research Division, Department of Research Reactor Utilization, Korea Atomic Energy Research Institute, Daejeon 305-353 (Korea, Republic of); Kim, Chang-Jin [Department of Pathology, Soonchunhyang Medical Science Research Institute, Chonan 330-090 (Korea, Republic of); Jeong, Dongjun, E-mail: juny1024@sch.ac.kr [Department of Pathology, Soonchunhyang Medical Science Research Institute, Chonan 330-090 (Korea, Republic of); Kwon, Ki-Sun, E-mail: kwonks@kribb.re.kr [Aging Research Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon 305-806 (Korea, Republic of); Department of Functional Genomics, Korea University of Science and Technology (UST), Daejeon 305-333 (Korea, Republic of)
2017-02-01
NADPH oxidase (NOX) generates reactive oxygen species (ROS) and has been suggested to mediate cell proliferation in some cancers. Here, we show that an increase in the expression of NOX5 long form (NOX5-L) is critical for tumor progression in breast tumor tissues. Immunostaining of clinical samples indicated that NOX5 was overexpressed in 41.1% of breast ductal carcinoma samples. NOX5-L depletion consistently suppressed cell proliferation, invasion, and migration in vitro. Antibody-mediated neutralization of NOX5-L attenuated tumor progression in a mouse xenograft model. Promoter analysis revealed that NOX5-L expression is regulated by STAT5A in breast cancer cells. Based on our novel findings, we suggest that inhibition of NOX5-L may be a promising therapeutic strategy that exerts anti-cancer effects via the modulation of ROS-mediated cell signaling. - Highlights: • The ROS-generating protein, NOX5-L, determines cellular proliferation and metastasis in subset of breast tumor. • Tumor growth was attenuated by the treatment of anti-NOX5-L antibody in a xenograft model. • NOX5-L expression is transcriptionally regulated by STAT5A in breast cancer cells.
Multi-criteria ACO-based Algorithm for Ship’s Trajectory Planning
Directory of Open Access Journals (Sweden)
Agnieszka Lazarowska
2017-03-01
Full Text Available The paper presents a new approach for solving a path planning problem for ships in the environment with static and dynamic obstacles. The algorithm utilizes a heuristic method, classified to the group of Swarm Intelligence approaches, called the Ant Colony Optimization. The method is inspired by a collective behaviour of ant colonies. A group of agents - artificial ants searches through the solution space in order to find a safe, optimal trajectory for a ship. The problem is considered as a multi-criteria optimization task. The criteria taken into account during problem solving are: path safety, path length, the International Regulations for Preventing Collisions at Sea (COLREGs compliance and path smoothness. The paper includes the description of the new multi-criteria ACO-based algorithm along with the presentation and discussion of simulation tests results.
Controlling the Balance of Exploration and Exploitation in ACO Algorithm
Directory of Open Access Journals (Sweden)
Ayad Mohammed Jabbar
2018-02-01
Full Text Available Ant colony optimization is a meta-heuristic algorithm inspired by the foraging behavior of real ant colony. The algorithm is a population-based solution employed in different optimization problems such as classification, image processing, clustering, and so on. This paper sheds the light on the side of improving the results of traveling salesman problem produced by the algorithm. The key success that produces the valuable results is due to the two important components of exploration and exploitation. Balancing both components is the foundation of controlling search within the ACO. This paper proposes to modify the main probabilistic method to overcome the drawbacks of the exploration problem and produces global optimal results in high dimensional space. Experiments on six variant of ant colony optimization indicate that the proposed work produces high-quality results in terms of shortest route
Validation of OCO-2 and ACOS-GOSAT using HIPPO and TCCON
Kulawik, Susan S.; Wunch, Debra; O'Dell, Christopher; Miller, Charles; Osterman, Greg; Wennberg, Paul; Griffith, David; Sherlock, Vanessa; Deutscher, Nicholas M.; Notholt, Justus;
2017-01-01
Consistent validation of satellite CO2 estimates is a prerequisite for using multiple satellite CO2measurements for joint flux inversion and establishing a long-term atmospheric CO2 data record. Wevalidate recent satellite observation of OCO-2 v7 and ACOS-GOSAT v7.3 using similar analysis as previouswork (Kulawik et al. (2016) and Frankenberg et al. (2106)) through comparisons to the HIAPER Pole-to-Pole Observations (HIPPO) and the Total Carbon Column Observing Network (TCCON) to estimate biasesand errors affecting the understanding of carbon cycle science. CarbonTracker RT is also compared tothe validation data, and additionally used to evaluate the mismatch between the HIPPO observationtimeframe and the OCO-2 record, which are offset by 3-7 years. Some key metrics that are validatedinclude the seasonal cycle phase and amplitude, latitudinal gradient by season, regional biases, anderrors with respect to averaging.
Transfer function fitting using a continuous Ant Colony Optimization (ACO algorithm
Directory of Open Access Journals (Sweden)
A. Reineix
2015-03-01
Full Text Available An original approach is proposed in order to achieve the fitting of ultra-wideband complex frequency functions, such as the complex impedances, by using the so-called ACO (Ant Colony Optimization methods. First, we present the optimization principle of ACO, which originally was dedicated to the combinatorial problems. Further on, the extension to the continuous and mixed problems is explained in more details. The interest in this approach is proved by its ability to define practical constraints and objectives, such as minimizing the number of filters used in the model with respect to a fixed relative error. Finally, the establishment of the model for the first and second order filter types illustrates the power of the method and its interest for the time-domain electromagnetic computation.
251. Seno coronario imperforado con clínica de taponamiento cardíaco
M.T. Conejero Jurado; Moya González, J.; Ávalos Pinto, R.M.; Otero Forero, J.; D. Valencia Núñez; Maiorano Iuliano, P.; Sauchelli Faas, G.; Pernia Oreña, I.; Merino Cejas, C.; Casares Mediavilla, J.; P. Alados Arboledas
2012-01-01
Las alteraciones anatómicas del seno coronario son extraordinariamente raras; presentamos el caso de una paciente con seno coronario imperforado que debutó con clínica de taponamiento cardíaco. Material y métodos: Paciente de 61 años que ingresa en el servicio de urgencias por clínica de dolor torácico atípico y disnea. En la ecocardiografía transtorácica (ETT) se aprecia masa retrocardíaca quística, debajo de ambas aurículas. Tomografía computarizada (TC) coronaria: sospecha de fístula de...
Trasplante cardíaco en pacientes con enfermedad de Chagas. Experiencia de un único centro
Directory of Open Access Journals (Sweden)
Alfredo Inácio Fiorelli
2011-07-01
Conclusiones: El trasplante cardíaco es el único tratamiento actual eficaz de tratamiento de la enfermedad de Chagas en fase terminal. La reactivación de la enfermedad es un problema real que es fácilmente revertido con la introducción de la terapéutica farmacológica específica, restaurando los padrones histológicos del miocardio sin dejar secuelas. La inmunosupresión, en especial los corticoides, predisponen al desarrollo de neoplasias y a la reactivación de la enfermedad, exigiendo una atención especial su interrupción o reducción precoz.
Nosema ceranae in European honey bees (Apis mellifera).
Fries, Ingemar
2010-01-01
Nosema ceranae is a microsporidian parasite described from the Asian honey bee, Apis cerana. The parasite is cross-infective with the European honey bee, Apis mellifera. It is not known when or where N. ceranae first infected European bees, but N. ceranae has probably been infecting European bees for at least two decades. N. ceranae appears to be replacing Nosema apis, at least in some populations of European honey bees. This replacement is an enigma because the spores of the new parasite are less durable than those of N. apis. Virulence data at both the individual bee and at the colony level are conflicting possibly because the impact of this parasite differs in different environments. The recent advancements in N. ceranae genetics, with a draft assembly of the N. ceranae genome available, are discussed and the need for increased research on the impacts of this parasite on European honey bees is emphasized. Copyright 2009 Elsevier Inc. All rights reserved.
Practical Implementation of 10 Rules for Writing REST APIs
Directory of Open Access Journals (Sweden)
Jiri Hradil
2017-01-01
Full Text Available This paper shows a practical implementation of “10 Rules for Writing REST APIs introduced in the article” (Hradil, 2016. The application is done in Invoice Home (Wikilane, 2016, an invoicing web application for small business and entrepreneurs available world-wide. The API is implemented in JSON hypermedia format (ECMA International, 2016 and with Ruby on Rails framework (Hansson, 2016. The main purpose of the API is to allow connection of Invoice Home with external systems and offer Invoice Home data in simpler format compared to the current HTML format of the full-stack web application. The paper could be also used as a basic template or pattern for any other implementation of the JSON API in any web-based application.
National Research Council Canada - National Science Library
Feng, Mao; Ramadan, Haitham; Han, Bin; Fang, Yu; Li, Jianke
2014-01-01
... (Apis mellifera and Apis cerana). A time-resolved proteome was compared using two-dimensional electrophoresis-based proteomics to reveal the mechanistic differences by analysis of hemolymph proteome changes between the worker bees...
National Research Council Canada - National Science Library
Williams, Geoffrey R; Shutler, Dave; Burgher-MacLellan, Karen L; Rogers, Richard E L
2014-01-01
... (Apis mellifera, hereafter honey bee) in many regions of the world. Invasive Nosema ceranae is particularly worrisome because some evidence suggests it has greater virulence than its congener N. apis. N...
Relationship between a novel polymorphism of the C5L2 gene and coronary artery disease.
Directory of Open Access Journals (Sweden)
Ying-Ying Zheng
Full Text Available BACKGROUND: C5L2 has been demonstrated to be a functional receptor of acylation-stimulating protein (ASP, which is a stimulator of triglyceride synthesis or glucose transport. However, little is known about the variations in the coding region of the C5L2 gene and their association with coronary artery disease (CAD. METHODOLOGY/PRINCIPAL FINDINGS: We identified a novel single nucleotide polymorphism (SNP, 698C>T (P233L, in exon 2 using a polymerase chain reaction direct-sequencing method. This nucleotide change causes the amino-acid order from proline to leucine at codon 233. We examined the role of this SNP for CAD using two independent case-control studies: one was in the Han population (492 CAD patients and 577 control subjects and the other was in the Uygur population (319 CAD patients and 554 control subjects. Heterozygote carriers of the 698CT genotype were more frequent among CAD patients than among controls not only in the Han population (7.3% versus 1.7% but also in the Uygur population (4.7% versus 1.6%. The odds ratio (OR for carriers of the 698CT genotype for CAD was 4.484 (95% confidence interval (CI: 2.197-9.174 in the Han group and 2.989 (95% CI: 1.292-6.909 in the Uygur population. After adjustment of confounding factors such as sex, age, smoking, alcohol consumption, hypertension, diabetes, as well as serum levels of triglyceride, total cholesterol, high-density lipoprotein, the difference remained significant in the Han group (P<0.001, OR = 6.604, 95% CI: 2.776-15.711 and in the Uygur group (P = 0.047, OR = 2.602, 95% CI: 1.015-6.671. CONCLUSION/SIGNIFICANCE: The 698CT genotype of C5L2 may be a genetic maker of CAD in the Han and Uygur population in western China.
Aplikasi RFID untuk Sistem Identifikasi Stasiun Kereta Api
Farid Ishartomo; Panggih Basuki
2011-01-01
Abstrak Rancangan ini bertujuan untuk merancang prototipe sistem identifikasi stasiun kereta api yang dilewati sebuah kereta menggunakan RFID dan mikrokontroler AT89S51. Dulu Radio Frequency Identification (RFID) terdiri dari RFID reader dan RFID transponder sebagai perangkat identifikasi stasiun kereta api. RFID reader memancarkan frekuensi tertentu untuk mengidentifikasi RFID transponder. Di sisi lain, RFID transponder akan menerima sinyal dari frekuensi RFID reader, dan kemudian mengir...
Integration of REST Web Service with Social Media API
Gebremichael, Aschalew
2016-01-01
The increasing number of social media users has led to a scenario in which a successful online strategy includes effective integration with the social media platforms, such as Facebook and Twitter. Understanding the fundamentals of REST API architecture together with factors that play a key role in building robust web service will create a strong foundation in the integration of a web application with a Social Media API. As a result, this thesis provides discussion on the fundamental th...
Energy Technology Data Exchange (ETDEWEB)
Medeiros, Raimundo C.; Santos, Ramon Loback Medeiros [TRANSPETRO - PETROBRAS Transporte S.A., Rio de Janeiro, RJ (Brazil); Bittencourt, Marcelo S.Q.; Lamy, Carlos A. [Instituto de Engenharia Nuclear (IEN), Rio de Janeiro, RJ (Brazil); Donato, Guilherme V.P. [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil)
2003-07-01
Risks of damages or even premature collapse of buried pipelines caused by their interaction with geologically unstable soils are well-established phenomena. Therefore, both monitoring and measurements of the actual loads transmitted by the soil to the pipeline are mandatory requirements, and define the necessity of developing new nondestructive techniques capable to carry out through evaluations of these loads in field. The aim of this paper has been placed on the presentation of a cutting-edge ultrasonic technology applied to stress measurements. To accomplish this purpose a series of ultrasonic tests were conducted on tensile specimens extracted from API 5L Grade X-65 steel pipe to determine its acoustic birefringence. The results have evidenced the acoustic birefringence to be a technique sufficiently consistent and, consequently, it shall be considered as a promising tool for the evaluation of the structural integrity of metallic structures in the near future. In addition, it was also observed that the use of this technique allows measuring the residual stress resulting from the pipe manufacturing process. (author)
GIANT API: an application programming interface for functional genomics.
Roberts, Andrew M; Wong, Aaron K; Fisk, Ian; Troyanskaya, Olga G
2016-07-08
GIANT API provides biomedical researchers programmatic access to tissue-specific and global networks in humans and model organisms, and associated tools, which includes functional re-prioritization of existing genome-wide association study (GWAS) data. Using tissue-specific interaction networks, researchers are able to predict relationships between genes specific to a tissue or cell lineage, identify the changing roles of genes across tissues and uncover disease-gene associations. Additionally, GIANT API enables computational tools like NetWAS, which leverages tissue-specific networks for re-prioritization of GWAS results. The web services covered by the API include 144 tissue-specific functional gene networks in human, global functional networks for human and six common model organisms and the NetWAS method. GIANT API conforms to the REST architecture, which makes it stateless, cacheable and highly scalable. It can be used by a diverse range of clients including web browsers, command terminals, programming languages and standalone apps for data analysis and visualization. The API is freely available for use at http://giant-api.princeton.edu. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.
3.5L V6 EcoBoost - democratization of sustainable engine technology
Energy Technology Data Exchange (ETDEWEB)
Kapp, Daniel; Schamel, Andreas; Hinds, Brett; Weaver, Corey [Ford Motor Co., Dearborn, MI (United States)
2008-07-01
The North American automotive industry is presently facing the challenge of a recently signed energy bill increasing corporate average fuel economy standards to 35 mpg (6.7 L/km) by 2020, inclusive of cars and trucks. The passing of this bill is coincident with crude oil costs hovering in the $130USD / barrel range, retail gasoline costs in the $4USD / gallon range, and mounting evidence on CO2 emissions and global warming. Ford Motor Company has anticipated these trends, has invested in the development of fuel efficient engine technologies, and is now deploying these technologies in volume to deliver both a meaningful and sustainable response to the above challenges. Leading the deployment curve is a technology publically announced as EcoBoost, representing the application of direct fuel injection and turbocharging to an advanced gasoline engine. Ford has previously reported the fundamentals of this technology which enables a significant fuel economy improvement via engine downsizing, and a significant performance improvement via engine dynamic response. As applied to 14 and V6 engine architectures, Ford has announced plans to deploy up to 750,000 EcoBoost engines worldwide by 2013 CY, with first application in the form of a 3.5L V6 EcoBoost engine in the 2010 MY Lincoln MKS luxury sedan. This paper summaries the development of the 3.5L V6 EcoBoost engine and its associated as-installed systems. Combustion, fuel, boost, and power conversion systems are discussed in detail with emphasis on the efficiency and value of these systems which enable a singular engine design to be applied across a wide range of applications. Engine performance and fuel economy assessments are also discussed and compared to conventional gasoline engines. (orig.)
Honeybee (Apis mellifera ligustica) drone embryo proteomes.
Li, Jianke; Fang, Yu; Zhang, Lan; Begna, Desalegn
2011-03-01
Little attention has been paid to the drone honeybee (Apis mellifera ligustica) which is a haploid individual carrying only the set of alleles that it inherits from its mother. Molecular mechanisms underlying drone embryogenesis are poorly understood. This study evaluated protein expression profiles of drone embryogenesis at embryonic ages of 24, 48 and 72h. More than 100 reproducible proteins were analyzed by mass spectrometry on 2D electrophoresis gels. Sixty-two proteins were significantly changed at the selected three experimental age points. Expression of the metabolic energy requirement-related protein peaked at the embryonic age of 48h, whereas development and metabolizing amino acid-related proteins expressed optimally at 72h. Cytoskeleton, protein folding and antioxidant-related proteins were highly expressed at 48 and 72h. Protein networks of the identified proteins were constructed and protein expressions were validated at the transcription level. This first proteomic study of drone embryogenesis in the honeybee may provide geneticists an exact timetable and candidate protein outline for further manipulations of drone stem cells. Crown Copyright © 2010. Published by Elsevier Ltd. All rights reserved.
ESMR/Nimbus-5 Level 1 Calibrated Brightness Temperature V001 (ESMRN5L1) at GES DISC
National Aeronautics and Space Administration — ESMRN5L1 is the Nimbus-5 Electrically Scanning Microwave Radiometer (ESMR) Level 1 Calibrated Brightness Temperature product and contains calibrated radiances...
Translation, validity and reliability of the British Sign Language (BSL) version of the EQ-5D-5L.
Rogers, Katherine D; Pilling, Mark; Davies, Linda; Belk, Rachel; Nassimi-Green, Catherine; Young, Alys
2016-07-01
To translate the health questionnaire EuroQol EQ-5D-5L into British Sign Language (BSL), to test its reliability with the signing Deaf population of BSL users in the UK and to validate its psychometric properties. The EQ-5D-5L BSL was developed following the international standard for translation required by EuroQol, with additional agreed features appropriate to a visual language. Data collection used an online platform to view the signed (BSL) version of the tests. The psychometric testing included content validity, assessed by interviewing a small sample of Deaf people. Reliability was tested by internal consistency of the items and test-retest, and convergent validity was assessed by determining how well EQ-5D-5L BSL correlates with CORE-10 BSL and CORE-6D BSL. The psychometric properties of the EQ-5D-5L BSL are good, indicating that it can be used to measure health status in the Deaf signing population in the UK. Convergent validity between EQ-5D-5L BSL and CORE-10 BSL and CORE-6D BSL is consistent, demonstrating that the BSL version of EQ-5D-5L is a good measure of the health status of an individual. The test-retest reliability of EQ-5D-5L BSL, for each dimension of health, was shown to have Cohen's kappa values of 0.47-0.61; these were in the range of moderate to good and were therefore acceptable. This is the first time EQ-5D-5L has been translated into a signed language for use with Deaf people and is a significant step forward towards conducting studies of health status and cost-effectiveness in this population.
Quality of life profile of general Vietnamese population using EQ-5D-5L.
Nguyen, Long Hoang; Tran, Bach Xuan; Hoang Le, Quynh Ngoc; Tran, Tung Thanh; Latkin, Carl A
2017-10-11
Health-related quality of life (HRQOL) is a vital benchmark to assess the effects of health interventions and policies. Measuring HRQOL of the general population is essential to establish a reference for health outcomes evaluations. However, evidence on HRQOL of general populations in low and middle income countries is very limited. This study aimed to measure HRQOL of the Vietnamese population by using the EuroQol-5 dimensions-5 levels (EQ-5D-5L) instrument and determine its associated factors. A cross-sectional study was performed in Hanoi with 1571 residences in Hanoi, the capital city of Vietnam. EQ-5D-5L and EQ- visual analogue scale (EQ-VAS) were used to assess HRQOL. Potential covariates included socio-demographic characteristics, having acute symptoms in the last four weeks, chronic diseases in the last three months, having multiple health issues, and health service utilisation in the last twelve months. A generalized linear model was employed to identify the association between HRQOL and covariates. Overall, the mean EQ-5D utility index was 0.91 (SD = 0.15), and the mean EQ-VAS score was 87.4 (SD = 14.3). The highest proportion of respondents reporting any problems was in Usual activities (24.3%), followed by Anxiety/Depression (15.2%) and Pain/Discomfort (10.0%), while the lowest percentage was in Self-care (2.5%). Lower HRQOL composite scores were related to unemployment, lower income, higher education, living in urban areas, having chronic diseases, having multiple health issues and using health service. For any health problem self-reported by respondents, the health utility reduced by 0.02 (respiratory diseases) to 0.15 (musculoskeletal diseases). Health utility of the general population and reductions for self-reported health problems in this study are useful for future population health evaluations and comparisons. It also informs the development of interventions to reduce health problems of the general population.
Quality of life profile and psychometric properties of the EQ-5D-5L in HIV/AIDS patients.
Tran, Bach Xuan; Ohinmaa, Arto; Nguyen, Long Thanh
2012-11-01
We assessed health-related quality of life (HRQOL), its associated factors, and examined measurement properties of the EuroQol - 5 Dimensions - 5 Levels (EQ-5D-5L) in HIV/AIDS patients. A cross-sectional multi-site survey was conducted in 1016 patients (age: 35.4 ± 7.0 years; 63.8% male) in three epicenters of Vietnam. Internal consistency reliability, convergent validity, and discriminative validity of the EQ-5D-5L and a visual analogue scale (VAS) were evaluated. Tobit censored regression models were used to identify predictors of HRQOL in HIV/AIDS patients. The mean EQ-5D-5L single index and VAS were 0.65 (95% Confidence Interval (CI) = 0.63; 0.67) and 70.3 (95% CI = 69.2; 71.5). Cronbach's alpha of five dimensions was 0.85. EQ-5D-5L has a good convergent validity with VAS (0.73). It discriminated patients at different HIV/AIDS stages, duration of ART, and CD4 cell count. Predictors of poorer HRQOL included being female, lower education level, unemployment, alcohol and drug use, CD4AIDS stages. The EQ-5D-5L has good measurement properties in HIV/AIDS patients and holds potentials for monitoring ART outcomes. Integration of HRQOL measurement using EQ-5D-5L in HIV/AIDS clinical practice could be helpful for economic evaluation of HIV/AIDS interventions.
Matthews, Clifford
2010-01-01
The API Individual Certification Programs (ICPs) are well established worldwide in the oil, gas, and petroleum industries. This Quick Guide is unique in providing simple, accessible and well-structured guidance for anyone studying the API 510 Certified Pressure Vessel Inspector syllabus by summarizing and helping them through the syllabus and providing multiple example questions and worked answers.Technical standards are referenced from the API 'body of knowledge' for the examination, i.e. API 510 Pressure vessel inspection, alteration, rerating; API 572 Pressure vessel inspection; API
Taponamiento cardíaco secundario a carcinoma papilar esclerosante difuso de tiroides
Directory of Open Access Journals (Sweden)
Verónica Riva
2011-12-01
Full Text Available El carcinoma papilar, variante esclerosante difusa, corresponde al 2% de todos los carcinomas papilares de la tiroides. Se caracteriza por comprometer de manera difusa y bilateral a la glándula tiroides. Clínicamente se manifiesta con metástasis ganglionares y pulmonares, afectando predominantemente a mujeres jóvenes. Se describe un caso de taponamiento cardíaco como presentación inicial de un carcinoma papilar de tiroides variante esclerosante difusa. Una mujer de 32 años concurrió al servicio de emergencias médicas refiriendo epigastralgia y tos seca. Durante el examen físico se constató hipotensión arterial, taquicardia y ruidos cardíacos disminuidos. Se realizó un ecocardiograma, observándose derrame pericárdico. Por medio de una pericardiocentesis se obtuvo líquido pericárdico, cuyo análisis mostró células neoplásicas. Durante la evolución la paciente presentó recurrencia del derrame pericárdico por lo que se realizó una ventana pleuropericárdica, detectándose durante la cirugía una lesión nodular subpleural, la cual fue biopsiada e informada posteriormente como una metástasis de carcinoma papilar vinculable a origen tiroideo. Se realizó una tiroidectomía total con linfadenectomía cervical bilateral. El diagnóstico final fue carcinoma papilar, variante esclerosante difusa. Esta variante infiltra el tejido conectivo de los espacios interfoliculares, simulando una tiroiditis y se caracteriza por una permeación vascular temprana. En oposición a la variante clásica, la esclerosante difusa presenta mayor agresividad y mayor tasa de recurrencia. El carcinoma papilar de tiroides debe tenerse presente como diagnóstico diferencial en nuestro medio, en todas aquellas lesiones neoplásicas papilares metastásicas, más aún si se trata de mujeres jóvenes.
Análise das complicações hospitalares relacionadas ao cateterismo cardíaco
Rossato,Géderson; de Quadros, Alexandre Schaan; Sarmento-Leite, Rogério; Gottschall, Carlos Antonio M.
2007-01-01
INTRODUÇÃO: As complicações relacionadas ao cateterismo cardíaco são os principais limitantes desta técnica, e podem variar desde eventos adversos leves e transitórios até eventos graves, como infarto do miocárdio ou morte. OBJETIVO: Avaliar a incidência de complicações imediatas do cateterismo cardíaco diagnóstico em adultos, conforme um modelo de categorização das complicações em tipo e gravidade. MÉTODO: Estudo de coorte prospectivo em um centro de referência. As características dos pacien...
Reabilitação e condicionamento físico após transplante cardíaco
Guilherme Veiga Guimarães; Fernando Bacal; Bocchi, Edimar A.
1999-01-01
Nas últimas décadas a prática regular de atividade física tem sido estimulada entre pessoas saudáveis e pacientes cardiopatas. Os programas de reabilitação cardíaca têm objetivos profiláticos e terapêuticos. Entretanto, existem poucos relatos de programas de reabilitação e condicionamento físico pós-transplante cardíaco no Brasil. O presente trabalho relata a experiência dos autores com pacientes pós-transplante cardíaco submetidos a programa de reabilitação física, na fase hospitalar e pós-a...
Haas, Christiane; Weber, Jost; Ludwig-Müller, Jutta; Deponte, Sandra; Bley, Thomas; Georgiev, Milen
2008-01-01
A cell suspension culture of sunflower (Helianthus annuus), a producer of immunologically active polysaccharides, was cultivated in a 5-L stirred tank bioreactor, operated in batch mode. After some changes in the internal bioreactor design a stable growth of Helianthus cells was achieved and the accumulated biomass reached 15.2 g/L (only approximately 5% lower compared to the accumulated biomass in shake-flasks). Flow cytometry used for measuring the cell cycle parameters of suspended Helianthus cells did not reveal significant differences between shake-flasks and bioreactor cultivation modes. For both cultivation methods significant enhancement of the percentage of S-phase cells was observed at the beginning of the cultivation process. Concerning the metabolite production the maximum in exopolysaccharides was reached at day 9 of the cultivation period (1.9 g/L), while the highest amounts of alpha-tocopherol were accumulated at the beginning of the cultivation process (day 2 of the cultivation). These finding were related to the respective stress levels caused by the inoculation procedure. The kinetic parameters of growth and polysaccharide production as well as the time course of carbon source utilization were monitored and discussed.
Liu, Zong-Yu; Jiang, Yi-Ping; Li, Lei; You, Lin-Lin; Wu, You; Xu, Bin; Ge, Lin-Quan; Wu, Jin-Cai
2016-03-01
The brown plant hopper (BPH), Nilaparvata lugens Stål (Hemiptera: Delphacidae), is a major pest affecting rice in Asia, and outbreaks of this pest are closely linked to pesticide-induced stimulation of reproduction. Therefore, the BPH is a classic example of a resurgent pest. However, the effects of different genes on the regulation of pesticide-induced reproductive stimulation in the BPH are unclear. In this study, the regulatory effects of acyl-coenzyme A oxidase (ACO) on the reproduction and biochemistry of the BPH were investigated with gene silencing. The number of eggs laid per female by triazophos (TZP)+dsACO BPH females was significantly lower than those of TZP-treated (without ACO silencing) or TZP+GFP females (negative control), with the number of eggs decreasing by 30.8% (from 529.5 to 366.3) and 32.0% (from 540.5 to 366.3), respectively. The preoviposition period, oviposition period, and longevity of the TZP-treated females were also influenced by dsACO treatment. Additionally, the amounts of crude fat, protein, and some fatty acids (oleic acid, palmitic acid, linoleic acid, stearic acid, and myristoleic acid) in TZP+dsACO females were significantly lower than in TZP-treated females. Thus, ACO is one of the key genes regulating the TZP-induced stimulation of reproduction in BPH females. Copyright © 2015 Elsevier Inc. All rights reserved.
Analisis Kinerja Operasional Kereta Api Sriwedari Ekspress Jurusan Solo - Yogya
Directory of Open Access Journals (Sweden)
Bayu Rosida Sumantri
2014-03-01
Full Text Available Pada bulan Nopember 2012 PT. Kereta Api Indonesia (Persero DAOP 6 Yogyakarta mengoperasikan Kereta Api Sriwedari Ekspress dengan rute perjalanan Yogya – Solo, hal ini dilakukan untuk mengantisipasi lonjakan penumpang akibat pemangkasan rute perjalanan Kereta Api Prambanan Ekspress dari tiga belas kali perjalanan menjadi enam kali perjalanan. Menurut Humas PT. Kereta Api Indonesia (Persero DAOP 6 Yogyakarta, dibukanya rute baru Kereta Api Sriwedari Ekspress yang melayani delapan kali perjalanan hanya dengan rute Yogya – Solo saja diharapkan kereta ini dapat memfasilitasi pergerakan penumpang antar dua daerah tersebut. Namun untuk mengetahui kinerja dari kereta api ini sesuai dengan Surat Keterangan Dirjen Perhubungan Darat No. 687 Tahun 2002, perlu ditinjau dari segi faktor muat, jumlah penumpang yang diangkut, waktu tunggu penumpang, ketepatan waktu kedatangan dan keberangkatan kereta dan kenyamanan penumpang. Dalam penelitian digunakan metode survey untuk mendapatkan nilai – nilai dari kinerja kereta api Sriwedari berupa survey observasi atau pengamatan lapangan. Adapun analisis yang digunakan untuk perhitungan waktu tempuh, waktu henti dan waktu tunda menggunakan uji hipotesis 1 sample t-test, karena uji ini paling memenuhi untuk melihat diterima atau tidaknya keterlambatan dari waktu kereta. Sedangkan untuk perhitungan load factor dan kenyamanan duduk dan berdiri berdasarkan perhitungan kapasitas dari Vukan R. Vuchic. Dari hasil analisis didapatkan waktu tempuh rata-rata untuk arah Yogyakarta selama 1 jam 14 menit dan untuk arah Solo selama 1 jam 12 menit. Waktu henti yang didapat dari seluruh jadwal perjalanan kereta arah Yogyakarta sebesar 3 menit, untuk arah Solo sebesar 5 menit. Waktu tunda dari seluruh perjalanan kereta Api Sriwedari untuk arah Yogyakarta didapat nilai waktu tunda kedatangan sebesar 22 menit dan nilai waktu tunda keberangkatan sebesar 20 menit, untuk arah Solo didapat nilai waktu tunda kedatangan sebesar 34
Aleteo auricular postrasplante cardíaco tratado exitosamente mediante ablación por catéter
Directory of Open Access Journals (Sweden)
Carlos López
2009-01-01
Full Text Available RESUMENEl desarrollo de arritmias supraventriculares es un hallazgo frecuente en el seguimiento depacientes sometidos a trasplante cardíaco. La ablación por radiofrecuencia del aleteo auricularha demostrado que es el tratamiento de elección en pacientes con cardiopatía subyacentey sin ella, en tanto que son escasas las comunicaciones en la bibliografía acerca de sueficacia postrasplante cardíaco.En esta presentación se describe el caso de un paciente de 26 años con antecedente detrasplante cardíaco que presentó aleteo auricular en la evolución. En el estudio electrofisiológico se observó un aleteo auricular típico antihorario dependiente del istmo en laaurícula derecha del donante. La aurícula derecha del receptor se encontraba disociada, enritmo sinusal. Durante la aplicación de radiofrecuencia en el istmo a la altura de la línea desutura auriculoauricular derecha se observó la interrupción del aleteo. Ambas aurículasderechas quedaron en ritmo sinusal, disociadas por bloqueo bidireccional a nivel de la anastomosis.REV ARGENT CARDIOL 2009;77:408-410.
Thermodynamic phase behavior of API/polymer solid dispersions.
Prudic, Anke; Ji, Yuanhui; Sadowski, Gabriele
2014-07-07
To improve the bioavailability of poorly soluble active pharmaceutical ingredients (APIs), these materials are often integrated into a polymer matrix that acts as a carrier. The resulting mixture is called a solid dispersion. In this work, the phase behaviors of solid dispersions were investigated as a function of the API as well as of the type and molecular weight of the carrier polymer. Specifically, the solubility of artemisinin and indomethacin was measured in different poly(ethylene glycol)s (PEG 400, PEG 6000, and PEG 35000). The measured solubility data and the solubility of sulfonamides in poly(vinylpyrrolidone) (PVP) K10 and PEG 35000 were modeled using the perturbed-chain statistical associating fluid theory (PC-SAFT). The results show that PC-SAFT predictions are in a good accordance with the experimental data, and PC-SAFT can be used to predict the whole phase diagram of an API/polymer solid dispersion as a function of the kind of API and polymer and of the polymer's molecular weight. This remarkably simplifies the screening process for suitable API/polymer combinations.
A knowledge discovery object model API for Java
Directory of Open Access Journals (Sweden)
Jones Steven JM
2003-10-01
Full Text Available Abstract Background Biological data resources have become heterogeneous and derive from multiple sources. This introduces challenges in the management and utilization of this data in software development. Although efforts are underway to create a standard format for the transmission and storage of biological data, this objective has yet to be fully realized. Results This work describes an application programming interface (API that provides a framework for developing an effective biological knowledge ontology for Java-based software projects. The API provides a robust framework for the data acquisition and management needs of an ontology implementation. In addition, the API contains classes to assist in creating GUIs to represent this data visually. Conclusions The Knowledge Discovery Object Model (KDOM API is particularly useful for medium to large applications, or for a number of smaller software projects with common characteristics or objectives. KDOM can be coupled effectively with other biologically relevant APIs and classes. Source code, libraries, documentation and examples are available at http://www.bcgsc.ca/bioinfo/software.
O estupor melancólico e o estupor maníaco
Directory of Open Access Journals (Sweden)
Rubens Coura
Full Text Available O Estupor Melancólico e o Estupor Maníaco são quadros clínicos das mais completas apatia e inibição motora, hoje tornados raros devido às intervenções psiquiátricas. Eles parecem corresponder aos pontos da máxima pressão possível da pulsão de morte: dirigida, respectivamente, contra o próprio Eu e contra os objetos – naquele sujeito e naquele período de sua vida. Sendo então o estado clínico do ponto intransponível de toda melancolia e de toda mania, esses dois estupores devem compor um verdadeiro elo perdido entre a melancolia e a mania, para a psicanálise. Se a relíquia de Pierre Fédida é, no luto, o fragmento de permanência daquilo que morreu, o autor propõe a romaria do sujeito ao seu tesourinho de criança como uma imagem regressiva apropriada à melancolia e à mania.
Ant Colony Optimization ACO For The Traveling Salesman Problem TSP Using Partitioning
Directory of Open Access Journals (Sweden)
Alok Bajpai
2015-08-01
Full Text Available Abstract An ant colony optimization is a technique which was introduced in 1990s and which can be applied to a variety of discrete combinatorial optimization problem and to continuous optimization. The ACO algorithm is simulated with the foraging behavior of the real ants to find the incremental solution constructions and to realize a pheromone laying-and-following mechanism. This pheromone is the indirect communication among the ants. In this paper we introduces the partitioning technique based on the divide and conquer strategy for the traveling salesman problem which is one of the most important combinatorial problem in which the original problem is partitioned into the group of sub problems. And then we apply the ant colony algorithm using candidate list strategy for each smaller sub problems. After that by applying the local optimization and combining the sub problems to find the good solution for the original problem by improving the exploration efficiency of the ants. At the end of this paper we have also be presented the comparison of result with the normal ant colony system for finding the optimal solution to the traveling salesman problem.
Martín-Hernández, Raquel; Botías, Cristina; Barrios, Laura; Martínez-Salvador, Amparo; Meana, Aránzazu; Mayack, Christopher; Higes, Mariano
2011-09-01
Nosema ceranae is a relatively new and widespread parasite of the western honeybee Apis mellifera that provokes a new form of nosemosis. In comparison to Nosema apis, which has been infecting the honeybee for much longer, N. ceranae seems to have co-evolved less with this host, causing a more virulent disease. Given that N. apis and N. ceranae are obligate intracellular microsporidian parasites, needing host energy to reproduce, energetic stress may be an important factor contributing to the increased virulence observed. Through feeding experiments on caged bees, we show that both mortality and sugar syrup consumption were higher in N. ceranae-infected bees than in N. apis-infected and control bees. The mortality and sugar syrup consumption are also higher in N. apis-infected bees than in controls, but are less than in N. ceranae-infected bees. With both microsporidia, mortality and sugar syrup consumption increased in function of the increasing spore counts administered for infection. The differences in energetic requirements between both Nosema spp. confirm that their metabolic patterns are not the same, which may depend critically on host-parasite interactions and, ultimately, on host pathology. The repercussions of this increased energetic stress may even explain the changes in host behavior due to starvation, lack of thermoregulatory capacity, or higher rates of trophallaxis, which might enhance transmission and bee death.
Nosema ceranae in drone honey bees (Apis mellifera).
Traver, Brenna E; Fell, Richard D
2011-07-01
Nosema ceranae is a microsporidian intracellular parasite of honey bees, Apis mellifera. Previously Nosema apis was thought to be the only cause of nosemosis, but it has recently been proposed that N. ceranae is displacing N. apis. The rapid spread of N. ceranae could be due to additional transmission mechanisms, as well as higher infectivity. We analyzed drones for N. ceranae infections using duplex qPCR with species specific primers and probes. We found that both immature and mature drones are infected with N. ceranae at low levels. This is the first report detecting N. ceranae in immature bees. Our data suggest that because drones are known to drift from their parent hives to other hives, they could provide a means for disease spread within and between apiaries. Copyright © 2011 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Voigt Kathrin
2015-06-01
Full Text Available The value of propolis as a disinfectant agent in the bee hive is considerable. We investigated the fungistatic effect of cinnamic acid and pinocembrin on the pathogen Ascosphaera apis causing chalkbrood disease in bee colonies in the laboratory with an agar diffusion test on malt extract agar. The minimal fungicide inhibitory concentration was 0.5% for cinnamic acid and 1.5% for pinocembrin (MIC -values. Both substances were tested by individual application for adult bee tolerance in a range of dosages and for brood tolerance (L1 - L5 referring to the MIC values. The dermal toxicity of adult bees for cinnamic acid and pinocembrin was low, a maximum of 3.3% even in the highest dosage of 1000 μg (concentration 20% and 250 μg (concentration 5% per bee, respectively. The mortality rates showed no significant differences to the controls (z-test, p≤0.05. First results on brood tolerability after application of test substances resulted in larval mortality but primarily in the group of young larvae. The mortality reduced simultaneous with the increasing larval weight. The total larval mortality 72 hours after the application over all stages was 28.7% for cinnamic acid and 13.1% for pinocembrin (positive control group 24.8%; negative control group 15.4%. The test groups showed no significant increased mortality compared to the control groups (z-test, p≥0.05. Both substances have in vitro fungicide potential and can be considered as potential active agents against A. apis in honey bee drugs. The results provide high tolerance of adult bees and an indication for larval tolerability most notably in elder larvae.
Integration of Experience API Into CDET’s E-Learning
2016-06-01
EXPERIENCE API INTO CDET’S E- LEARNING by Clayton C. MacAloney June 2016 Thesis Advisor: Man-Tak Shing Co-Advisor: Arijit Das THIS PAGE...thesis 4. TITLE AND SUBTITLE INTEGRATION OF EXPERIENCE API INTO CDET’S E-LEARNING 5. FUNDING NUMBERS 6. AUTHOR(S) Clayton C. MacAloney 7...Education and Training (CDET) looking at Experience API (xAPI) for ways to improve the accessibility, effectiveness, and efficiency of the educational
Application of Skype API to Control Working Time
Directory of Open Access Journals (Sweden)
Julian Vasilev
2013-11-01
Full Text Available The purpose of this article is to present an innovative approach to monitor and control working time. A special software program is developed by Delphi implementing Skype API functions. This article shows three different approaches to control working time using the Skype_API program. It automatically detects when an employee goes to his working place and when he leaves work. Moreover it can check periodically weather an employee is at work. The proposed ideas are written for the first time. They may be applied easily in many enterprises with very low costs.
Unified Lightweight Semantic Descriptions of Web APIs and Web Services
Pedrinaci, Carlos; Kopecký, Jacek; Maleshkova, Maria; Liu, Dong; Li, Ning; Domingue, John
2011-01-01
Recently, Linked Data and Web APIs have emerged as the preferred means of exposing data and Web application functionality. In this paper we argue that service systems should be adapted in the light of both trends. In particular we believe that i) common means for discovering and interacting with Web services and Web APIs are necessary, and that ii) we should bridge the gap between services and linked data both by supporting the publication of services as linked data and by enabling the proces...
On the reaction to deprecation of clients of 4 + 1 popular Java APIs and the JDK
Sawant, A.A.; Robbes, Romain; Bacchelli, A.
2017-01-01
Application Programming Interfaces (APIs) are a tremendous resource—that is, when they are stable. Several studies have shown that this is unfortunately not the case. Of those, a large-scale study of API changes in the Pharo Smalltalk ecosystem documented several findings about API deprecations
Quality of life profile and psychometric properties of the EQ-5D-5L in HIV/AIDS patients
Directory of Open Access Journals (Sweden)
Tran Bach
2012-11-01
Full Text Available Abstract Objectives We assessed health-related quality of life (HRQOL, its associated factors, and examined measurement properties of the EuroQol - 5 Dimensions - 5 Levels (EQ-5D-5L in HIV/AIDS patients. Methods A cross-sectional multi-site survey was conducted in 1016 patients (age: 35.4 ± 7.0 years; 63.8% male in three epicenters of Vietnam. Internal consistency reliability, convergent validity, and discriminative validity of the EQ-5D-5L and a visual analogue scale (VAS were evaluated. Tobit censored regression models were used to identify predictors of HRQOL in HIV/AIDS patients. Results The mean EQ-5D-5L single index and VAS were 0.65 (95% Confidence Interval (CI = 0.63; 0.67 and 70.3 (95% CI = 69.2; 71.5. Cronbach’s alpha of five dimensions was 0.85. EQ-5D-5L has a good convergent validity with VAS (0.73. It discriminated patients at different HIV/AIDS stages, duration of ART, and CD4 cell count. Predictors of poorer HRQOL included being female, lower education level, unemployment, alcohol and drug use, CD4 Conclusion The EQ-5D-5L has good measurement properties in HIV/AIDS patients and holds potentials for monitoring ART outcomes. Integration of HRQOL measurement using EQ-5D-5L in HIV/AIDS clinical practice could be helpful for economic evaluation of HIV/AIDS interventions.
Association of Immune and Metabolic Receptors C5aR and C5L2 with Adiposity in Women
Directory of Open Access Journals (Sweden)
Pegah Poursharifi
2014-01-01
Full Text Available Adipose tissue receptors C5aR and C5L2 and their heterodimerization/functionality and interaction with ligands C5a and acylation stimulating protein (ASP have been evaluated in cell and rodent studies. Their contribution to obesity factors in humans remains unclear. We hypothesized that C5a receptors, classically required for host defense, are also associated with adiposity. Anthropometry and fasting blood parameters were measured in 136 women divided by body mass index (BMI: normal/overweight (≤30 kg/m2; n = 34, obese I (≤45 kg/m2; n = 33, obese II (≤51 kg/m2; n = 33, and obese III (≤80 kg/m2; n = 36. Subcutaneous and omental adipose tissue C5aR and C5L2 expression were analysed. C5L2 expression was comparable between subcutaneous and omental across all BMI groups. Plasma ASP and ASP/omental C5L2 expression increased with BMI (P < 0.001 and P < 0.01, resp.. While plasma C5a was unchanged, C5aR expression decreased with increasing BMI in subcutaneous and omental tissues (P < 0.01 and P < 0.05, resp., with subcutaneous omental depots. Omental C5L2/C5aR ratio increased with BMI (P < 0.01 with correlations between C5L2/C5aR and waist circumference, HDL-C, and adiponectin. Tissue and BMI differences in receptors and ligands, particularly in omental, suggest relationship to metabolic disturbances and highlight adipose-immune interactions.
Comparing responsiveness of the EQ-5D-5L, EQ-5D-3L and EQ VAS in stroke patients.
Golicki, Dominik; Niewada, Maciej; Karlińska, Anna; Buczek, Julia; Kobayashi, Adam; Janssen, M F; Pickard, A Simon
2015-06-01
To date, evidence to support the construct validity of the EQ-5D-5L has primarily focused on cross-sectional data. The aims of this study were to examine the responsiveness of EQ-5D-5L in patients with stroke and to compare it with responsiveness of EQ-5D-3L and visual analogue scale (EQ VAS). We performed an observational longitudinal cohort study of patients with stroke. At 1 week and 4 months post-stroke, patients were assessed with modified Rankin Scale (mRS) and Barthel Index (BI) and were administered the EQ-5D-5L and EQ-5D-3L, including the EQ VAS. The EQ-5D-5L index scores were derived using the crosswalk methodology developed by the EuroQol Group. We classified patients according to two external criteria, based on mRS or BI, into 3 categories: 'improvement,' 'stable' or 'deterioration'. We assessed the responsiveness of each measure in each patient subgroup using: effect size (ES), standardized response mean (SRM), F-statistic, relative efficiency and area under the receiver operating characteristic curve. A total of 112 patients (52% females; mean age 70.6 years; 93% ischemic stroke) completed all the instruments at both occasions. In subjects with clinical improvement, EQ-5D-5L was consistently responsive, showing moderate ES (0.51-0.71) and moderate to large SRM (0.69-0.86). In general, EQ-5D-3L index appeared to be more responsive (ES 0.63-0.82; SRM 0.77-1.06) and EQ VAS less responsive (ES 0.51-0.65; SRM 0.59-0.69) than EQ-5D-5L index. The EQ-5D-5L index, based on the crosswalk value set, seems to be appropriately responsive in patients with stroke, 4 months after disease onset. As far as EQ-5D-5L index is scored according to crosswalk approach, the EQ-5D-3L index appears to be more responsive in stroke population.
THE ROLE OF THE N-TERMINAL DOMAIN OF THE COMPLEMENT FRAGMENT RECEPTOR, C5L2, IN LIGAND BINDING
Scola, Anne-Marie; Higginbottom, Adrian; Lynda J Partridge; Reid, Robert C.; Woodruff, Trent; Taylor, Stephen M.; Fairlie, David P.; Monk, Peter N.
2006-01-01
C5L2 is a new cellular receptor found to interact with the human anaphylatoxins complement factor C5a and its C-terminal cleavage product C5a des Arg. The classical human C5a receptor (C5aR) preferentially binds C5a, with a 10-100-fold lower affinity for C5a des Arg. In contrast, C5L2 binds both ligands with nearly equal affinity. C5aR presents acidic and tyrosine residues in its N-terminus that interact with the core of C5a while a hydrophobic pocket formed by the transmembrane helices inter...
Tumores cardíacos: 10 anos de experiência
Directory of Open Access Journals (Sweden)
Antônio Augusto MIANA
1997-01-01
Full Text Available Objetivo: Avaliar a experiência cirúrgica do grupo no tratamento dos tumores cardíacos durante o período de janeiro de 1985 a dezembro de 1994. Casuística e Métodos: De um total de 2268 cirurgias cardíacas com circulação extracorpórea realizadas neste período de 10 anos, 6 foram para extirpação de tumores intracavitários, perfazendo 0,26% dos casos. Destes, 3 eram mixomas de átrio esquerdo, 1 fibroelastoma papilar de valva mitral, 1 rabdomioma de ventrículo esquerdo e 1 fibroma de ventrículo esquerdo. A forma clínica de apresentação foi embolia sistêmica (3 casos ou insuficiência cardíaca (3 casos. O diagnóstico foi ecocardiográfico (5 casos e angiográfico (6 casos. Resultados: Todos os pacientes tiveram evolução imediata favorável, exceto 1 deles, com mixoma de átrio equerdo, que evoluiu com mediastinite e septicemia, vindo a falecer e constituindo o único óbito hospitalar. O seguimento pós-operatório tardio, obtido em 4 pacientes (15 a 111 meses - média 49 ± 36,8 meses, não detectou qualquer recidiva, encontrando-se todos em classe funcional I (NYHA. Conclusões: Os autores concluem que os tumores cardíacos são bastante raros, de fácil diagnóstico desde que considerados, na grande maioria benignos e que cursam favoravelmente com a extirpação cirúrgica.Purpose: To review the surgical experience of our group in the treatment of primary cardiac tumors, during a 10 year period beginning January 1985 till December 1994. Material and Methods: From a total of 2268 cardiac surgeries with the aid of extracorporeal circulation performed during this 10 year period, there were 6 cases of intracavitary tumor resection, an incidence of 0.26%. Three were myxomas of the left atrium, 1 papillary fibroelastoma of the mitral valve, 1 rhabdomyoma of the left ventricule and 1 fibroma of the left ventricle. Three patients presented systemic embolism and the other three congestive heart failure. The diagnosis was confirmed
Transplante cardíaco humano: experiência inicial Human cardiac transplant: initial experience
Directory of Open Access Journals (Sweden)
Noedir A. G Stolf
1986-12-01
Full Text Available No Instituto do Coração, de março de 1985 a fevereiro de 1986,11 pacientes foram submetidos a transplante cardíaco ortotópico. Eram todos do sexo masculino, com idade variando de 39 a 54 anos; 6 com cardiopatia isquémica, 4 com cardiomiopatia dilatada e um com cardiomiopatia chagásica. Foi realizado estudo hemodinâmico através de catéter de Swan-Ganz, no pré-operatório, no pós-operatório, após estabilização na unidade de recuperação, e trinta ou mais dias após o transplante. Os dados mostram melhora progressiva em relação ao índice cardíaco, pressão em artéria pulmonar, pressão de capilar pulmonar, resistência vascular pulmonar e resistência vascular sistêmica. Três dos 11 pacientes apresentaram disfunção renal transitória no pós-operatório imediato e que regrediram até o 15º dia, enquanto que 2 pacientes apresentaram aumento moderado da creatinina plasmática. Apenas 3 pacientes não apresentaram qualquer episódio de rejeição; nos demais, esses episódios foram um diagnóstico histológico sem repercussões clínicas. Complicações infecciosas ocorreram em 9 pacientes e foram de fácil controle clínico. No pós-operatório tardio, a hipertensão esteve presente em 8 pacientes, sendo mais acentuada em 2 deles. Não houve óbitos, nesta série de pacientes; todos estão assintomáticos e os 6 primeiros estão trabalhando.At the Instituto do Cora��ão, University of São Paulo Medical School, 11 patients were submitted to heart transplantation from march 1985 up to february 1986. All were male, with ages of 39-59 years, 6 with coronary heart disease, 4 with dilated cardiomyopathy and 1 with Chagas cardiomyopathy. The patients were studied hemodynamically with a Swan-Ganz catheter pre-operatively, at the arrival in the intensive care unit, in the first postoperative day and 30 or more days after the transplant. The data showed that there was a progressive increase of cardiac index and decreases of
Changes in oxidative stress in transgenic RNAi ACO1 tomato fruit during ripening
Eglous, Najat Mohamed; Ali, Zainon Mohd; Hassan, Maizom; Zainal, Zamri
2013-11-01
Tomato (Solanum Lycopersicum L.) is the second most cultivated vegetable in the world and widely used as a system for studying the role of ethylene during fruit ripening. Our objective was to study the oxidative stress and antioxidative metabolism during ripening of non transgenic tomato and transgenic line-21 tomato which reduced ethylene. The line-21 of transgenic tomato plants (RNAi ACO1) had lower ethylene production and longer shelf-life more than 32 days as compared to the wild-type fruits which have very short shelf-life. In this study, tomato fruit were divided into five different stages (MG: mature green 5%, B: breaker 25%, T: turning 50%, O: orange75%, RR: red ripe100%). The activity of lipoxygenase (LOX) and lipid peroxidation (MDA) were measured to assess changes in oxidative stress. The LOX activity and MDA content decreased significantly obtaining 2.6-fold and 1.2-fold, respectively, as compared to the wild type fruit. However, superoxide dismutase (SOD) and catalase (CAT) activities were increased to 1.9 and 1.2 folds from the mature green to the fully ripe stage in transgenic tomatoes. Furthermore, the wild type tomato increases 1.3 in SOD and 1.6 in CAT activities. The overall results indicate that the wild type tomato fruit showed a faster rate of ripening, parallel to decline in the rate of enzymatic antioxidative systems as compared to the transgenic line-21 tomato fruit. In addition, the results show that the antioxidant capacity is improved during the ripening process and is accompanied by an increase in the oxidative stress.
PrismTech Data Distribution Service Java API Evaluation
Riggs, Cortney
2008-01-01
My internship duties with Launch Control Systems required me to start performance testing of an Object Management Group's (OMG) Data Distribution Service (DDS) specification implementation by PrismTech Limited through the Java programming language application programming interface (API). DDS is a networking middleware for Real-Time Data Distribution. The performance testing involves latency, redundant publishers, extended duration, redundant failover, and read performance. Time constraints allowed only for a data throughput test. I have designed the testing applications to perform all performance tests when time is allowed. Performance evaluation data such as megabits per second and central processing unit (CPU) time consumption were not easily attainable through the Java programming language; they required new methods and classes created in the test applications. Evaluation of this product showed the rate that data can be sent across the network. Performance rates are better on Linux platforms than AIX and Sun platforms. Compared to previous C++ programming language API, the performance evaluation also shows the language differences for the implementation. The Java API of the DDS has a lower throughput performance than the C++ API.
Effects of honeybee ( Apis mellifera ) pollination on seed set in ...
African Journals Online (AJOL)
This study was carried out to determine the efficiency of pollination with honeybee (Apis mellifera) on sunflower hybrid seed production under different types of pollination during 2005 and 2006 in Mustafakemalpasa-Bursa, Turkey. Three pollination types (1) in cages with honeybees, (2) hand pollination (in cages) and (3) in ...
Enzymatic activities of Dermatophilus congolensis measured by API ZYM.
Hermoso de Mendoza, J; Arenas, A; Alonso, J M; Rey, J M; Gil, M C; Anton, J M; Hermoso de Mendoza, M
1993-10-01
API ZYM kit was used to test enzymatic activities on eighteen strains of Dermatophilus congolensis. All strains produced lipase and acid phosphatase, which act on lipids, and leucine arylamidase which act on proteins. Another 10 exoenzymes were present in at least one of the strains.
The MPO API: A tool for recording scientific workflows
Energy Technology Data Exchange (ETDEWEB)
Wright, John C., E-mail: jcwright@mit.edu [MIT Plasma Science and Fusion Center, Cambridge, MA (United States); Greenwald, Martin; Stillerman, Joshua [MIT Plasma Science and Fusion Center, Cambridge, MA (United States); Abla, Gheni; Chanthavong, Bobby; Flanagan, Sean; Schissel, David; Lee, Xia [General Atomics, San Diego, CA (United States); Romosan, Alex; Shoshani, Arie [Lawrence Berkeley Laboratory, Berkeley, CA (United States)
2014-05-15
Highlights: • A description of a new framework and tool for recording scientific workflows, especially those resulting from simulation and analysis. • An explanation of the underlying technologies used to implement this web based tool. • Several examples of using the tool. - Abstract: Data from large-scale experiments and extreme-scale computing is expensive to produce and may be used for high-consequence applications. The Metadata, Provenance and Ontology (MPO) project builds on previous work [M. Greenwald, Fusion Eng. Des. 87 (2012) 2205–2208] and is focused on providing documentation of workflows, data provenance and the ability to data-mine large sets of results. While there are important design and development aspects to the data structures and user interfaces, we concern ourselves in this paper with the application programming interface (API) – the set of functions that interface with the data server. Our approach for the data server is to follow the Representational State Transfer (RESTful) software architecture style for client–server communication. At its core, the API uses the POST and GET methods of the HTTP protocol to transfer workflow information in message bodies to targets specified in the URL to and from the database via a web server. Higher level API calls are built upon this core API. This design facilitates implementation on different platforms and in different languages and is robust to changes in the underlying technologies used. The command line client implementation can communicate with the data server from any machine with HTTP access.
One implementation of API interface for RouterOS
Directory of Open Access Journals (Sweden)
Gencho Stoitsov
2014-05-01
Full Text Available The purpose of this publication is to present the implementation of API interface for RouterOS of the company MikroTik, which allows using PHP scripts for obtaining data for configuration and management of the routing devices that use this OS.
(DWV) in honeybees (Apis mellifera L.) and mite
African Journals Online (AJOL)
STORAGESEVER
2009-08-18
Aug 18, 2009 ... the most common honey bee viruses transmitted by the parasitic mite Varroa destructor during pupal stages, and is associated with ... Key words: Apis mellifera, deformed wing virus, honeybee viruses, Varroa destructor, RT-PCR, Ordu, Turkey. .... In all tests ddH2O used as negative control. PCR products of ...
Nosema Tolerant Honeybees (Apis mellifera) Escape Parasitic Manipulation of Apoptosis
DEFF Research Database (Denmark)
Kurze, Christoph; Le Conte, Yves; Dussaubat, Claudia
2015-01-01
conducted three inoculation experiments to investigate in the apoptotic respond during infection with the intracellular gut pathogen Nosema ceranae, which is considered as potential global threat to the honeybee (Apis mellifera) and other bee pollinators, in sensitive and tolerant honeybees. To explore...
Using PAT to accelerate the transition to continuous API manufacturing
DEFF Research Database (Denmark)
de Gouveia, Maria Francisca Dias Folque; Rahbek, Jesper P.; Mortensen, Asmus R.
2017-01-01
the following: speeding up the design of the continuous process and a better understanding of the manufacturing requirements to ensure optimal yield and avoid unreacted raw materials and by-products in the continuous reactor effluent. Graphical Abstract Using PAT to accelerate the transition to continuous API...
Studies on the life cycle and morphometrics of honeybees, Apis ...
African Journals Online (AJOL)
The life cycle of the honeybee, Apis mellifera adansonii, was studied in mangrove area by monitoring the developmental stages and morphology of the castes. It was observed that the fate of the eggs were predetermined at the onset leading to drones, queens or workers. It was also established that the three different castes ...
Biophysics of the subgenual organ of the honeybee, Apis mellifera
DEFF Research Database (Denmark)
Kilpinen, Ole; Storm, Jesper
1997-01-01
The subgenual organ of the honeybee (Apis mellifera) is suspended in a haemolymph channel in the tibia of each leg. When the leg is accelerated, inertia causes the haemolymph (and the subgenual organ) to lag behind the movement of the rest of the leg. The magnitude of this phase lag determines...
Sperm use economy of honeybee (Apis mellifera) queens
DEFF Research Database (Denmark)
Baer, Boris; Collins, Jason; Maalaps, Kristiina
2016-01-01
the fecundity and longevity of queens and therefore colony fitness. We quantified the number of sperm that honeybee (Apis mellifera) queens use to fertilize eggs. We examined sperm use in naturally mated queens of different ages and in queens artificially inseminated with different volumes of semen. We found...
Pathogen detection and gut bacteria identification in Apis cerana ...
African Journals Online (AJOL)
Pathogen infection of honeybees can lead to economic losses in apiculture. The earlier the pathogen contamination can be found the better it will likely be for the treatment of the infected colony and prevention of the spread of the pathogen within and between colonies. A total of 50 colonies of Apis cerana were sampled in ...
Physical stability of API/polymer-blend amorphous solid dispersions.
Lehmkemper, Kristin; Kyeremateng, Samuel O; Bartels, Mareike; Degenhardt, Matthias; Sadowski, Gabriele
2018-03-01
The preparation of amorphous solid dispersions (ASDs) is a well-established strategy for formulating active pharmaceutical ingredients by embedding them in excipients, usually amorphous polymers. Different polymers can be combined for designing ASDs with desired properties like an optimized dissolution behavior. One important criterion for the development of ASD compositions is the physical stability. In this work, the physical stability of API/polymer-blend ASDs was investigated by thermodynamic modeling and stability studies. Amorphous naproxen (NAP) and acetaminophen (APAP) were embedded in blends of hydroxypropyl methylcellulose acetate succinate (HPMCAS) and either poly(vinylpyrrolidone) (PVP) or poly(vinylpyrrolidone-co-vinyl acetate) (PVPVA64). Parameters for modeling the API solubility in the blends and the glass-transition temperature curves of the water-free systems with Perturbed-Chain Statistical Associating Fluid Theory and Kwei equation, respectively, were correlated to experimental data. The phase behavior for standardized storage conditions (0%, 60% and 75% relative humidity (RH)) was predicted and compared to six months-long stability studies. According to modeling and experimental results, the physical stability was reduced with increasing HPMCAS content and increasing RH. This trend was observed for all investigated systems, with both APIs (NAP and APAP) and both polymer blends (PVP/HPMCAS and PVPVA64/HPMCAS). PC-SAFT and the Kwei equation turned out to be suitable tools for modeling and predicting the physical stability of the investigated API/polymer-blends ASDs. Copyright © 2017 Elsevier B.V. All rights reserved.
The Proteins API: accessing key integrated protein and genome information.
Nightingale, Andrew; Antunes, Ricardo; Alpi, Emanuele; Bursteinas, Borisas; Gonzales, Leonardo; Liu, Wudong; Luo, Jie; Qi, Guoying; Turner, Edd; Martin, Maria
2017-07-03
The Proteins API provides searching and programmatic access to protein and associated genomics data such as curated protein sequence positional annotations from UniProtKB, as well as mapped variation and proteomics data from large scale data sources (LSS). Using the coordinates service, researchers are able to retrieve the genomic sequence coordinates for proteins in UniProtKB. This, the LSS genomics and proteomics data for UniProt proteins is programmatically only available through this service. A Swagger UI has been implemented to provide documentation, an interface for users, with little or no programming experience, to 'talk' to the services to quickly and easily formulate queries with the services and obtain dynamically generated source code for popular programming languages, such as Java, Perl, Python and Ruby. Search results are returned as standard JSON, XML or GFF data objects. The Proteins API is a scalable, reliable, fast, easy to use RESTful services that provides a broad protein information resource for users to ask questions based upon their field of expertise and allowing them to gain an integrated overview of protein annotations available to aid their knowledge gain on proteins in biological processes. The Proteins API is available at (http://www.ebi.ac.uk/proteins/api/doc). © The Author(s) 2017. Published by Oxford University Press on behalf of Nucleic Acids Research.
Modelling the subgenual organ of the honeybee, Apis mellifera
DEFF Research Database (Denmark)
Storm, Jesper; Kilpinen, Ole
1998-01-01
In a recent study on the honeybee (Apis mellifera), the subgenual organ was observed moving inside the leg during sinusoidal vibrations of the leg (Kilpinen and Storm 1997). The subgenual organ of the honeybee is suspended in a haemolymph channel in the tibia of each leg. When the leg accelerates...
Improving honey production in worker bees (Apis mellifera adansoni ...
African Journals Online (AJOL)
Modification of feeding activity, nursing care and undertaker behaviour were carried out among some colonies of honey bees Apis mellifera adansoni L to know the effect on honey production. Apiaries Numbers 1, 2 and 3 contain three replicates of experimental hives while apiary Number 4 contains control hives. All the ...
Standard methods for research on apis mellifera gut symbionts
Gut microbes can play an important role in digestion, disease resistance, and the general health of animals, but little is known about the biology of gut symbionts in Apis mellifera. This paper is part of a series on honey bee research methods, providing protocols for studying gut symbionts. We desc...
JASPAR RESTful API: accessing JASPAR data from any programming language.
Khan, Aziz; Mathelier, Anthony
2017-12-15
JASPAR is a widely used open-access database of curated, non-redundant transcription factor binding profiles. Currently, data from JASPAR can be retrieved as flat files or by using programming language-specific interfaces. Here, we present a programming language-independent application programming interface (API) to access JASPAR data using the Representational State Transfer (REST) architecture. The REST API enables programmatic access to JASPAR by most programming languages and returns data in eight widely used formats. Several endpoints are available to access the data and an endpoint is available to infer the TF binding profile(s) likely bound by a given DNA binding domain protein sequence. Additionally, it provides an interactive browsable interface for bioinformatics tool developers. This REST API is implemented in Python using the Django REST Framework. It is accessible at http://jaspar.genereg.net/api/ and the source code is freely available at https://bitbucket.org/CBGR/jaspar under GPL v3 license. aziz.khan@ncmm.uio.no, anthony.mathelier@ncmm.uio.no. Supplementary data are available at Bioinformatics online.
The Proteins API: accessing key integrated protein and genome information
Antunes, Ricardo; Alpi, Emanuele; Gonzales, Leonardo; Liu, Wudong; Luo, Jie; Qi, Guoying; Turner, Edd
2017-01-01
Abstract The Proteins API provides searching and programmatic access to protein and associated genomics data such as curated protein sequence positional annotations from UniProtKB, as well as mapped variation and proteomics data from large scale data sources (LSS). Using the coordinates service, researchers are able to retrieve the genomic sequence coordinates for proteins in UniProtKB. This, the LSS genomics and proteomics data for UniProt proteins is programmatically only available through this service. A Swagger UI has been implemented to provide documentation, an interface for users, with little or no programming experience, to ‘talk’ to the services to quickly and easily formulate queries with the services and obtain dynamically generated source code for popular programming languages, such as Java, Perl, Python and Ruby. Search results are returned as standard JSON, XML or GFF data objects. The Proteins API is a scalable, reliable, fast, easy to use RESTful services that provides a broad protein information resource for users to ask questions based upon their field of expertise and allowing them to gain an integrated overview of protein annotations available to aid their knowledge gain on proteins in biological processes. The Proteins API is available at (http://www.ebi.ac.uk/proteins/api/doc). PMID:28383659
Foraging and pollination behaviour of the African Honey bee ( Apis ...
African Journals Online (AJOL)
Foraging and pollination behaviour of the African Honey bee (Apis mellifera adansonii) on Callistemon rigidus flowers in Ngaoundere (Cameroon). F-N Tchuenguem Fohouo, J Messi, D Brüchner, B Bouba, G Mbofung, J Hentchoya Hemo. Abstract. No Abstract Available Journal of the Cameroon Academy of Sciences ...
A survey of the ethnozoological knowledge of honey bees Apis ...
African Journals Online (AJOL)
A survey of the ethnozoological knowledge of honey bee Apis mellifera in Ijebu division of South western Nigeria was carried out to examine the pattern of invasion, control methods of their invasion and their effects in life and economy of the people which also include the medicinal and traditional utilization. The Survey was ...
Schnell, Norbert; Saiz, Victor; Barkati, Karim; Goldszmidt, Samuel
2015-01-01
International audience; In this article we present an API and a set of Javascript modules for the synchronized scheduling and aligned playback of predetermined sequences of events such as notes, audio segments , and parameter changes as well as media streams (e.g. audio buffers) based on the Web Audio API logical time. The API has been designed to facilitate the development on both ends, the implementation of modules which generate event sequences or media streams as well as the integration o...
Rismayani, nfn
2017-01-01
Bone district is one of region in South Sulawesi province. There are 27 sub-districts and 374 villages in Bone district. A villages sampled in this study is Barakkae village Lamuru Bone district. The problem in this research is how to make the management system administration at rural level in Bone district and how to apply information technology based on RESTful API on rural administration of Bone district. The technology or method used is the RESTful API, RESTful API is REST (REpresentatio...
A Program of Methodological Research to Arrive at the New International EQ-5D-5L Valuation Protocol
Oppe, Mark; Devlin, Nancy J.; van Hout, Ben; Krabbe, Paul F.M.; de Charro, Frank
OBJECTIVES: To describe the research that has been undertaken by the EuroQol Group to improve current methods for health state valuation, to summarize the results of an extensive international pilot program, and to outline the key elements of the five-level EuroQol five-dimensional (EQ-5D-5L)
De lo demoníaco a lo abyecto. Figuras de lo terrible en el arte moderno
Martínez Arias, Leonardo
2015-01-01
El presente trabajo de investigación parte del complejo miedo-terror como inherente a la condición humana, y pretende observar cómo dicho complejo se manifiesta en la historia del arte, especialmente en las artes visuales, desde comienzos de la modernidad hasta fines del siglo XX. La manifestación del complejo se lleva a cabo a través de tres figuras, las cuales surgen a partir de la desintegración de la figura medieval de lo demoníaco: lo sublime, lo siniestro y lo abyecto. Lo sublime alude ...
Sedação com sufentanil e clonidina em pacientes submetidos a cateterismo cardíaco
Directory of Open Access Journals (Sweden)
Anita Perpetua Carvalho Rocha
2011-03-01
Full Text Available FUNDAMENTO: A sedação para a realização de cateterismo cardíaco tem sido alvo de preocupação. Benzodiazepínicos, agonistas alfa-2 adrenérgicos e opioides são utilizados para esse fim, entretanto, cada um destes medicamentos possui vantagens e desvantagens. OBJETIVO: Avaliar a eficácia do sufentanil e da clonidina como sedativos em pacientes submetidos a cateterismo cardíaco, observando o impacto dos mesmos sobre os parâmetros hemodinâmicos e respiratórios, a presença de efeitos colaterais, além da satisfação do paciente e do hemodinamicista com o exame. MÉTODOS: Trata-se de um ensaio clínico prospectivo, duplo-cego, randomizado e controlado, que envolveu 60 pacientes que receberam 0,1 µg/kg de sufentanil ou 0,5 µg/kg de clonidina antes da realização do cateterismo cardíaco. O escore de sedação segundo a escala de Ramsay, a necessidade de utilização de midazolam, os efeitos colaterais, os parâmetros hemodinâmicos e respiratórios foram registrados, sendo os dados analisados em 06 diferentes momentos. RESULTADOS: O comportamento da pressão arterial, da frequência cardíaca e da frequência respiratória foi semelhante nos dois grupos, entretanto, no momento 2, os pacientes do grupo sufentanil (Grupo S apresentaram menor escore de sedação segundo a escala de Ramsay, e a saturação periférica da oxihemoglobina foi menor que o grupo clonidina (Grupo C no momento 6. Os pacientes do Grupo S apresentaram maior incidência de náusea e vômito pós-operatório que os pacientes do Grupo C. A satisfação dos pacientes foi maior no grupo clonidina. Os hemodinamicistas mostraram-se satisfeitos nos dois grupos. CONCLUSÃO: O sufentanil e a clonidina foram efetivos como sedativos em pacientes submetidos a cateterismo cardíaco.
Asistencia ventricular y trasplante cardíaco en las cardiopatías congénitas
Cabo, Javier; Hübler, Michael; Herreros, Jesús; Hübler, Samira; Villar, Miguel Ángel; García-Guereta, Luis; Trainini, Jorge
2011-01-01
En pacientes jóvenes y adultos con cardiopatías congénitas y fallo ventricular grave refractarios al tratamiento médico intenso con fármacos vasoactivos y en aquellos pacientes con fallo primario del injerto postrasplante cardíaco, la asistencia circulatoria, bien mediante extracorporeal membrane oxygenation (ECMO), asistencia centrífuga, o asistencia ventricular mecánica (AVM) representan la últimas terapias posibles disponibles en el protocolo de actuación estratégica para mantener al pacie...
Host Specificity in the Honeybee Parasitic Mite, Varroa spp. in Apis mellifera and Apis cerana.
Directory of Open Access Journals (Sweden)
Alexis L Beaurepaire
Full Text Available The ectoparasitic mite Varroa destructor is a major global threat to the Western honeybee Apis mellifera. This mite was originally a parasite of A. cerana in Asia but managed to spill over into colonies of A. mellifera which had been introduced to this continent for honey production. To date, only two almost clonal types of V. destructor from Korea and Japan have been detected in A. mellifera colonies. However, since both A. mellifera and A. cerana colonies are kept in close proximity throughout Asia, not only new spill overs but also spill backs of highly virulent types may be possible, with unpredictable consequences for both honeybee species. We studied the dispersal and hybridisation potential of Varroa from sympatric colonies of the two hosts in Northern Vietnam and the Philippines using mitochondrial and microsatellite DNA markers. We found a very distinct mtDNA haplotype equally invading both A. mellifera and A. cerana in the Philippines. In contrast, we observed a complete reproductive isolation of various Vietnamese Varroa populations in A. mellifera and A. cerana colonies even if kept in the same apiaries. In light of this variance in host specificity, the adaptation of the mite to its hosts seems to have generated much more genetic diversity than previously recognised and the Varroa species complex may include substantial cryptic speciation.
Host Specificity in the Honeybee Parasitic Mite, Varroa spp. in Apis mellifera and Apis cerana
Beaurepaire, Alexis L.; Dinh, Tam Q.; Cervancia, Cleofas; Moritz, Robin F. A.
2015-01-01
The ectoparasitic mite Varroa destructor is a major global threat to the Western honeybee Apis mellifera. This mite was originally a parasite of A. cerana in Asia but managed to spill over into colonies of A. mellifera which had been introduced to this continent for honey production. To date, only two almost clonal types of V. destructor from Korea and Japan have been detected in A. mellifera colonies. However, since both A. mellifera and A. cerana colonies are kept in close proximity throughout Asia, not only new spill overs but also spill backs of highly virulent types may be possible, with unpredictable consequences for both honeybee species. We studied the dispersal and hybridisation potential of Varroa from sympatric colonies of the two hosts in Northern Vietnam and the Philippines using mitochondrial and microsatellite DNA markers. We found a very distinct mtDNA haplotype equally invading both A. mellifera and A. cerana in the Philippines. In contrast, we observed a complete reproductive isolation of various Vietnamese Varroa populations in A. mellifera and A. cerana colonies even if kept in the same apiaries. In light of this variance in host specificity, the adaptation of the mite to its hosts seems to have generated much more genetic diversity than previously recognised and the Varroa species complex may include substantial cryptic speciation. PMID:26248192
Changes in Alternative Splicing in Apis Mellifera Bees Fed Apis Cerana Royal Jelly
Directory of Open Access Journals (Sweden)
Shi Yuan Yuan
2014-12-01
Full Text Available The Western honey bee (Apis mellifera is a social insect characterized by caste differentiation in which the queen bee and worker bees display marked differences in morphology, behavior, reproduction, and longevity despite their identical genomes. The main causative factor in caste differentiation is the food fed to queen larvae, termed royal jelly (RJ. Alternative splicing (AS is an important RNA-mediated post-transcriptional process in eukaryotes. Here we report AS changes in A. mellifera after being fed either A. mellifera RJ or A. cerana RJ. The results demonstrated that the RJ type affected 4 types of AS in adult A. mellifera: exon skipping, intron retention, alternative 5’ splice sites, and alternative 3’splice sites. After feeding with A. cerana RJ, AS occurred in many genes in adult A. mellifera that encode proteins involved in development, growth, the tricarboxylic acid cycle, and substance metabolism. This study provides the first evidence that heterospecific RJ can influence the AS of many genes related to honey bee development and growth.
Impacto del riesgo cardíaco sobre la Aneurismectomía
Directory of Open Access Journals (Sweden)
Orestes Díaz Hernández
2000-04-01
Full Text Available Se realiza un análisis cardiológico a 100 pacientes a los cuales se les efectuó cirugía electiva por aneurisma de la aorta abdominal infrarrenal; para esto se emplearon 5 métodos: el índice de riesgo cardíaco de Goldman original y modificado, los marcadores coronarios de Eagle, las indicaciones por niveles recomendadas por Hollier y la ecuación de Cooperman. La cardiopatía isquémica se detectó en el 59 % del total de los pacientes. De ellos, el 43 % tenía antecedentes de infarto del miocardio, el 33 % angina estable bajo tratamiento medicamentoso, el 6 % insuficiencia cardíaca congestiva con tratamiento digitálico y el 11 % un ritmo no sinusal detectado en el electrocardiograma. La supervivencia a largo plazo en la cardiopatía isquémica se comportó al año y 2 años en el 80 %, a los 5 años en el 72 % y a los 10 y 13 años en el 35 %. Se propone un algoritmo simple y modificado de valoración cardiológica en los pacientes que muestran aneurisma de la aorta abdominalA cardiological analysis of 100 patients whe underwent elective surgery due to infrarenal abdominal aortic aneurysm was made. 5 methods were used to this end: the original and modified Goldman´s cardiac resk index, Eagle´s coronary markers, the indications by levels recommended by Hollier and Cooperman´s equation. Ischaemic heart disease was detected in 59 % of the patients. 43 % of them had history of myocardial infarction, 33 % of stable angina under drug treatment, 6 % of congestive heart failure with digitalis treatment and 11 % had a nonsinusal rate detected in the EKG. Among those suffering from schemic heart disease there was a long term survival of 80 % at the lst and 2nd year, 72 % at the 5 th year, and 35 % at the 10th and 13th year. A simple and modified algorithm of cardiological assessment was proposed for patients with abdominal aortic aneurysm
Transplante cardíaco ortotópico pela técnica bicaval
Directory of Open Access Journals (Sweden)
CHACCUR Paulo
1997-01-01
Full Text Available Há trinta anos tem sido empregada a técnica descrita por Lower e Shumway para o transplante cardíaco ortotópico, com bons resultados. Complicações, como estase venosa, formação de trombos, arritmias atriais e insuficiência das valvas tricúspide e mitral, estão presentes no pós-operatório tardio. A partir de 1995, passamos a utilizar a técnica bicaval em todos os casos (6 pacientes. Cinco eram do sexo masculino e a média de idades dos receptores era de 50,6 anos. A cardiomiopatia era dilatada e isquêmica em 2 casos cada, e chagásica e reumática nos demais. Três pacientes apresentavam operações prévias, sendo que um deles havia sido submetido a três operações de prótese valvar aórtica, o segundo a implante de marcapasso epimiocárdico definitivo, e o último a duas operações de revascularização do miocárdio associada a aneurismectomia de ventrículo esquerdo. A técnica cirúrgica consistiu, na maioria dos casos, na anastomose das veias pulmonares, em conjunto com o átrio esquerdo do coração a ser implantado e, a seguir, a da cava superior, inferior, do tronco pulmonar e aorta. Todos os doadores estavam em hospitais da cidade e com retirada múltipla de órgãos. Não tivemos óbito hospitalar e todos os pacientes estão vivos para um período de um a quinze meses de pós-operatório. Não houve diferença significativa quando se comparou as duas técnicas para o tempo de anóxia, tempo de C E C, tempo de implante, presença de taquiarritmias atriais, sangramento e permanência hospitalar. Houve diferença significativa (p<0,05 para a utilização de marcapasso temporário e presença de insuficiência tricúspide. Acreditamos que a técnica bicaval, além de reduzir o tamanho das cavidades atriais, é uma técnica simples, com índice menor de complicações e que poderá ser empregada com mais freqüência.
Directory of Open Access Journals (Sweden)
Genevieve C. Digby
2011-04-01
Full Text Available La fisioterapia se ha transformado en una especialidad que claramente incide en la calidad de vida de nuestros pacientes. En poblaciones añosas, el uso de fisioterapia incluye múltiples modalidades para un alto número de distintas enfermedades. Varios informes sobre posibles interacciones negativas entre las distintas modalidades de fisioterapia y los dispositivos cardíacos implantables (marcapasos y cardiodesfibriladores han sido publicados en los últimos aňos. A pesar de ello, existe muy poca evidencia y guías precisas para identificar cuáles son las modalidades de fisioterapia seguras a utilizar en esta población de pacientes. En la siguiente revisión, nos propusimos resumir las interacciones documentadas entre fisioterapia y dispositivos cardíacos implantables (DCI, discutir el estándar actual de estas prácticas e identificar las principales consideraciones que existen desde la perspectiva de un servicio de electrofisiología cardíaca, para el tratamiento adecuado en estos pacientes. Finalmente, abogamos por fortalecer la colaboración entre fisioterapeutas y electrofisiólogos, con el fin de asegurar una óptima y segura atención de este grupo de pacientes.
Trasplante cardíaco y de médula ósea en un paciente
Directory of Open Access Journals (Sweden)
CÉSAR BELZITI
2009-01-01
Full Text Available RESUMENLa amiloidosis es una enfermedad infiltrativa sistémica que compromete al corazón y representauna causa importante de miocardiopatía restrictiva.Se describe el caso de un paciente masculino de 35 años con insuficiencia cardíaca avanzadasecundaria a miocardiopatía infiltrativa por depósito amiloide. Durante su evaluación serealizó diagnóstico de neoplasia de células plasmáticas. Debido a la rápida progresión de lossíntomas, el deterioro de la función ventricular y la incapacidad para tolerar el tratamientoadecuado para su enfermedad hematológica, se realizó trasplante cardíaco seguido de trasplanteautólogo de médula ósea sin complicaciones. La presentación de este caso constituyela primera comunicación en nuestro país de trasplante cardíaco seguido de trasplante demédula ósea como tratamiento de la amiloidosis cardíaca.REV ARGENT CARDIOL 2009;77;309-311.
T2DiACoD: A Gene Atlas of Type 2 Diabetes Mellitus Associated Complex Disorders.
Rani, Jyoti; Mittal, Inna; Pramanik, Atreyi; Singh, Namita; Dube, Namita; Sharma, Smriti; Puniya, Bhanwar Lal; Raghunandanan, Muthukurussi Varieth; Mobeen, Ahmed; Ramachandran, Srinivasan
2017-07-31
We performed integrative analysis of genes associated with type 2 Diabetes Mellitus (T2DM) associated complications by automated text mining with manual curation and also gene expression analysis from Gene Expression Omnibus. They were analysed for pathogenic or protective role, trends, interaction with risk factors, Gene Ontology enrichment and tissue wise differential expression. The database T2DiACoD houses 650 genes, and 34 microRNAs associated with T2DM complications. Seven genes AGER, TNFRSF11B, CRK, PON1, ADIPOQ, CRP and NOS3 are associated with all 5 complications. Several genes are studied in multiple years in all complications with high proportion in cardiovascular (75.8%) and atherosclerosis (51.3%). T2DM Patients' skeletal muscle tissues showed high fold change in differentially expressed genes. Among the differentially expressed genes, VEGFA is associated with several complications of T2DM. A few genes ACE2, ADCYAP1, HDAC4, NCF1, NFE2L2, OSM, SMAD1, TGFB1, BDNF, SYVN1, TXNIP, CD36, CYP2J2, NLRP3 with details of protective role are catalogued. Obesity is clearly a dominant risk factor interacting with the genes of T2DM complications followed by inflammation, diet and stress to variable extents. This information emerging from the integrative approach used in this work could benefit further therapeutic approaches. The T2DiACoD is available at www.http://t2diacod.igib.res.in/ .
Directory of Open Access Journals (Sweden)
Xiangqian Li
2017-01-01
Full Text Available Reliable information on the spatiotemporal dynamics of solar radiation plays a crucial role in studies relating to global climate change. In this study, a new backpropagation neural network (BPNN model optimized with an Ant Colony Optimization (ACO algorithm was developed to generate the ACO-BPNN model, which had demonstrated superior performance for simulating solar radiation compared to traditional BPNN modelling, for Northeast China. On this basis, we applied an intensity analysis to investigate the spatiotemporal variation of solar radiation from 1982 to 2010 over the study region at three levels: interval, category, and conversion. Research findings revealed that (1 the solar radiation resource in the study region increased from the 1980s to the 2000s and the average annual rate of variation from the 1980s to the 1990s was lower than that from the 1990s to the 2000s and (2 the gains and losses of solar radiation at each level were in different conditions. The poor, normal, and comparatively abundant levels were transferred to higher levels, whereas the abundant level was transferred to lower levels. We believe our findings contribute to implementing ad hoc energy management strategies to optimize the use of solar radiation resources and provide scientific suggestions for policy planning.
Mensuração do tamanho cardíaco em radiografias de gatos com hipertireoidismo experimental
Directory of Open Access Journals (Sweden)
Mauro José Lahm Cardoso
2007-04-01
Full Text Available O hipertireoidismo felino ou tireotoxicose é a doença endócrina mais freqüente em gatos domésticos. O hipertireoidismo felino é uma desordem multissistêmica associada com aumento das concentrações dos hormônios tireoidianos circulantes, triidotironina (T3 e tiroxina (T4. Anormalidades cardiovasculares em gatos com hipertireoidismo espontâneo já foram bem descritas. O objetivo deste trabalho foi realizar a mensuração cardíaca em 19 gatos submetidos a tireotoxicose experimental, utilizando o "vertebral heart size" (VHS. A mensuração utilizando o VHS foi realizada a partir de radiografias torácicas lateral, dorsoventral e ventrodorsal. As radiografias torácicas laterais foram mais eficazes do que as ventrodorsal e dorsoventral em ilustrar o aumento progressivo do coração. O VHS é um método fácil de ser usado, permitindo a avaliação do tamanho cardíaco em gatos hipertireóideos, e facilita a identificação de cardiomegalia e progressão do tamanho cardíaco.
Lobo Domingo, E.L.; Gonçalves Delatorre, P.; Martins Rembold, S.; Lima da Silva, J.L.
2010-01-01
El objetivo de este estudio fue investigar los aspectos sociodemográficos de los clientes atendidos en el Hospital Universitario (HU), de Rio de Janeiro/Brasil, para implante de marcapasos cardíaco definitivo entre diciembre de 2005 y diciembre de 2006. Se analizaron 78 historias clínicas, incluyendo todos los clientes sometidos a implante o cambio de marcapasos cardíaco definitivo en el sector de hemodinámica o en el centro quirúrgico del HU. De esos 78 clientes estudiados, 52 se sometieron ...
Vila, Jose Henrique Andrade; Silva, José Pedro da; Fonseca,Luciana da; Baumgratz,José Francisco; Tangari Jr, Américo; Leite,Weverton Ferreira; Guilhen,Claudia Jesus; Armelin, Egas
2010-01-01
FUNDAMENTO: Nos últimos anos o numero de artigos sobre transplante cardíaco heterotópico tem sido escasso na literatura, inclusive internacional, e em particular do seguimento de longo prazo destes pacientes, o que levou ao presente relato. OBJETIVO: Relatar a experiência clínica inicial e evolução tardia de quatro pacientes submetidos a transplante cardíaco heterotópico, sua indicação e principais complicações. MÉTODOS: As cirurgias ocorreram entre 1992 e 2001, sendo que a indicação de trans...
Barrera-Ramírez,Carlos Felipe; Pineda-Pompa,Luis R; Melo,Mario; Valdez Castro, Ricardo; Medina-Gómez,Héctor; Godina-Alonso,Gustavo; Guzmán,Carlos E
2005-01-01
El lupus eritematoso sistémico es una enfermedad autoinmune inflamatoria capaz de afectar cualquier aparato y sistema. Aunque la pericarditis es la manifestación cardíaca más frecuentemente observada, usualmente no es una situación que comprometa la vida del paciente. El taponamiento cardíaco ocasionado por derrame pericárdico en el lupus es una situación extremadamente rara, con una incidencia no mayor al 2%. Informamos el caso de una mujer de 21 años de edad con taponamiento cardíaco por lu...
Williams, Geoffrey R.; Shutler, Dave; Burgher-MacLellan, Karen L.; Rogers, Richard E. L.
2014-01-01
Nosema spp. fungal gut parasites are among myriad possible explanations for contemporary increased mortality of western honey bees (Apis mellifera, hereafter honey bee) in many regions of the world. Invasive Nosema ceranae is particularly worrisome because some evidence suggests it has greater virulence than its congener N. apis. N. ceranae appears to have recently switched hosts from Asian honey bees (Apis cerana) and now has a nearly global distribution in honey bees, apparently displacing N. apis. We examined parasite reproduction and effects of N. apis, N. ceranae, and mixed Nosema infections on honey bee hosts in laboratory experiments. Both infection intensity and honey bee mortality were significantly greater for N. ceranae than for N. apis or mixed infections; mixed infection resulted in mortality similar to N. apis parasitism and reduced spore intensity, possibly due to inter-specific competition. This is the first long-term laboratory study to demonstrate lethal consequences of N. apis and N. ceranae and mixed Nosema parasitism in honey bees, and suggests that differences in reproduction and intra-host competition may explain apparent heterogeneous exclusion of the historic parasite by the invasive species. PMID:24987989
Directory of Open Access Journals (Sweden)
Geoffrey R Williams
Full Text Available Nosema spp. fungal gut parasites are among myriad possible explanations for contemporary increased mortality of western honey bees (Apis mellifera, hereafter honey bee in many regions of the world. Invasive Nosema ceranae is particularly worrisome because some evidence suggests it has greater virulence than its congener N. apis. N. ceranae appears to have recently switched hosts from Asian honey bees (Apis cerana and now has a nearly global distribution in honey bees, apparently displacing N. apis. We examined parasite reproduction and effects of N. apis, N. ceranae, and mixed Nosema infections on honey bee hosts in laboratory experiments. Both infection intensity and honey bee mortality were significantly greater for N. ceranae than for N. apis or mixed infections; mixed infection resulted in mortality similar to N. apis parasitism and reduced spore intensity, possibly due to inter-specific competition. This is the first long-term laboratory study to demonstrate lethal consequences of N. apis and N. ceranae and mixed Nosema parasitism in honey bees, and suggests that differences in reproduction and intra-host competition may explain apparent heterogeneous exclusion of the historic parasite by the invasive species.
A program of methodological research to arrive at the new international EQ-5D-5L valuation protocol.
Oppe, Mark; Devlin, Nancy J; van Hout, Ben; Krabbe, Paul F M; de Charro, Frank
2014-06-01
To describe the research that has been undertaken by the EuroQol Group to improve current methods for health state valuation, to summarize the results of an extensive international pilot program, and to outline the key elements of the five-level EuroQol five-dimensional (EQ-5D-5L) questionnaire valuation protocol, which is the culmination of that work. To improve on methods of health state valuation for the EQ-5D-5L questionnaire, we investigated the performance of different variants of time trade-off and discrete choice tasks in a multinational setting. We also investigated the effect of three modes of administration on health state valuation: group interviews, online self-completion, and face-to-face interviews. The research program provided the basis for the EQ-5D-5L questionnaire valuation protocol. Two different types of tasks are included to derive preferences: a newly developed composite time trade-off task and a forced-choice paired comparisons discrete choice task. Furthermore, standardized blocked designs for the selection of the states to be valued by participants were created and implemented together with all other elements of the valuation protocol in a digital aid, the EuroQol Valuation Technology, which was developed in conjunction with the protocol. The EuroQol Group has developed a standard protocol, with accompanying digital aid and interviewer training materials, that can be used to create value sets for the EQ-5D-5L questionnaire. The use of a well-described, consistent protocol across all countries enhances the comparability of value sets between countries, and allows the exploration of the influence of cultural and other factors on health state values. Copyright © 2014 International Society for Pharmacoeconomics and Outcomes Research (ISPOR). Published by Elsevier Inc. All rights reserved.
Chen, Dafu; Guo, Rui; Xu, Xijian; Xiong, Cuiling; Liang, Qin; Zheng, Yanzhen; Luo, Qun; Zhang, Zhaonan; Huang, Zhijian; Kumar, Dhiraj; Xi, Weijun; Zou, Xuan; Liu, Min
2017-07-20
Honeybees are susceptible to a variety of diseases, including chalkbrood, which is capable of causing huge losses of both the number of bees and colony productivity. This research is designed to characterize the transcriptome profiles of Ascosphaera apis-treated and un-treated larval guts of Apis mellifera ligustica in an attempt to unravel the molecular mechanism underlying the immune responses of western honeybee larval guts to mycosis. In this study, 24, 296 and 2157 genes were observed to be differentially expressed in A. apis-treated Apis mellifera (4-, 5- and 6-day-old) compared with un-treated larval guts. Moreover, the expression patterns of differentially expressed genes (DEGs) were examined via trend analysis, and subsequently, gene ontology analysis and KEGG pathway enrichment analysis were conducted for DEGs involved in up- and down-regulated profiles. Immunity-related pathways were selected for further analysis, and our results demonstrated that a total of 13 and 50 DEGs were annotated in the humoral immune-related and cellular immune-related pathways, respectively. Additionally, we observed that many DEGs up-regulated in treated guts were part of cellular immune pathways, such as the lysosome, ubiquitin mediated proteolysis, and insect hormone biosynthesis pathways and were induced by A. apis invasion. However, more down-regulated DEGs were restrained. Surprisingly, a majority of DEGs within the Toll-like receptor signaling pathway, and the MAPK signaling pathway were up-regulated in treated guts, while all but two genes involved in the NF-κB signaling pathway were down-regulated, which suggested that most genes involved in humoral immune-related pathways were activated in response to the invasive fungal pathogen. This study's findings provide valuable information regarding the investigation of the molecular mechanism of immunity defenses of A. m. ligustica larval guts to infection with A. apis. Furthermore, these studies lay the groundwork for
“Wrapping” X3DOM around Web Audio API
Directory of Open Access Journals (Sweden)
Andreas Stamoulias
2015-12-01
Full Text Available Spatial sound has a conceptual role in the Web3D environments, due to highly realism scenes that can provide. Lately the efforts are concentrated on the extension of the X3D/ X3DOM through spatial sound attributes. This paper presents a novel method for the introduction of spatial sound components in the X3DOM framework, based on X3D specification and Web Audio API. The proposed method incorporates the introduction of enhanced sound nodes for X3DOM which are derived by the implementation of the X3D standard components, enriched with accessional features of Web Audio API. Moreover, several examples-scenarios developed for the evaluation of our approach. The implemented examples established the achievability of new registered nodes in X3DOM, for spatial sound characteristics in Web3D virtual worlds.
Draft genome sequence of the Algerian bee Apis mellifera intermissa
Directory of Open Access Journals (Sweden)
Nizar Jamal Haddad
2015-06-01
Full Text Available Apis mellifera intermissa is the native honeybee subspecies of Algeria. A. m. intermissa occurs in Tunisia, Algeria and Morocco, between the Atlas and the Mediterranean and Atlantic coasts. This bee is very important due to its high ability to adapt to great variations in climatic conditions and due to its preferable cleaning behavior. Here we report the draft genome sequence of this honey bee, its Whole Genome Shotgun project has been deposited at DDBJ/EMBL/GenBank under the accession JSUV00000000. The 240-Mb genome is being annotated and analyzed. Comparison with the genome of other Apis mellifera sub-species promises to yield insights into the evolution of adaptations to high temperature and resistance to Varroa parasite infestation.
Draft genome sequence of the Algerian bee Apis mellifera intermissa.
Haddad, Nizar Jamal; Loucif-Ayad, Wahida; Adjlane, Noureddine; Saini, Deepti; Manchiganti, Rushiraj; Krishnamurthy, Venkatesh; AlShagoor, Banan; Batainh, Ahmed Mahmud; Mugasimangalam, Raja
2015-06-01
Apis mellifera intermissa is the native honeybee subspecies of Algeria. A. m. intermissa occurs in Tunisia, Algeria and Morocco, between the Atlas and the Mediterranean and Atlantic coasts. This bee is very important due to its high ability to adapt to great variations in climatic conditions and due to its preferable cleaning behavior. Here we report the draft genome sequence of this honey bee, its Whole Genome Shotgun project has been deposited at DDBJ/EMBL/GenBank under the accession JSUV00000000. The 240-Mb genome is being annotated and analyzed. Comparison with the genome of other Apis mellifera sub-species promises to yield insights into the evolution of adaptations to high temperature and resistance to Varroa parasite infestation.
QSPIN: A High Level Java API for Quantum Computing Experimentation
Barth, Tim
2017-01-01
QSPIN is a high level Java language API for experimentation in QC models used in the calculation of Ising spin glass ground states and related quadratic unconstrained binary optimization (QUBO) problems. The Java API is intended to facilitate research in advanced QC algorithms such as hybrid quantum-classical solvers, automatic selection of constraint and optimization parameters, and techniques for the correction and mitigation of model and solution errors. QSPIN includes high level solver objects tailored to the D-Wave quantum annealing architecture that implement hybrid quantum-classical algorithms [Booth et al.] for solving large problems on small quantum devices, elimination of variables via roof duality, and classical computing optimization methods such as GPU accelerated simulated annealing and tabu search for comparison. A test suite of documented NP-complete applications ranging from graph coloring, covering, and partitioning to integer programming and scheduling are provided to demonstrate current capabilities.
Pertukaran Data Antar Database Dengan Menggunakan Teknologi API
Directory of Open Access Journals (Sweden)
Ahmad Hanafi
2017-03-01
Full Text Available Electronically data interchange between institutions or companies must be supported with appropriate data storage media capacity. MySQL is a database engine that is used to perform data storage in the form of information, where the data can be utilized as needed. MYSQL has the advantage of which is to provide convenience in terms of usage, and able to work on different platforms. System requirements that must be reliable and multitasking capable of making the database not only as a data storage medium, but can also be utilized as a means of data exchange. Dropbox API is the best solution that can be utilized as a technology that supports the database to be able to Exchange data. The combination of the Dropbox API and database can be used as a very cheap solution for small companies to implement data exchange, because it only requires a relatively small Internet connection.
Development of the Adherence Predictive Index (API for Medication Taking
Directory of Open Access Journals (Sweden)
Jon C Schommer
2016-03-01
Full Text Available The objective for this study was to explore if characteristics of personality type using the Preferred Communication Style Questionnaire, in concert with the demographic characteristics of age, education, and race/ethnicity, are associated with, and help predict, individuals’ medication adherence behavior. Data were collected via an on-line survey, sent to a sample of adults residing in the United States, between April 28 and June 22, 2015. Out of 26,173 responses to the survey, 16,736 reported taking one or more medications and were eligible for inclusion in this study. The development of the Adherence Predictive Index (API used mean Morisky Medication Adherence Scale (MMAS-8 scores for each of eight personality types as a starting point. API scores were calculated by adding or subtracting specific values to each group’s mean MMAS-8 score based on personality type, age, education and race/ethnicity characteristics which were demonstrated to have significant effects on adherence. The weighting system was informed by linear regression, logistic regression, personality type literature, researcher experience, and previous qualitative and quantitative research. The resultant score was converted to an API score that ranged from 1 to 5 so that it would be feasible for health care providers to understand and use. The findings showed that an Adherence Predictive Index (API could be developed based upon a relatively small number of questions that focus on personality type and generational, educational, and cultural experiences. It was developed in order to be a component of a comprehensive program that has the goals of (1 identifying and describing specific behavioral strategies individuals are most likely to successfully employ, (2 motivating patients by using their preferred communication style, and (3 predicting each patient’s propensity to adhere. Future research is needed to evaluate the index’s validity, sensitivity, and effectiveness in
Multimodel parameter optimization with adaptive population importance sampler (APIS)
Mäkelä, Jarmo; Susiluoto, Jouni; Knauer, Jürgen; Aurela, Mika; Mammarella, Ivan; Markkanen, Tiina; Thum, Tea; Zaehle, Sönke; Aalto, Tuula
2017-04-01
We are optimizing key parameters in soil hydrology and forest water and carbon exchange related formulations in ecosystem model JSBACH, which is the land surface component of the Earth System model of Max Planck Institute for Meteorology (MPI-ESM). The model has been modified to use multiple stomatal/canopy conductance formulations which will vary during the optimization process. Our previous results have shown that JSBACH is lacking in its response to drought, which is the motivation to test the different conductance formulations. The optimization is done with the adaptive population importance sampler (APIS) algorithm, that provides a global estimation of the selected JSBACH parameters, using all generated samples. Additionally APIS is able to estimate the model evidence (or partition function), which can be used to determine the optimal submodel (conductance formulation). APIS starts with a set of N randomly generated proposals (standard deviations for the parameters), with location parameters spread in the state space. We draw M samples and calculate the partial IS (importance sampler) estimators for each proposal, after which we update the location parameters and each proposal as well as the global estimator for each JSBACH parameter. This process is then repeated a number of times. The study focuses on boreal coniferous evergreen forests. The optimization is based on site level eddy covariance flux measurements on multiple sites across the Northern Hemisphere, where the parameters are estimated by minimizing the model-data mismatch in evapotranspiration and gross primary production.
ADS 2.0: New Architecture, API and Services
Chyla, R.; Accomazzi, A.; Holachek, A.; Grant, C. S.; Elliott, J.; Henneken, E. A.; Thompson, D. M.; Kurtz, M. J.; Murray, S. S.; Sudilovsky, V.
2015-09-01
The ADS platform is undergoing the biggest rewrite of its 20-year history. While several components have been added to its architecture over the past couple of years, this talk will concentrate on the underpinnings of ADS's search layer and its API. To illustrate the design of the components in the new system, we will show how the new ADS user interface is built exclusively on top of the API using RESTful web services. Taking one step further, we will discuss how we plan to expose the treasure trove of information hosted by ADS (10 million records and fulltext for much of the Astronomy and Physics refereed literature) to partners interested in using this API. This will provide you (and your intelligent applications) with access to ADS's underlying data to enable the extraction of new knowledge and the ingestion of these results back into the ADS. Using this framework, researchers could run controlled experiments with content extraction, machine learning, natural language processing, etc. In this talk, we will discuss what is already implemented, what will be available soon, and where we are going next.
PvaPy: Python API for EPICS PV Access
Energy Technology Data Exchange (ETDEWEB)
Veseli, S.
2016-01-01
As the number of sites deploying and adopting EPICS Version 4 grows, so does the need to support PV Access from multiple languages. Especially important are the widely used scripting languages that tend to reduce both software development time and the learning curve for new users. In this paper we describe PvaPy, a Python API for the EPICS PV Access protocol and its accompanying structured data API. Rather than implementing the protocol itself in Python, PvaPy wraps the existing EPICS Version 4 C++ libraries using the Boost.Python framework. This approach allows us to benefit from the existing code base and functionality, and to significantly reduce the Python API development effort. PvaPy objects are based on Python dictionaries and provide users with the ability to access even the most complex of PV Data structures in a relatively straightforward way. Its interfaces are easy to use, and include support for advanced EPICS Version 4 features such as implementation of client and server Remote Procedure Calls (RPC).
Variation morphogeometrics of Africanized honey bees (Apis mellifera in Brazil
Directory of Open Access Journals (Sweden)
Lorena A. Nunes
2012-09-01
Full Text Available The morphometrics of the honey bee Apis mellifera L., 1758 has been widely studied mainly because this species has great ecological importance, high adaptation capacity, wide distribution and capacity to effectively adapt to different regions. The current study aimed to investigate the morphometric variations of wings and pollen baskets of honey bees Apis mellifera scutellata Lepeletier, 1836 from the five regions in Brazil. We used geometric morphometrics to identify the existence of patterns of variations of shape and size in Africanized honey bees in Brazil 16 years after the classic study with this species, allowing a temporal and spatial comparative analysis using new technological resources to assess morphometrical data. Samples were collected in 14 locations in Brazil, covering the five geographical regions of the country. The shape analysis and multivariate analyses of the wing allowed to observe that there is a geographical pattern among the population of Apis mellifera in Brazil. The geographical variations may be attributed to the large territorial extension of the country in addition to the differences between the bioregions.
Nolan, Claire M; Longworth, Louise; Lord, Joanne; Canavan, Jane L; Jones, Sarah E; Kon, Samantha S C; Man, William D-C
2016-06-01
The EQ-5D, a generic health status questionnaire that is widely used in health economic evaluation, was recently expanded to the EQ-5D-5L to address criticisms of unresponsiveness and ceiling effect. To describe the validity, responsiveness and minimum important difference of the EQ-5D-5L in COPD. Study 1: The validity of the EQ-5D-5L utility index and visual analogue scale (EQ-VAS) was compared with four established disease-specific health status questionnaires and other measures of disease severity in 616 stable outpatients with COPD. Study 2: The EQ-5D-5L utility index and EQ-VAS were measured in 324 patients with COPD before and after 8 weeks of pulmonary rehabilitation. Distribution and anchor-based approaches were used to estimate the minimum important difference. There were moderate-to-strong correlations between utility index and EQ-VAS with disease-specific questionnaires (Pearson's r=0.47-0.72). A ceiling effect was seen in 7% and 2.6% of utility index and EQ-VAS. Utility index decreased (worsening health status) with indices of worsening disease severity. With rehabilitation, mean (95% CI) changes in utility index and EQ-VAS were 0.065 (0.047 to 0.083) and 8.6 (6.5 to 10.7), respectively, with standardised response means of 0.39 and 0.44. The mean (range) anchor estimates of the minimum important difference for utility index and EQ-VAS were 0.051 (0.037 to 0.063) and 6.9 (6.5 to 8.0), respectively. The EQ-5D-5L is a valid and responsive measure of health status in COPD and may provide useful additional cost-effectiveness data in clinical trials. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/
Instrument-Defined Estimates of the Minimally Important Difference for EQ-5D-5L Index Scores.
McClure, Nathan S; Sayah, Fatima Al; Xie, Feng; Luo, Nan; Johnson, Jeffrey A
2017-04-01
The five-level EuroQol five-dimensional questionnaire (EQ-5D-5L) is a preference-based measure of health-related quality of life (HRQOL), which yields an index score anchored at 0 (dead) and 1 (full health). We lack evidence on estimates for the minimally important difference (MID) of the EQ-5D-5L that will help in interpreting differences or changes in HRQOL measured by this scale score. To estimate the MID of the EQ-5D-5L index score for available scoring algorithms including algorithms from Canada, China, Spain, Japan, England, and Uruguay. A simulation-based approach based on instrument-defined single-level transitions was used to estimate the MID values of the EQ-5D-5L for each country-specific scoring algorithm. The simulation-based instrument-defined MID estimates (mean ± SD) for each country-specific scoring algorithm were as follows: Canada, 0.056 ± 0.011; China, 0.069 ± 0.007; Spain, 0.061 ± 0.008; Japan, 0.048 ± 0.004; England, 0.063 ± 0.013; and Uruguay, 0.063 ± 0.019. Differences in MID estimates reflect differences in population preferences, in valuation techniques used, as well as in modeling strategies. After excluding the maximum-valued scoring parameters, the MID estimates (mean ± SD) were as follows: Canada, 0.037 ± 0.001; China, 0.058 ± 0.005; Spain, 0.045 ± 0.009; Japan, 0.044 ± 0.004; England, 0.037 ± 0.008; and Uruguay, 0.040 ± 0.010. Simulation-based estimates of the MID of the EQ-5D-5L index score were generally between 0.037 and 0.069, which are similar to the MID estimates of other preference-based HRQOL measures. Copyright © 2017 International Society for Pharmacoeconomics and Outcomes Research (ISPOR). Published by Elsevier Inc. All rights reserved.
Li, Meng; Gogos, Costas G; Ioannidis, Nicolas
2015-01-15
The dissolution rate of the active pharmaceutical ingredients in pharmaceutical hot-melt extrusion is the most critical elementary step during the extrusion of amorphous solid solutions - total dissolution has to be achieved within the short residence time in the extruder. Dissolution and dissolution rates are affected by process, material and equipment variables. In this work, we examine the effect of one of the material variables and one of the equipment variables, namely, the API particle size and extruder screw configuration on the API dissolution rate, in a co-rotating, twin-screw extruder. By rapidly removing the extruder screws from the barrel after achieving a steady state, we collected samples along the length of the extruder screws that were characterized by polarized optical microscopy (POM) and differential scanning calorimetry (DSC) to determine the amount of undissolved API. Analyses of samples indicate that reduction of particle size of the API and appropriate selection of screw design can markedly improve the dissolution rate of the API during extrusion. In addition, angle of repose measurements and light microscopy images show that the reduction of particle size of the API can improve the flowability of the physical mixture feed and the adhesiveness between its components, respectively, through dry coating of the polymer particles by the API particles. Copyright © 2014. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Purnomo Raharjo
2017-07-01
Full Text Available Sedimentary processes occur intensively in Tanjung Api-Api area situated in the estuary of Musi Banyuasin river. A study on 210Pb isotopes of the sediments has been done to understand the rate of sedimentation. For that purpose, the Marine Geological Institute of Indonesia (MGI has also conducted bathymetry and sediment distribution mappings. Two samples represent depths of 17-30 cm and 190-210 cm below sea floor give age of 11.54 and 22.45 years. The average of sedimentation rate is 2.03 cm/years (from 0 to 0.3 m below seafloor and 8.9 cm/years (until 2.1 m depth below seafloor. The result shows, decreasing sedimentation rate upward, that indicates the surficial sediment less influenced by wave and surface current nowadays.
The end of polling: why and how to transform a REST API into a Data Streaming API?
CERN. Geneva
2017-01-01
We know interactivity is the key to keep our user’s interest alive but we can’t reduce animation to UI anymore. Twitter, Waze, Slack… users are used to have real-time data in applications they love. But how can you turn your static API into a stream of data? By pulling? Pushing? Webhook-ing? When talking about data streaming, we often think about WebSockets. But have you ever heard of Server-Sent Events? In this tools-in-action we will compare those technologies to understand which one you should opt for depending on your usecase, and I’ll show you how we have been reducing the amount of data to transfer even further with JSON-Patch. And because real-time data is not only needed by web (and because it’s much more fun), I’ll show you how we can make a drone dance on streamed APIs.
Ozkirim, A; Keskin, N
2001-01-01
The aim of this study is to find out the ratio of Nosema infected honey bees which are producing the famous Anzer honey that is used for the cure of the illnesses such as farangitis, tonsilitis, ulceration, and scratchs due to the experiences of the people living in Turkey. Honey bee samples were collected from two different regions of Anzer plain in July. Honey bee abdomens were homogenized and 1 ml distilled water was added for each honey bee. Later, 0.1 ml out of this solution was examined by Neubauer slides and the number of Nosema apis spores were counted. The results showed that Nosema apis significantly infected the honey bees although it was summer season. However, the summer season at the Anzer plain, when compared with the Mediterranean climate, is considered to be spring.
Experiencia con hipotermia terapéutica en el paro cardíaco extrahospitalario
Directory of Open Access Journals (Sweden)
Ricardo Levin
2016-01-01
Full Text Available Introducción: El paro cardíaco extrahospitalario (PCEH, una de las principales causas de mortalidad en el mundo occidental, se asocia con una muy baja sobrevida hospitalaria y con un número elevado de secuelas neurológicas entre los sobrevivientes, sin modificaciones significativas en el pronóstico en las últimas tres décadas. Estudios clínicos más recientes plantearon la utilidad de la hipotermia terapéutica en la reducción de la mortalidad y el grado de deterioro neurológico en sobrevivientes de un PCEH. Objetivos: Evaluar la mortalidad y el resultado neurológico de pacientes comatosos resucitados de un PCEH tratados con hipotermia terapéutica. Considerar las indicaciones y los hallazgos de la cinecoronariografía y detectar complicaciones asociadas con la hipotermia. Material y métodos: Se incluyeron pacientes resucitados de un PCEH tratados bajo hipotermia terapéutica, que consistió en una fase de enfriamiento a 33 °C, un mantenimiento durante 24 horas y recalentamiento a 0,25 °C/hora. Se analizaron las indicaciones y los hallazgos de la cinecoronariografía. Se evaluaron complicaciones metabólicas, arrítmicas, infecciosas y hemorrágicas. Se consideró significativo valor de p menor de 0,05. Resultados: De los 213 pacientes incluidos, la sobrevida hospitalaria fue de 109 pacientes (51,2%, de los que 96 (46,1% presentaron al egreso buena recuperación neurológica. Se observó mayor sobrevida en pacientes con ritmos pasibles de desfibrilación respecto de aquellos con ritmos no pasibles de desfibrilación (58,2% vs. 37,7%; p = 0,007. Se derivaron (3,5 horas en promedio a cinecoronariografía 147 (69% pacientes, de los cuales 121 (82,3% mostraron enfermedad significativa, observándose en 69 (57% oclusión coronaria completa. Ciento siete pacientes fueron sometidos a angioplastia; 43 (40,2% de ellos fallecieron durante la internación frente a 61 (58,6% óbitos entre los no intervenidos o no estudiados (p = 0,005. Entre
Intelligent Search Method Based ACO Techniques for a Multistage Decision Problem EDP/LFP
Directory of Open Access Journals (Sweden)
Mostefa RAHLI
2006-07-01
the algorithm getting to him a rate preferably more or less justifiable. In operational research, this subject is known under the name of CPO [14] (combinatory problem optimization.The choice of a numerical method to use for a merged case study and calculation of the LFP/Fitting/EDP what is [7, 8, 9, 10, 18, 19, 20] (in theoretical form of a problem compensates the final decision to adopt and a strategy of optimal production (which is a practical problem form and the final task most wanted.Each method is imposed by:· The algorithm complexity.· In an application gathering all calculations, the number of uses of method compared to the total number of later issues.· The maximum number of iterations for a given use.· The maximum iterations count allowed for this algorithm kind.· The limitations of the algorithm such as: applicability of a method (algorithm adapted or not to the problem; does the problem constrained or not; problem dimension or order N (N ≤ Nmax; the algorithm stability.It's well-known that for an approached calculation method, the propagation of errors strongly conditions the need of making its adequate choice and if it can be adopted compared to others for the same area.More is the number of the elementary operations is large more the final result misses precision and especially if the finality of the study is a responsible decision to make and a satisfaction of constraints and multiple conditions. Our study proposes an inference based solution (AI with the use of ACO technique (Ant colony Optimization2.
Conner-Spady, Barbara L; Marshall, Deborah A; Bohm, Eric; Dunbar, Michael J; Loucks, Lynda; Al Khudairy, Ammar; Noseworthy, Tom W
2015-07-01
To assess the test-retest reliability of the EQ-5D-5L (5L) and compare the validity of the 5L and EQ-5D-3L (3L) in osteoarthritis patients referred to an orthopaedic surgeon for total joint replacement. We mailed questionnaires to 306 consecutive patients following referral and a second questionnaire after 2 weeks to assess reliability. Questionnaires included the 5L, EQ-VAS, Short Form-12, Oxford hip and knee scores, pain VAS, and the 3L. We compared the ceiling effect, redistribution properties, convergent and discriminant validity, and discriminatory power of the 5L and 3L. We obtained 176 respondents (response rate 58 %), 60 % female, 64 % knee patients, mean age 65 years (SD 11), with no significant differences between responders versus non-responders. Intraclass correlation coefficients were 0.61-0.77 for the 5L dimensions and 0.87 for the 5L index. For the 3L, most patients used level 2 (some/moderate problems) for mobility (87 %), usual activities (78 %), and pain/discomfort (71 %). In comparison, 5L responses were spread out with only 52, 42, and 50 %, respectively, using the middle level. All convergent validity coefficients were stronger with the 5L (Spearman coefficients 0.51-0.75). Absolute informativity (Shannon's index) showed higher results for all dimensions of the 5L compared with the 3L (average difference 0.74). Relative informativity (Shannon's evenness index) showed an increase from the 3L to the 5L in mobility, usual activities, and pain/discomfort. The 5L provided stronger validity evidence than the 3L, especially for dimensions relevant to this patient population-mobility, usual activities, and pain/discomfort.
A Ruby API to query the Ensembl database for genomic features.
Strozzi, Francesco; Aerts, Jan
2011-04-01
The Ensembl database makes genomic features available via its Genome Browser. It is also possible to access the underlying data through a Perl API for advanced querying. We have developed a full-featured Ruby API to the Ensembl databases, providing the same functionality as the Perl interface with additional features. A single Ruby API is used to access different releases of the Ensembl databases and is also able to query multi-species databases. Most functionality of the API is provided using the ActiveRecord pattern. The library depends on introspection to make it release independent. The API is available through the Rubygem system and can be installed with the command gem install ruby-ensembl-api.
First Identification of Nosema Ceranae (Microsporidia Infecting Apis Mellifera in Venezuela
Directory of Open Access Journals (Sweden)
Porrini Leonardo P.
2017-06-01
Full Text Available Nosema ceranae is a pathogen of Apis mellifera, which seems to have jumped from its original host Asiatic honey bee Apis ceranae. Nosemosis which affects the honey bee Apis mellifera is caused by two parasitic fungi described as etiologic agents of the disease. Nosema apis was the only microsporidian infection identified in A. mellifera until N. ceranae in Taiwan and Europe. Nosema spp. positive samples of adult worker bees from the Venezuelean state of Lara were determined through light microscopy of spores. Samples were then tested to determine Nosema species (N.apis/N.ceranae using previously reported PCR primers for the 16S rRNA gene. A multiplex PCR assay was used to differentiate both N. apis and N. ceranae species. Only N. ceranae was found in the analyzed samples and the percentage of infected foragers fluctuated between 18% and 60%.
Sierra Omar Danilo; Insuasty Torres Jennyfer
2004-01-01
An index measuring the aggressiveness among ten colonies of Apis mellifera was elaborated based on the third generation synthetic indices by Charum et al. (1999). The index values are subject to a fixed parameter used as the beginning or standard value, and correspond to the aggressive features of some Africans colonies studied by Rothenbuler et al. (1968). In the ten colonies the index values are notably smaller than those of African colonies and are biased to the lowest values. This indicat...
Shi, Yuan Yuan; Sun, Liang Xian; Huang, Zachary Y; Wu, Xiao Bo; Zhu, Yong Qiang; Zheng, Hua Jun; Zeng, Zhi Jiang
2013-01-01
The Eastern honey bee, Apis cerana Fabricius, is distributed in southern and eastern Asia, from India and China to Korea and Japan and southeast to the Moluccas. This species is also widely kept for honey production besides Apis mellifera. Apis cerana is also a model organism for studying social behavior, caste determination, mating biology, sexual selection, and host-parasite interactions. Few resources are available for molecular research in this species, and a linkage map was never constructed. A linkage map is a prerequisite for quantitative trait loci mapping and for analyzing genome structure. We used the Chinese honey bee, Apis cerana cerana to construct the first linkage map in the Eastern honey bee. F2 workers (N = 103) were genotyped for 126,990 single nucleotide polymorphisms (SNPs). After filtering low quality and those not passing the Mendel test, we obtained 3,000 SNPs, 1,535 of these were informative and used to construct a linkage map. The preliminary map contains 19 linkage groups, we then mapped the 19 linkage groups to 16 chromosomes by comparing the markers to the genome of A. mellfiera. The final map contains 16 linkage groups with a total of 1,535 markers. The total genetic distance is 3,942.7 centimorgans (cM) with the largest linkage group (180 loci) measuring 574.5 cM. Average marker interval for all markers across the 16 linkage groups is 2.6 cM. We constructed a high density linkage map for A. c. cerana with 1,535 markers. Because the map is based on SNP markers, it will enable easier and faster genotyping assays than randomly amplified polymorphic DNA or microsatellite based maps used in A. mellifera.
Directory of Open Access Journals (Sweden)
Yuan Yuan Shi
Full Text Available BACKGROUND: The Eastern honey bee, Apis cerana Fabricius, is distributed in southern and eastern Asia, from India and China to Korea and Japan and southeast to the Moluccas. This species is also widely kept for honey production besides Apis mellifera. Apis cerana is also a model organism for studying social behavior, caste determination, mating biology, sexual selection, and host-parasite interactions. Few resources are available for molecular research in this species, and a linkage map was never constructed. A linkage map is a prerequisite for quantitative trait loci mapping and for analyzing genome structure. We used the Chinese honey bee, Apis cerana cerana to construct the first linkage map in the Eastern honey bee. RESULTS: F2 workers (N = 103 were genotyped for 126,990 single nucleotide polymorphisms (SNPs. After filtering low quality and those not passing the Mendel test, we obtained 3,000 SNPs, 1,535 of these were informative and used to construct a linkage map. The preliminary map contains 19 linkage groups, we then mapped the 19 linkage groups to 16 chromosomes by comparing the markers to the genome of A. mellfiera. The final map contains 16 linkage groups with a total of 1,535 markers. The total genetic distance is 3,942.7 centimorgans (cM with the largest linkage group (180 loci measuring 574.5 cM. Average marker interval for all markers across the 16 linkage groups is 2.6 cM. CONCLUSION: We constructed a high density linkage map for A. c. cerana with 1,535 markers. Because the map is based on SNP markers, it will enable easier and faster genotyping assays than randomly amplified polymorphic DNA or microsatellite based maps used in A. mellifera.
Tri Juliyanto, Ilham
2015-01-01
: Quality Improvement Strategy Railway Transportation Services (Studi pada PT. Kereta Api Indonesia (Persero) Daerah Operasi VII Madiun). This research intended to discover the strategic which applied by PT. KAI DAOP VII Madiun for increasing the quality of service in train transportation, supporting factor and inhibiting factor strategic in increase of quality of service of PT. KAI DAOP VII Madiun. In this research, uses descriptive research with qualitative approach and use analysis method ...
Disayathanoowat, Terd; Young, John Peter W; Helgason, Thorunn; Chantawannakul, Panuwan
2012-02-01
This study investigated bacterial community structures in the midguts of Apis mellifera and Apis cerana in Thailand to understand how bacterial communities develop in Apis species. The bacterial species present in replicate colonies from different locations and life stages were analysed. PCR amplification of bacterial 16S rRNA gene fragments and terminal restriction fragment length polymorphism analyses revealed a total of 16 distinct terminal restriction fragments (T-RFs), 12 of which were shared between A. mellifera and A. cerana populations. The T-RFs were affiliated to Beta- and Gammaproteobacteria, Firmicutes and Actinomycetes. The Gammaproteobacteria were found to be common in all stages of honey bee, but in addition, the Firmicutes group was found to be present in the worker bees. Bacterial community structure showed no difference amongst the replicate colonies, but was affected to some degree by geographical location, life stage and species of honey bees. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.
40 CFR Appendix 7 to Subpart A of... - API Recommended Practice 13B-2
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false API Recommended Practice 13B-2 7..., Subpt. A, App. 7 Appendix 7 to Subpart A of Part 435—API Recommended Practice 13B-2 1. Description a...—Sampling of Cuttings Discharge Streams for use with API Recommended Practice 13B-2 1.0Sampling Locations 1...
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
A Monte Carlo modeling alternative for the API Gamma Ray Calibration Facility.
Galford, J E
2017-04-01
The gamma ray pit at the API Calibration Facility, located on the University of Houston campus, defines the API unit for natural gamma ray logs used throughout the petroleum logging industry. Future use of the facility is uncertain. An alternative method is proposed to preserve the gamma ray API unit definition as an industry standard by using Monte Carlo modeling to obtain accurate counting rate-to-API unit conversion factors for gross-counting and spectral gamma ray tool designs. Copyright © 2017 Elsevier Ltd. All rights reserved.
A Shellcode Detection Method Based on Full Native API Sequence and Support Vector Machine
Cheng, Yixuan; Fan, Wenqing; Huang, Wei; An, Jing
2017-09-01
Dynamic monitoring the behavior of a program is widely used to discriminate between benign program and malware. It is usually based on the dynamic characteristics of a program, such as API call sequence or API call frequency to judge. The key innovation of this paper is to consider the full Native API sequence and use the support vector machine to detect the shellcode. We also use the Markov chain to extract and digitize Native API sequence features. Our experimental results show that the method proposed in this paper has high accuracy and low detection rate.
Luangpaiboon, P.
2009-10-01
Many entrepreneurs face to extreme conditions for instances; costs, quality, sales and services. Moreover, technology has always been intertwined with our demands. Then almost manufacturers or assembling lines adopt it and come out with more complicated process inevitably. At this stage, products and service improvement need to be shifted from competitors with sustainability. So, a simulated process optimisation is an alternative way for solving huge and complex problems. Metaheuristics are sequential processes that perform exploration and exploitation in the solution space aiming to efficiently find near optimal solutions with natural intelligence as a source of inspiration. One of the most well-known metaheuristics is called Ant Colony Optimisation, ACO. This paper is conducted to give an aid in complicatedness of using ACO in terms of its parameters: number of iterations, ants and moves. Proper levels of these parameters are analysed on eight noisy continuous non-linear continuous response surfaces. Considering the solution space in a specified region, some surfaces contain global optimum and multiple local optimums and some are with a curved ridge. ACO parameters are determined through hybridisations of Modified Simplex and Simulated Annealing methods on the path of Steepest Ascent, SAM. SAM was introduced to recommend preferable levels of ACO parameters via statistically significant regression analysis and Taguchi's signal to noise ratio. Other performance achievements include minimax and mean squared error measures. A series of computational experiments using each algorithm were conducted. Experimental results were analysed in terms of mean, design points and best so far solutions. It was found that results obtained from a hybridisation with stochastic procedures of Simulated Annealing method were better than that using Modified Simplex algorithm. However, the average execution time of experimental runs and number of design points using hybridisations were
Wang, Cai-Xia; Chen, Yuan-Yuan; Yang, Feng; Yang, Fan; Guo, Jin-Tao; Sun, Siyu; Fan, Ling
2017-01-01
Needle-based confocal laser endomicroscopy (nCLE) under endoscopic ultrasound guidance is a newly developed imaging technique for pancreatic lesions and lymph nodes, enabling a subcellular level of resolution. The confocal miniprobe is an invasive instrument designed to be reused up to 10 times. Therefore, a method that ensures the complete elimination of microbial contaminants on the device is necessary. We studied the bactericidal efficacy of the Stella™ system, which purports to achieve this objective. The surfaces of three nCLE miniprobes were contaminated with suspensions of Bacillus atrophaeus (ATCC9372). One probe was randomly selected to count the bacterial load on the surface. The other two probes were manually cleaned and rinsed. One probe was randomly selected to count bacteria on the surface, and the other probe was sterilized using the Stella™ 5L endoscopic sterilization system before obtaining the bacterial count. The process was repeated for 20 cycles to evaluate the microbicidal efficacy of the Stella™ 5L endoscopic sterilization system. These miniprobes were immersed in the Stella Fuse disinfectant for 72 h. After the 72 h of immersion, the weight loss of probes was determined using a high precision electronic scale to examine corrosion following disinfection. The change in image quality was evaluated by an endoscopist. From an initial contamination level of 4.48 × 106 ± 1.57 × 106 cfu/mL on the surface of the probes, the bacterial count was reduced to 4.25 × 102 ± 1.95 × 102 cfu/mL after manual cleaning (including enzyme washing), and no microorganisms were recovered after 20 cycles with the Stella™ 5L system. The probe weights before and after 72 h of immersion were 45.769 (45.768-45.771) g and 45.762 (45.752-45.768) g, respectively. No change in image quality was observed. This study shows that the Stella™ 5L system is capable of the complete elimination of microorganism contamination in a short period and avoids the toxicity of
Certeza diagnóstica en la mortalidad de una población de pacientes con trasplante cardíaco
Directory of Open Access Journals (Sweden)
Marcos Amuchástegui
2008-01-01
Full Text Available RESUMENIntroducciónA pesar de que la morbimortalidad en el trasplante cardíaco ha sido motivo de extensoanálisis, la mayoría de los estudios y registros de mortalidad en pacientes trasplantados sebasan sobre datos clínicos. En la bibliografía existen comunicaciones aisladas de autopsiasen pacientes con trasplante cardíaco.ObjetivoDeterminar la importancia de la realización de estudios anatomopatológicos para el diagnósticode causa de muerte en un programa de trasplante cardíaco.Material y métodosSe incluyeron todos los pacientes con trasplante cardíaco fallecidos entre enero 1990 y enero2005. El diagnóstico definitivo de la causa de muerte fue corroborado por autopsia obiopsia de órgano sólido. Las causas de muerte evaluadas fueron falla precoz del injerto,rechazo celular, infección, enfermedad vascular del injerto, neoplasia y otros.ResultadosDurante el período en estudio 73 pacientes fueron sometidos a trasplante cardíaco; de ellos,fallecieron 31. Se obtuvieron 12 autopsias y 7 biopsias de órgano sólido que certificaron lacausa de muerte (61%. La causa de muerte más frecuente fue el rechazo celular mayor degrado III. En el 12,9%, la anatomía patológica difirió de la sospecha clínica de la causa demuerte.ConclusiónLa información clinicopatológica derivada de estudios post mortem es un indicador de nuestrarealidad asistencial y se constituye en un pilar fundamental para el conocimiento y elmanejo futuro de los pacientes trasplantados, por lo que consideramos que la realización deautopsias en estos pacientes es de vital importancia.REV ARGENT CARDIOL 2008;76:292-294.
The "no problems"-problem: an empirical analysis of ceiling effects on the EQ-5D 5L.
Konnopka, Alexander; Koenig, Hans-Helmut
2017-08-01
To analyze the association between ceiling effects on the EQ-5D 5L and morbidity in a general population sample. We used a cross-sectional sample of the German general population (n = 5007) to describe the frequency of health state "11111" and "no problems"-answers on the five single dimensions stratified by the number of diseases for which participants utilized health care during the last 6 months. For the five single dimensions we also used specific criteria to analyze their discriminative ability. A logit-model was applied for a multivariate analysis of ceiling effects. 31% of participants reported the health state "11111." This percentage strongly decreased with increasing morbidity, down to 4.9% if four or more diseases were present. The dimensions "mobility," "usual activities," and "pain/discomfort" showed good discriminative abilities. The dimensions "anxiety/depression" and "self -care" were able to discriminate between different levels of morbidity, but nevertheless showed strong ceiling effects, in particular "self-care." When analyzing ceiling effects of the EQ-5D 5L, one has to draw attention to morbidity since high proportions of participants indicating the best health state might result from being healthy regarding the dimensions assessed by the EQ-5D, in particular in general population datasets.
Directory of Open Access Journals (Sweden)
Manuel B. Huber
2016-03-01
Full Text Available Health-related quality of life (HRQoL is a key measure for evaluating health status in populations. Using the recent EQ-5D-5L for measurement, this study analyzed quality of life results and their stability over consecutive population surveys. Three cross-section surveys for representative samples of the general German population from 2012, 2013, and 2014 were evaluated using the EQ-5D-5L descriptive system and valuation by the Visual Analog Scale (VAS. Aggregated sample size reached 6074. The dimension with the highest prevalence of problems was pain/discomfort (31.7%. Compared with 2012 (59.3%, the percentage of participants in the best health state increased slightly in 2013 (63.4% and 2014 (62%. Over the 3-year period, diabetes and heart disease had the strongest negative influence on mean VAS result. The number of reported chronic diseases cumulatively reduced mean VAS. Extreme problems in one or more dimensions were stated by only 0.1%–0.2% of patients. Of the potential 247 health states with a problem score ≥20, only six were observed in the aggregated sample. HRQoL results were fairly stable over the 3 years, but the share of the population with no problems was not. Results from the aggregated sample may serve as updated reference values for the general German population.
Pelaksanaan Peraturan Partisipasi Masyarakat dalam Penanggulangan Bencana Gunung Api Merapi
Directory of Open Access Journals (Sweden)
Heribertus Jaka Triyana
2012-02-01
Full Text Available This paper describes the implementation of the public participation rule in the disaster management of Merapi volcano. The regulation desires for a shift of paradigm from centralized disaster management to participative disaster management. This study shows the government has not shifted from the old paradigm of centralized disaster management. Tulisan ini menggambarkan pelaksanaan aturan partisipasi masyarakat dalam penanggulangan bencana gunung api Merapi. Peraturan menginginkan pergeseran paradigma penanggulangan bencana dari sentralistik ke penanggulangan bencana yang partisipatoris. Penelitian ini menunjukkan Pemerintah belum sepenuhnya beralih dari paradigma penanggulangan bencana sentralistis.
Entwicklung von Microservices mit zusammensetzbaren API-Bausteinen
Speth, Sandro
2017-01-01
Der Microservice-Architekturstil findet heute im Bereich des Service Computing häufig Anwendung. Anwendungen, die diesem Architekturstil folgen, werden als menge von „kleinen“ undabhängigen Diensten implementiert. Jeder Dienst ist für eine überschaubare und klar definierte Geschäftsfunktionalität zuständig. Dabei kummunizieren diese sogenannten Microservices nicht nur untereinander über Application Programming Interfaces (APIs), sondern stellen den Benutzern der Anwendung ausgewählte Funkt...
The Ensembl REST API: Ensembl Data for Any Language.
Yates, Andrew; Beal, Kathryn; Keenan, Stephen; McLaren, William; Pignatelli, Miguel; Ritchie, Graham R S; Ruffier, Magali; Taylor, Kieron; Vullo, Alessandro; Flicek, Paul
2015-01-01
We present a Web service to access Ensembl data using Representational State Transfer (REST). The Ensembl REST server enables the easy retrieval of a wide range of Ensembl data by most programming languages, using standard formats such as JSON and FASTA while minimizing client work. We also introduce bindings to the popular Ensembl Variant Effect Predictor tool permitting large-scale programmatic variant analysis independent of any specific programming language. The Ensembl REST API can be accessed at http://rest.ensembl.org and source code is freely available under an Apache 2.0 license from http://github.com/Ensembl/ensembl-rest. © The Author 2014. Published by Oxford University Press.
Directory of Open Access Journals (Sweden)
Jaime Casanova Soeiro Junior
2013-06-01
Full Text Available Este trabalho enfoca o desenvolvimento dos aços API para tubulações desde o aço API 5L X42, desenvolvido em 1948, através de laminação a quente seguida de tratamento térmico. Desde então foram feitos diferentes desenvolvimentos visando aumentar a resistência mecânica e a tenacidade, além de melhorar a soldabilidade. Entre eles, a adição de elementos de liga, produzindo os aços ARBL e a utilização de rotas de processamento termomecânico durante a laminação. Inicialmente a rota utilizada era a laminação a quente controlada (TMCR, com utilização de elemento microligante como Nb para os aços X60 e o conjunto Nb e V para os aços X65 e X70, associado a uma redução do teor de carbono. Posteriormente foi implantada a rota de fabricação do aço por laminação controlada seguida de resfriamento controlado (TMCP, com redução de carbono e adição de Nb e Ti para os aços X80, e adições de Mo, Nb, Be Ti para os X100. A redução do carbono foi motivada também para melhorar a sua soldabilidade e, por este motivo, estes aços são soldados por diferentes processos de soldagem, como o eletrodo revestido. Desenvolvimentos recentes com raiz feita com MAG-TC e enchimento com arame tubular tem dado resultados animadores.This paper is a brief history on the development of pipelines steels since the API 5L X42 steel, developed in 1948 by hot rolling followed by heat treatment. Subsequently different developments were made to increase the strength and toughness of these materials, and to improve their weldability. Among them, the addition of microalloying elements, producing HSLA steels and thermomechanical processing routes during hot rolling. Initially the route used was the controlled hot rolling (TMCR, together with microalloying element such as Nb for X60 steel and Nb plus V for X65 and X70 steels, associated with a reduction in carbon content. Later, the thermomechanical controlled process (TMCP manufacturing route was
National Research Council Canada - National Science Library
Jayakodi, Murukarthick; Jung, Je Won; Park, Doori; Ahn, Young-Joon; Lee, Sang-Choon; Shin, Sang-Yoon; Shin, Chanseok; Yang, Tae-Jin; Kwon, Hyung Wook
2015-01-01
.... In an attempt to identify long intergenic non-coding RNAs (lincRNAs) and their possible involvement in honey bee development and diseases, we analyzed RNA-seq datasets generated from Asian honey bee (Apis cerana...
Characteristics of honey bee and non-Apis bee (Hymenoptera) farms in Canada.
Daly, Z; Melhim, A; Weersink, A
2012-08-01
Here, we present a farm-level, Canada-wide analysis of Canadian bee farms in 2006; this article is the first report to distinguish between honey bee (Apis mellifera L.) farms and non-Apis bee (Hymenoptera) farms. Farms are characterized according to bee species, bee stocks, and whether the farm makes 50% or more of gross sales from bee-related activities. Farm characteristics, including bee stocks, gross sales, capital investments, land base, specialization, location, and operator demographics, are reported for the different farm types and sizes. Non-Apis bee farms are revealed to be a nontrivial part of the Canadian bee industry: 21.2% of Canadian bee farms have non-Apis bees and 16.6% have exclusively non-Apis bees. Important differences between honey bee farms and non-Apis bee farms also are found. These differences include the more land-intensive nature of non-Apis bee farms and the finding that non-Apis bee farms have greater diversity in terms of their primary commodity, even at higher bee stock levels.
A Five Year Review OF API20E Bacteria Identification System's ...
African Journals Online (AJOL)
Objectives: To assess the performance of the API20E bacteria identification system at a teaching hospital in Kenya. Design: Retrospective study. Setting: The microbiology laboratoryoratory of the Aga Khan University teaching Hospital. Subjects: One thousand six hundred and fifty eight API20E records. Main outcome ...
Improvements and extensions to API 618 related to pulsation and mechanical response studies
Eijk, A.; Smeulers, J.P.M.; Blodgett, L.E.; Smalley, A.J.
1999-01-01
Purchasers of reciprocating compressors need a standard to help ensure reliable installations. The PNEUROP standard evolved in Europe, and the API 618 Standard in the U.S.A. Frequent application and generally good experience, worldwide, have led to four releases of API 618, the last dated June 1995.
Influence of humidity on the phase behavior of API/polymer formulations.
Prudic, Anke; Ji, Yuanhui; Luebbert, Christian; Sadowski, Gabriele
2015-08-01
Amorphous formulations of APIs in polymers tend to absorb water from the atmosphere. This absorption of water can induce API recrystallization, leading to reduced long-term stability during storage. In this work, the phase behavior of different formulations was investigated as a function of relative humidity. Indomethacin and naproxen were chosen as model APIs and poly(vinyl pyrrolidone) (PVP) and poly(vinyl pyrrolidone-co-vinyl acetate) (PVPVA64) as excipients. The formulations were prepared by spray drying. The water sorption in pure polymers and in formulations was measured at 25°C and at different values of relative humidity (RH=25%, 50% and 75%). Most water was absorbed in PVP-containing systems, and water sorption was decreasing with increasing API content. These trends could also be predicted in good agreement with the experimental data using the thermodynamic model PC-SAFT. Furthermore, the effect of absorbed water on API solubility in the polymer and on the glass-transition temperature of the formulations was predicted with PC-SAFT and the Gordon-Taylor equation, respectively. The absorbed water was found to significantly decrease the API solubility in the polymer as well as the glass-transition temperature of the formulation. Based on a quantitative modeling of the API/polymer phase diagrams as a function of relative humidity, appropriate API/polymer compositions can now be selected to ensure long-term stable amorphous formulations at given storage conditions. Copyright © 2015 Elsevier B.V. All rights reserved.
Macelignan inhibits bee pathogenic fungi Ascophaera apis growth through HOG1 pathway
Directory of Open Access Journals (Sweden)
Y.K. Shin
2016-01-01
Full Text Available Ascosphaera apis is a bee pathogen that causes bee larvae infection disease, to which treatment is not yet well investigated. The aim of this study was to investigate antifungal susceptibility in vitro against A. apis and to identify a new antifungal agent for this pathogen through minimal inhibitory concentration (MIC assay and western blot analysis. Macelignan had 1.56 and 3.125 μg/mL MIC against A. apis after 24 and 48 h, respectively, exhibiting the strongest growth inhibition against A. apis among the tested compounds (corosolic acid, dehydrocostus lactone, loganic acid, tracheloside, fangchinoline and emodin-8-O-β-D-glucopyranoside. Furthermore, macelignan showed a narrow-ranged spectrum against various fungal strains without any mammalian cell cytotoxicity. In spite of miconazole having powerful broad-ranged anti-fungal activity including A. apis, it demonstrated strong cytotoxicity. Therefore, even if macelignan alone was effective as an antifungal agent to treat A. apis, combined treatment with miconazole was more useful to overcome toxicity, drug resistance occurrence and cost effectiveness. Finally, HOG1 was revealed as a target molecule of macelignan in the anti-A. apis activity by inhibiting phosphorylation using S. cerevisiae as a model system. Based on our results, macelignan, a food-grade antimicrobial compound, would be an effective antifungal agent against A. apis infection in bees.
Park, Doori; Jung, Je Won; Lee, Mi Ok; Lee, Si Young; Kim, Boyun; Jin, Hye Jun; Kim, Jiyoung; Ahn, Young-Joon; Lee, Ki Won; Song, Yong Sang; Hong, Seunghun; Womack, James E; Kwon, Hyung Wook
2014-03-01
Insect-derived antimicrobial peptides (AMPs) have diverse effects on antimicrobial properties and pharmacological activities such as anti-inflammation and anticancer properties. Naturally occurring genetic polymorphism have a direct and/or indirect influence on pharmacological effect of AMPs, therefore information on single nucleotide polymorphism (SNP) occurring in natural AMPs provides an important clue to therapeutic applications. Here we identified nucleotide polymorphisms in melittin gene of honey bee populations, which is one of the potent AMP in bee venoms. We found that the novel SNP of melittin gene exists in these two honey bee species, Apis mellifera and Apis cerana. Nine polymorphisms were identified within the coding region of the melittin gene, of which one polymorphism that resulted in serine (Ser) to asparagine (Asp) substitution that can potentially effect on biological activities of melittin peptide. Serine-substituted melittin (Mel-S) showed more cytotoxic effect than asparagine-substituted melittin (Mel-N) against E. coli. Also, Mel-N and Mel-S had different inhibitory effects on the production of inflammatory factors such as IL-6 and TNF-α in BV-2 cells. Moreover, Mel-S showed stronger cytotoxic activities than Mel-N peptide against two human ovarian cancer cell lines. Using carbon nanotube-based transistor, we here characterized that Mel-S interacted with small unilamellar liposomes more strongly than Mel-N. Taken together, our present study demonstrates that there exist different characteristics of the gene frequency and the biological activities of the melittin peptide in two honey bee species, Apis mellifera and A. cerana. Copyright © 2014 Elsevier Inc. All rights reserved.
Frick, Marcel; Fischer, Jörg; Helbling, Arthur; Ruëff, Franziska; Wieczorek, Dorothea; Ollert, Markus; Pfützner, Wolfgang; Müller, Sabine; Huss-Marp, Johannes; Dorn, Britta; Biedermann, Tilo; Lidholm, Jonas; Ruecker, Gerta; Bantleon, Frank; Miehe, Michaela; Spillner, Edzard; Jakob, Thilo
2016-12-01
Component resolution recently identified distinct sensitization profiles in honey bee venom (HBV) allergy, some of which were dominated by specific IgE to Api m 3 and/or Api m 10, which have been reported to be underrepresented in therapeutic HBV preparations. We performed a retrospective analysis of component-resolved sensitization profiles in HBV-allergic patients and association with treatment outcome. HBV-allergic patients who had undergone controlled honey bee sting challenge after at least 6 months of HBV immunotherapy (n = 115) were included and classified as responder (n = 79) or treatment failure (n = 36) on the basis of absence or presence of systemic allergic reactions upon sting challenge. IgE reactivity to a panel of HBV allergens was analyzed in sera obtained before immunotherapy and before sting challenge. No differences were observed between responders and nonresponders regarding levels of IgE sensitization to Api m 1, Api m 2, Api m 3, and Api m 5. In contrast, Api m 10 specific IgE was moderately but significantly increased in nonresponders. Predominant Api m 10 sensitization (>50% of specific IgE to HBV) was the best discriminator (specificity, 95%; sensitivity, 25%) with an odds ratio of 8.444 (2.127-33.53; P = .0013) for treatment failure. Some but not all therapeutic HBV preparations displayed a lack of Api m 10, whereas Api m 1 and Api m 3 immunoreactivity was comparable to that of crude HBV. In line with this, significant Api m 10 sIgG 4 induction was observed only in those patients who were treated with HBV in which Api m 10 was detectable. Component-resolved sensitization profiles in HBV allergy suggest predominant IgE sensitization to Api m 10 as a risk factor for treatment failure in HBV immunotherapy. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Randas J. V Batista
1995-06-01
Full Text Available No período de janeiro de 1990 a maio de 1995 foram operados com a técnica do autotransplante cardíaco 92 pacientes com cardiopatias complexas e arritmias supraventriculares, principalmente fibrilação atrial (n=89, reentrada (n=2, QT longo (n=1. O sexo feminino predominou (n=63. A idade variou de 18 a 76 anos (m=43. Os defeitos concomitantes foram: átrio esquerdo gigante (medido pelo ecocardiograma > 6 cm (n=65; átrio direito gigante (n=9; átrio esquerdo aumentado (4 cm (n=23; estenose mitral (n=46; insuficiência mitral (n=28; dupla lesão mitral (n=16; estenose aórtica (n=12; insuficiência aórtica (n=5; insuficiência tricúspide (n=78; trombose atrial (n=23; calcificação atrial (n=12; hipertensão pulmonar (n=86; fibroelastose biventricular (n=3; rotura atrioventricular (pós-troca de valva mitral (n=1; aneurisma da raiz aórtica (n=1; ventriculectomia parcial (n=8; 88 pacientes saíram do centro cirúrgico em ritmo sinusal e assim permaneceram; 6 precisaram de drogas inotrópicas e 3 de drogas antiarrítmicas. Todos os pacientes que apresentavam átrio esquerdo ou direito gigante com fibrilação atrial tiveram seus átrios reduzidos ao tamanho normal. Não houve mortalidade operatória e 6 evoluíram a óbito hospitalar. Na reavaliação aos seis meses de pós-operatório, os sobreviventes estavam bem, em ritmo sinusal. A técnica do autotransplante cardíaco facilita o reparo intracardíaco, proporciona a redução atrial e conseqüente retorno do paciente ao ritmo sinusal e abre novas perspectivas.From January 1990 to May 1995,92 patients with complex cardiac problems and supraventricular arrhythmias were operated upon with the technique of heart autotransplantation. The arrhythmias were: atrial fibrillation (n=89; reentry (n=2; long QT syndrome (n=1. Females predominated (n=63. The age varied from 18 to 76 years (m=43. Concomittant defects were: giant left atrium (> 6 cm measured by echo (n=65; giant right atrium (n=9; large
Kasthurirathne, Suranga N; Mamlin, Burke; Grieve, Grahame; Biondich, Paul
2015-01-01
Interoperability is essential to address limitations caused by the ad hoc implementation of clinical information systems and the distributed nature of modern medical care. The HL7 V2 and V3 standards have played a significant role in ensuring interoperability for healthcare. FHIR is a next generation standard created to address fundamental limitations in HL7 V2 and V3. FHIR is particularly relevant to OpenMRS, an Open Source Medical Record System widely used across emerging economies. FHIR has the potential to allow OpenMRS to move away from a bespoke, application specific API to a standards based API. We describe efforts to design and implement a FHIR based API for the OpenMRS platform. Lessons learned from this effort were used to define long term plans to transition from the legacy OpenMRS API to a FHIR based API that greatly reduces the learning curve for developers and helps enhance adhernce to standards.
Genetic variation in natural honeybee populations, Apis mellifera capensis
Hepburn, Randall; Neumann, Peter; Radloff, Sarah E.
2004-09-01
Genetic variation in honeybee, Apis mellifera, populations can be considerably influenced by breeding and commercial introductions, especially in areas with abundant beekeeping. However, in southern Africa apiculture is based on the capture of wild swarms, and queen rearing is virtually absent. Moreover, the introduction of European subspecies constantly failed in the Cape region. We therefore hypothesize a low human impact on genetic variation in populations of Cape honeybees, Apis mellifera capensis. A novel solution to studying genetic variation in honeybee populations based on thelytokous worker reproduction is applied to test this hypothesis. Environmental effects on metrical morphological characters of the phenotype are separated to obtain a genetic residual component. The genetic residuals are then re-calculated as coefficients of genetic variation. Characters measured included hair length on the abdomen, width and length of wax plate, and three wing angles. The data show for the first time that genetic variation in Cape honeybee populations is independent of beekeeping density and probably reflects naturally occurring processes such as gene flow due to topographic and climatic variation on a microscale.
The Effect of Altitude Conditions on the Particle Emissions of a J85-GE-5L Turbojet Engine
Rickey, June Elizabeth
1995-01-01
Particles from a J85-GE-5L turbojet engine were measured over a range of engine speeds at simulated altitude conditions ranging from near sea level to 45,000 ft and at flight Mach numbers of 0.5 and 0.8. Samples were collected from the engine by using a specially designed probe positioned several inches behind the exhaust nozzle. A differential mobility particle sizing system was used to determine particle size. Particle data measured at near sea-level conditions were compared with Navy Aircraft Environmental Support Office (AESO) particle data taken from a GE-J85-4A engine at a sea-level static condition. Particle data from the J85 engine were also compared with particle data from a J85 combustor at three different simulated altitudes.
Chen, Poyu; Lin, Keh-Chung; Liing, Rong-Jiuan; Wu, Ching-Yi; Chen, Chia-Ling; Chang, Ku-Chou
2016-06-01
To examine the criterion validity, responsiveness, and minimal clinically important difference (MCID) of the EuroQoL 5-Dimensions Questionnaire (EQ-5D-5L) and visual analog scale (EQ-VAS) in people receiving rehabilitation after stroke. The EQ-5D-5L, along with four criterion measures-the Medical Research Council scales for muscle strength, the Fugl-Meyer assessment, the functional independence measure, and the Stroke Impact Scale-was administered to 65 patients with stroke before and after 3- to 4-week therapy. Criterion validity was estimated using the Spearman correlation coefficient. Responsiveness was analyzed by the effect size, standardized response mean (SRM), and criterion responsiveness. The MCID was determined by anchor-based and distribution-based approaches. The percentage of patients exceeding the MCID was also reported. Concurrent validity of the EQ-Index was better compared with the EQ-VAS. The EQ-Index has better power for predicting the rehabilitation outcome in the activities of daily living than other motor-related outcome measures. The EQ-Index was moderately responsive to change (SRM = 0.63), whereas the EQ-VAS was only mildly responsive to change. The MCID estimation of the EQ-Index (the percentage of patients exceeding the MCID) was 0.10 (33.8 %) and 0.10 (33.8 %) based on the anchor-based and distribution-based approaches, respectively, and the estimation of EQ-VAS was 8.61 (41.5 %) and 10.82 (32.3 %). The EQ-Index has shown reasonable concurrent validity, limited predictive validity, and acceptable responsiveness for detecting the health-related quality of life in stroke patients undergoing rehabilitation, but not for EQ-VAS. Future research considering different recovery stages after stroke is warranted to validate these estimations.
The Ruby UCSC API: accessing the UCSC genome database using Ruby
Directory of Open Access Journals (Sweden)
Mishima Hiroyuki
2012-09-01
Full Text Available Abstract Background The University of California, Santa Cruz (UCSC genome database is among the most used sources of genomic annotation in human and other organisms. The database offers an excellent web-based graphical user interface (the UCSC genome browser and several means for programmatic queries. A simple application programming interface (API in a scripting language aimed at the biologist was however not yet available. Here, we present the Ruby UCSC API, a library to access the UCSC genome database using Ruby. Results The API is designed as a BioRuby plug-in and built on the ActiveRecord 3 framework for the object-relational mapping, making writing SQL statements unnecessary. The current version of the API supports databases of all organisms in the UCSC genome database including human, mammals, vertebrates, deuterostomes, insects, nematodes, and yeast. The API uses the bin index—if available—when querying for genomic intervals. The API also supports genomic sequence queries using locally downloaded *.2bit files that are not stored in the official MySQL database. The API is implemented in pure Ruby and is therefore available in different environments and with different Ruby interpreters (including JRuby. Conclusions Assisted by the straightforward object-oriented design of Ruby and ActiveRecord, the Ruby UCSC API will facilitate biologists to query the UCSC genome database programmatically. The API is available through the RubyGem system. Source code and documentation are available at https://github.com/misshie/bioruby-ucsc-api/ under the Ruby license. Feedback and help is provided via the website at http://rubyucscapi.userecho.com/.
The Ruby UCSC API: accessing the UCSC genome database using Ruby
2012-01-01
Background The University of California, Santa Cruz (UCSC) genome database is among the most used sources of genomic annotation in human and other organisms. The database offers an excellent web-based graphical user interface (the UCSC genome browser) and several means for programmatic queries. A simple application programming interface (API) in a scripting language aimed at the biologist was however not yet available. Here, we present the Ruby UCSC API, a library to access the UCSC genome database using Ruby. Results The API is designed as a BioRuby plug-in and built on the ActiveRecord 3 framework for the object-relational mapping, making writing SQL statements unnecessary. The current version of the API supports databases of all organisms in the UCSC genome database including human, mammals, vertebrates, deuterostomes, insects, nematodes, and yeast. The API uses the bin index—if available—when querying for genomic intervals. The API also supports genomic sequence queries using locally downloaded *.2bit files that are not stored in the official MySQL database. The API is implemented in pure Ruby and is therefore available in different environments and with different Ruby interpreters (including JRuby). Conclusions Assisted by the straightforward object-oriented design of Ruby and ActiveRecord, the Ruby UCSC API will facilitate biologists to query the UCSC genome database programmatically. The API is available through the RubyGem system. Source code and documentation are available at https://github.com/misshie/bioruby-ucsc-api/ under the Ruby license. Feedback and help is provided via the website at http://rubyucscapi.userecho.com/. PMID:22994508
The Ruby UCSC API: accessing the UCSC genome database using Ruby.
Mishima, Hiroyuki; Aerts, Jan; Katayama, Toshiaki; Bonnal, Raoul J P; Yoshiura, Koh-ichiro
2012-09-21
The University of California, Santa Cruz (UCSC) genome database is among the most used sources of genomic annotation in human and other organisms. The database offers an excellent web-based graphical user interface (the UCSC genome browser) and several means for programmatic queries. A simple application programming interface (API) in a scripting language aimed at the biologist was however not yet available. Here, we present the Ruby UCSC API, a library to access the UCSC genome database using Ruby. The API is designed as a BioRuby plug-in and built on the ActiveRecord 3 framework for the object-relational mapping, making writing SQL statements unnecessary. The current version of the API supports databases of all organisms in the UCSC genome database including human, mammals, vertebrates, deuterostomes, insects, nematodes, and yeast.The API uses the bin index-if available-when querying for genomic intervals. The API also supports genomic sequence queries using locally downloaded *.2bit files that are not stored in the official MySQL database. The API is implemented in pure Ruby and is therefore available in different environments and with different Ruby interpreters (including JRuby). Assisted by the straightforward object-oriented design of Ruby and ActiveRecord, the Ruby UCSC API will facilitate biologists to query the UCSC genome database programmatically. The API is available through the RubyGem system. Source code and documentation are available at https://github.com/misshie/bioruby-ucsc-api/ under the Ruby license. Feedback and help is provided via the website at http://rubyucscapi.userecho.com/.
Directory of Open Access Journals (Sweden)
Suzana M.F. Malheiros
2002-06-01
Full Text Available OBJECTIVE: Neurologic complications are known as important cause of morbidity and mortality in orthotopic heart transplantation. Our aim was to identify the frequency and outcome of neurologic complications after heart transplantation in a prospective observational study. METHOD: From September 93 to September 99, as part of our routine heart transplantation protocol all patients with end-stage cardiac failure were evaluated by the same neurologist before and at the time of any neurologic event (symptom or complaint after transplantation. RESULTS: Out of 120 candidates evaluated, 62 were successfully transplanted (53 male; median age 45.5 years, median follow-up 26.8 months. Fifteen patients (24% had ischemic, 22 (35% idiopathic, 24 (39% Chagas' disease and 1 (2% had congenital cardiomyopathy. Neurologic complications occurred in 19 patients (31%: tremor, severe headache, transient encephalopathy and seizures related to drug toxicity or metabolic changes in 13; peripheral neuropathy in 4; and spinal cord compression in two (metastatic prostate cancer and epidural abscess. No symptomatic postoperative stroke was observed. CONCLUSIONS: Although frequent, neurologic complications were seldom related to persistent neurologic disability or death. Most of the complications resulted from immunosuppression, however, CNS infection was rare. The absence of symptomatic stroke in our series may be related to the lower frequency of ischemic cardiomyopathy.OBJETIVO: Complicações neurológicas são frequentemente descritas como causa de morbidade e mortalidade em transplantes cardíacos. Nosso objetivo foi avaliar a frequência de complicações neurológicas em pacientes submetidos a transplantes cardíacos, bem como sua evolução, através de um estudo prospectivo observacional. MÉTODO: Todos os candidatos a transplantes cardíacos foram avaliados pelo mesmo neurologista, como parte do protocolo de rotina de avaliação pré-transplante no período de 9
Directory of Open Access Journals (Sweden)
Cecília Sales Pires
2007-10-01
Full Text Available OBJETIVO: Avaliar os achados oculares, pelo exame oftalmológico, em indivíduos que receberam transplante cardíaco, buscando especialmente investigar possíveis alterações na camada de fibras nervosas da retina com polarímetro de varredura a laser. MÉTODOS: Foram estudados 15 indivíduos que receberam transplante cardíaco no período de setembro de 2003 a julho de 2004. Todos foram submetidos a exame que constava de acuidade visual para longe (AVL, biomicroscopia, tonometria e fundoscopia. Onze pacientes foram submetidos ao analisador de fibras nervosas GDx. Doze eram do sexo masculino e a média da idade foi de 55,0 ± 13,5 anos. O tempo decorrido desde o transplante variou de 3 a 74 meses, com média de 29,7 ± 20,8 meses. RESULTADOS: A AVL com melhor correção foi igual ou melhor do que 20/40 em todos os pacientes. Em um deles observou-se a presença de catarata subcapsular posterior; em outro, nubéculas na córnea secundárias a quadro de herpes zoster. À fundoscopia pôde-se observar lesão cicatrizada sugestiva de retinocoroidite em um paciente. As alterações observadas à biomicroscopia e à fundoscopia eram esperadas devido à imunossupressão subseqüente ao transplante. Ao GDx observou-se perda de fibras da camada de fibras nervosas da retina superior em 12 dos 22 olhos avaliados. CONCLUSÃO: Os resultados apóiam a suposição de que antes ou durante o transplante cardíaco tenha havido diminuição no aporte de oxigênio à circulação retiniana, levando a perda parcial de fibras da retina.PURPOSE: To evaluate findings of ophthalmologic examinations in cardiac transplant recipients, searching especially for changes in the retinal nerve fiber layer by means of Scanning Laser Polarimetry. METHODS: Fifteen cardiac transplant recipients were examined from September 2003 to July 2004. All of them underwent ophthalmologic examination, which consisted of visual acuity (VA, biomicroscopy, tonometry and fundoscopy. Fiber layer
Síndrome de bajo gasto cardíaco en la tetralogía de Fallot
Directory of Open Access Journals (Sweden)
Lincoln de la Parte Pérez
2002-06-01
Full Text Available Se realiza un estudio retrospectivo de 200 niños operados de tetralogía de Fallot en el Cardiocentro del Hospital Pediátrico Universitario "William Soler" durante el período comprendido entre los años 1990 y 1993. Se observó una relación directamente proporcional entre el tiempo de pinzamiento aórtico (paro anóxico, el tiempo de circulación extracorpórea (CEC y el desarrollo del síndrome de bajo gasto cardíaco. La incidencia de bajo gasto cardíaco en los niños con tiempo de pinzamiento aórtico menor a los 30 min fue nula, en los pacientes con tiempo menor a los 60 min la incidencia fue del 23,2 % (40 pacientes. En los 24 pacientes que sufrieron procedimientos quirúrgicos prolongados y tiempo de pinzamiento aórtico mayor de 1 hora la incidencia fue del 95,8 %. En los pacientes con tiempo de CEC menor de 90 min la incidencia de bajo gasto cardíaco que de sólo el 9,75 %, en los niños con tiempo de CEC entre 91 y 105 min fue de 15,53 %, en los que necesitaron entre 106 y 120 min de CEC fue del 62,5 % y en los procedimientos quirúrgicos prolongados fue del 95,8 %. La mayoría de los pacientes respondió bien al tratamiento, aunque en un pequeño número de ellos se mantuvo la disfunción ventricular a pesar del tratamiento. Siete niños fallecieron en el posoperatorio para una mortalidad del 3,5 %.A retrospective study of 200 children with Tetralogy of Fallot, who were operated on the Cardiology Center of "William Soler" University Pediatric Hospital from 1990 to 1993, was performed. There was a direct proportional relation between time of holding aorta with forceps (anoxic arrest, time of extracorporeal circulation and the development of low cardiac output syndrome. The incidence of low cardiac output in children who underwent holding of aorta with forceps for less than 30 minutes was zero, but the same procedure applied in patients for less than 60 minutes, the incidence was 23,2%(40 patients. The 24 patients that underwent
Dosselli, Ryan; Grassl, Julia; Carson, Andrew; Simmons, Leigh W.; Baer, Boris
2016-01-01
Honey bees (Apis mellifera) host a wide range of parasites, some being known contributors towards dramatic colony losses as reported over recent years. To counter parasitic threats, honey bees possess effective immune systems. Because immune responses are predicted to cause substantial physiological costs for infected individuals, they are expected to trade off with other life history traits that ultimately affect the performance and fitness of the entire colony. Here, we tested whether the initial onset of an infection negatively impacts the flight behaviour of honey bee workers, which is an energetically demanding behaviour and a key component of foraging activities. To do this, we infected workers with the widespread fungal pathogen Nosema apis, which is recognised and killed by the honey bee immune system. We compared their survival and flight behaviour with non-infected individuals from the same cohort and colony using radio frequency identification tags (RFID). We found that over a time frame of four days post infection, Nosema did not increase mortality but workers quickly altered their flight behaviour and performed more flights of shorter duration. We conclude that parasitic infections influence foraging activities, which could reduce foraging ranges of colonies and impact their ability to provide pollination services. PMID:27827404
Dong, Shihao; Wen, Ping; Zhang, Qi; Li, Xinyu; Tan, Ken; Nieh, James
2017-03-01
In highly social bees, queen mandibular pheromone (QMP) is vital for colony life. Both Apis cerana (Ac) and Apis mellifera (Am) share an evolutionarily conserved set of QMP compounds: (E)-9-oxodec-2-enoic acid (9-ODA), (E)-9-hydroxydec-2-enoic acid (9-HDA), (E)-10-hydroxy-dec-2-enoic acid (10-HDA), 10-hydroxy-decanoic acid (10-HDAA), and methyl p-hydroxybenzoate (HOB) found at similar levels. However, evidence suggests there may be species-specific sensitivity differences to QMP compounds because Ac workers have higher levels of ovarian activation than Am workers. Using electroantennograms, we found species-specific sensitivity differences for a blend of the major QMP compounds and three individual compounds (9-HDA, 10-HDAA, and 10-HDA). As predicted, Am was more sensitive than Ac in all cases (1.3- to 2.7- fold higher responses). There were also species differences in worker retinue attraction to three compounds (9-HDA, HOB, and 10-HDA). In all significantly different cases, Am workers were 4.5- to 6.2-fold more strongly attracted than Ac workers were. Thus, Ac workers responded less strongly to QMP than Ac workers, and 9-HDA and 10-HDA consistently elicited stronger antennal and retinue formation responses.
Directory of Open Access Journals (Sweden)
Aguinaldo Figueiredo Freitas Jr
2012-09-01
Full Text Available FUNDAMENTO: A hipertensão pulmonar é associada ao pior prognóstico no pós-transplante cardíaco. O teste de reatividade pulmonar com Nitroprussiato de Sódio (NPS está associado a elevados índices de hipotensão arterial sistêmica, disfunção ventricular do enxerto transplantado e elevadas taxas de desqualificação para o transplante. OBJETIVO: Neste estudo, objetivou-se comparar os efeitos do Sildenafil (SIL e NPS sobre variáveis hemodinâmicas, neuro-hormonais e ecocardiográficas durante teste de reatividade pulmonar. MÉTODOS: Os pacientes foram submetidos, simultaneamente, ao cateterismo cardíaco direito, ao ecocardiograma e à dosagem de BNP e gasometria venosa, antes e após administração de NPS (1 - 2 µg/Kg/min ou SIL (100 mg, dose única. RESULTADOS: Ambos reduziram a hipertensão pulmonar, porém o nitrato promoveu hipotensão sistêmica significativa (Pressão Arterial Média - PAM: 85,2 vs. 69,8 mmHg, p < 0,001. Ambos reduziram as dimensões cardíacas e melhoraram a função cardíaca esquerda (NPS: 23,5 vs. 24,8 %, p = 0,02; SIL: 23,8 vs. 26 %, p < 0,001 e direita (SIL: 6,57 ± 2,08 vs. 8,11 ± 1,81 cm/s, p = 0,002; NPS: 6,64 ± 1,51 vs. 7,72 ± 1,44 cm/s, p = 0,003, medidas pela fração de ejeção ventricular esquerda e Doppler tecidual, respectivamente. O SIL, ao contrário do NPS, apresentou melhora no índice de saturação venosa de oxigênio, medido pela gasometria venosa. CONCLUSÃO: Sildenafil e NPS são vasodilatadores que reduzem, de forma significativa, a hipertensão pulmonar e a geometria cardíaca, além de melhorar a função biventricular. O NPS, ao contrário do SIL, esteve associado a hipotensão arterial sistêmica e piora da saturação venosa de oxigênio.
Directory of Open Access Journals (Sweden)
Joel Birman
2010-12-01
Full Text Available A intenção deste ensaio é esboçar a leitura da psicose maníaco-depressiva no Brasil, no começo do século XX. Destaca a transformação teórica ocorrida na psiquiatria brasileira, que se deslocou da tradição francesa para a alemã. Sublinha o modo como a problemática da histeria foi substituída pela da psicose maníaco-depressiva nesse contexto histórico.This essay examines the early twentieth-century interpretation of manic depressive psychosis in Brazil, during a moment when Brazilian psychiatry witnessed a theoretical shift from the French to German traditions. It calls special attention to how the problem of hysteria was replaced by manic depressive psychosis within this historical context.
Directory of Open Access Journals (Sweden)
Luis Almenar Bonet
2008-07-01
Conclusiones: La supervivencia obtenida en España con el TC, sobre todo en los últimos años, sitúa al trasplante cardíaco como el mejor tratamiento ante cardiopatías terminales en situación funcional avanzada y sin otras opciones médicas o quirúrgicas establecidas.
Directory of Open Access Journals (Sweden)
Luis Almenar Bonet
2009-07-01
Conclusiones: La supervivencia obtenida en España con el TC, sobre todo en los últimos años, sitúa al trasplante cardíaco como el tratamiento de elección para cardiopatías irreversibles en situación funcional avanzada y sin otras opciones médicas o quirúrgicas establecidas.
Directory of Open Access Journals (Sweden)
Singhal Nalini
2012-06-01
Full Text Available Abstract Background The Acute Care of at-Risk Newborns (ACoRN program was developed in Canada for trained health care providers for the identification and management of newborns who are at-risk and/or become unwell in the first few hours or days after birth. The ACoRN process follows an 8-step framework that enables the evaluation and management of babies irrespective of the experience or expertise of the caregiving individual or team. This study assesses the applicability of the program to Chinese pediatric practitioners. Methods Course content and educational materials were translated from English into Chinese by bilingual neonatal practitioners. Confidence and knowledge questionnaires were developed and reviewed for face and content validity by a team of ACoRN instructors. Bilingual Chinese instructors were trained at the tertiary perinatal centre in Hangzhou Zhejiang to deliver the course at 15 level II county hospitals. Participants completed pre- and post-course confidence and knowledge questionnaires and provided feedback through post-course focus groups. Results 216 physicians and nurses were trained. Confidence and knowledge relating to neonatal stabilization improved significantly following the courses. Participants rated course utility and function between 4.2 and 4.6/5 on all items. Pre/post measures of confidence were significantly correlated with post course knowledge. Focus group data supported the perceived value of the program and recommended course adjustments to include pre-course reading, and increased content related to simulation, communication skills, and management of respiratory illness and jaundice. Conclusions ACoRN, a Canadian educational program, appears to be well received by Chinese health care providers and results in improved knowledge and confidence. International program adaptation for use by health care professionals requires structured and systematic evaluation to ensure that the program meets the needs of
Measurement properties of the EQ-5D-5L compared to the EQ-5D-3L across eight patient groups
DEFF Research Database (Denmark)
Janssen, M F; Pickard, A Simon; Golicki, Dominik
2012-01-01
PURPOSE: The aim of this study was to assess the measurement properties of the 5-level classification system of the EQ-5D (5L), in comparison with the 3-level EQ-5D (3L). METHODS: Participants (n = 3,919) from six countries, including eight patient groups with chronic conditions (cardiovascular......), redistribution properties, ceiling, discriminatory power, convergent validity, and known-groups validity. RESULTS: Missing values were on average 0.8 % for 5L and 1.3 % for 3L. In total, 2.9 % of responses were inconsistent between 5L and 3L. Redistribution from 3L to 5L using EQ dimension-specific rating scales...... of the 3-level system which improves upon the measurement properties, reducing the ceiling while improving discriminatory power and establishing convergent and known-groups validity....
THIR/Nimbus-5 Level 1 Meteorological Radiation Data at 6.7 microns V001 (THIRN5L1CH67) at GES DISC
National Aeronautics and Space Administration — THIRN5L1CH67 is the Nimbus-5 Temperature-Humidity Infrared Radiometer (THIR) Level 1 Meteorological Radiation Data at 6.7 microns product and contains radiances...
THIR/Nimbus-5 Level 1 Meteorological Radiation Data at 11.5 microns V001 (THIRN5L1CH115) at GES DISC
National Aeronautics and Space Administration — THIRN5L1CH115 is the Nimbus-5 Temperature-Humidity Infrared Radiometer (THIR) Level 1 Meteorological Radiation Data at 11.5 microns product and contains radiances...
Caso clínico del Departamento de Psiquiatría: Trastorno afectivo bipolar 1, episodio maníaco
Directory of Open Access Journals (Sweden)
José Manuel Calvo Gómez
1995-04-01
Full Text Available Se trata de un paciente de 21 años con un cuadro clínico de una semana de evolución cuyas características satisfacen los criterios diagnósticos de la Cuarta Edición del Manual Estadístico y Diagnóstico de los Trastornos Mentales (DSM IV para trastorno afectivo bipolar 1,episodio maníaco severo con características psicóticas congruentes con el estado de ánimo. Criterios diagnósticos para trastorno afectivo bipolar 1: A. Actualmente (o recientemente en episodio maníaco. B. Ha existido previamente al menos un episodio depresivo mayor, episodio maníaco o episodio mixto. C. Los episodios afectivos de los criterios A y B no son producidos por un trastorno esquizoafectivo y no están superpuestos sobre esquizofrenia, trastorno esquizofreniforme, trastorno delirante, o trastorno psicótico no especificado en otro sitio.
Wang, Xiuyun; Zhao, Weitao; Wu, Xiangwei; Zhang, Tianhua; Liu, Yi; Zhang, Kai; Xiao, Yihong; Jiang, Lilong
2017-12-01
Mesoporous ACo2O4 (A = Cu, Ni and Mn) catalysts with high surface area were synthesized by a simple co-nanocasting approach using SBA-15 as a hard template. Their catalytic performances for total oxidation of benzene were tested and physicochemical properties were characterized in detail by means of XRD, N2 physisorption, TEM/HR-TEM, XPS, H2-TPR, O2-TPD-MS and in situ DRIFTS. The results demonstrate that benzene conversion in MnCo2O4 is more than 90% at 238 °C, which is higher than that of NiCo2O4 and CuCo2O4. The superior catalytic activity in MnCo2O4 is associated with its highly ordered mesoporous structure, higher surface Mn concentration and more active oxygen species. In situ DRIFTS results indicate that the lattice oxygen species are participated in the generation of carboxylates intermediate species over ACo2O4, while the surface active oxygen species favor the oxidation of carboxylates species to final products. All the results indicate that the oxidation of benzene in ACo2O4 catalysts consist of MvK and L-H mechanisms.
Apoptosis inhibitor 5 (API-5; AAC-11; FIF) is upregulated in human carcinomas in vivo.
Koci, Lenka; Chlebova, Katarina; Hyzdalova, Martina; Hofmanova, Jirina; Jira, Miroslav; Kysela, Petr; Kozubik, Alois; Kala, Zdenek; Krejci, Pavel
2012-04-01
Apoptosis inhibitor 5 (API-5) is a 55 kDa nuclear protein with potent anti-apoptotic signaling in tumor cells in vitro. In this study, we analyzed the expression of the API-5 protein in vivo in a broad spectrum of human carcinomas, including those of the colon, lung, liver, kidney, pancreas, stomach and esophagus using tumor tissues obtained during tumor resection. The results showed significant upregulation of API-5 expression in biopsies of lung (23%, n=13) and colorectal tumors (33%, n=27) in comparison with biopsies from the adjacent normal tissue. Colon cancer biopsies were used to study the cell populations with an upregulated level of expression of API-5 more closely. Using a magnetic bead-based selection for the epithelial cell marker EpCAM, we purified epithelial cells from the tumor and control tissues and analyzed these cells for API-5 expression by western immunoblotting. We observed that EpCAM-positive tumor cells expressed API-5 in all three colorectal cancer cases tested, in contrast to the control EpCAM-positive and EpCAM-negative cells isolated from the control or tumor tissues. These data suggest that the expression of the API-5 protein is upregulated in tumor epithelial cells and may serve as a prognostic marker in colorectal cancer.
api, A novel Medicago truncatula symbiotic mutant impaired in nodule primordium invasion.
Teillet, Alice; Garcia, Joseph; de Billy, Françoise; Gherardi, Michèle; Huguet, Thierry; Barker, David G; de Carvalho-Niebel, Fernanda; Journet, Etienne-Pascal
2008-05-01
Genetic approaches have proved to be extremely useful in dissecting the complex nitrogen-fixing Rhizobium-legume endosymbiotic association. Here we describe a novel Medicago truncatula mutant called api, whose primary phenotype is the blockage of rhizobial infection just prior to nodule primordium invasion, leading to the formation of large infection pockets within the cortex of noninvaded root outgrowths. The mutant api originally was identified as a double symbiotic mutant associated with a new allele (nip-3) of the NIP/LATD gene, following the screening of an ethylmethane sulphonate-mutagenized population. Detailed characterization of the segregating single api mutant showed that rhizobial infection is also defective at the earlier stage of infection thread (IT) initiation in root hairs, as well as later during IT growth in the small percentage of nodules which overcome the primordium invasion block. Neither modulating ethylene biosynthesis (with L-alpha-(2-aminoethoxyvinylglycine or 1-aminocyclopropane-1-carboxylic acid) nor reducing ethylene sensitivity in a skl genetic background alters the basic api phenotype, suggesting that API function is not closely linked to ethylene metabolism or signaling. Genetic mapping places the API gene on the upper arm of the M. truncatula linkage group 4, and epistasis analyses show that API functions downstream of BIT1/ERN1 and LIN and upstream of NIP/LATD and the DNF genes.
Investigation into process-induced de-aggregation of cohesive micronised API particles.
Hoffmann, Magnus; Wray, Patrick S; Gamble, John F; Tobyn, Mike
2015-09-30
The aim of this study was to assess the impact of unit processes on the de-aggregation of a cohesive micronised API within a pharmaceutical formulation using near-infrared chemical imaging. The impact on the primary API particles was also investigated using an image-based particle characterization system with integrated Raman analysis. The blended material was shown to contain large, API rich domains which were distributed in-homogeneously across the sample, suggesting that the blending process was not aggressive enough to disperse aggregates of micronised drug particles. Cone milling, routinely used to improve the homogeneity of such cohesive formulations, was observed to substantially reduce the number and size of API rich domains; however, several smaller API domains survived the milling process. Conveyance of the cone milled formulation through the Alexanderwerk WP120 powder feed system completely dispersed all remaining aggregates. Importantly, powder feed transmission of the un-milled formulation was observed to produce an equally homogeneous API distribution. The size of the micronised primary drug particles remained unchanged during powder feed transmission. These findings provide further evidence that this powder feed system does induce shear, and is in fact better able to disperse aggregates of a cohesive micronised API within a blend than the blend-mill-blend step. Crown Copyright © 2015. Published by Elsevier B.V. All rights reserved.
Wang, Lingdi; Scott, Iain; Zhu, Lu; Wu, Kaiyuan; Han, Kim; Chen, Yong; Gucek, Marjan; Sack, Michael N
2017-09-12
The mitochondrial enriched GCN5-like 1 (GCN5L1) protein has been shown to modulate mitochondrial protein acetylation, mitochondrial content and mitochondrial retrograde signaling. Here we show that hepatic GCN5L1 ablation reduces fasting glucose levels and blunts hepatic gluconeogenesis without affecting systemic glucose tolerance. PEPCK and G6Pase transcript levels are downregulated in hepatocytes from GCN5L1 liver specific knockout mice and their upstream regulator, FoxO1 protein levels are decreased via proteasome-dependent degradation and via reactive oxygen species mediated ERK-1/2 phosphorylation. ERK inhibition restores FoxO1, gluconeogenic enzyme expression and glucose production. Reconstitution of mitochondrial-targeted GCN5L1 blunts mitochondrial ROS, ERK activation and increases FoxO1, gluconeogenic enzyme expression and hepatocyte glucose production. We suggest that mitochondrial GCN5L1 modulates post-translational control of FoxO1, regulates gluconeogenesis and controls metabolic pathways via mitochondrial ROS mediated ERK activation. Exploring mechanisms underpinning GCN5L1 mediated ROS signaling may expand our understanding of the role of mitochondria in gluconeogenesis control.Hepatic gluconeogenesis is tightly regulated at transcriptional level and is essential for survival during prolonged fasting. Here Wang et al. show that the mitochondrial enriched GCN5-like 1 protein controls hepatic glucose production by regulating FoxO1 protein levels via proteasome-dependent degradation and, in turn, gluconeogenic gene expression.
Asymmetrical coexistence of Nosema ceranae and Nosema apis in honey bees.
Chen, Yanping; Evans, Jay D; Zhou, Liang; Boncristiani, Humberto; Kimura, Kiyoshi; Xiao, Tieguang; Litkowski, A M; Pettis, Jeffery S
2009-07-01
Globalization has provided opportunities for parasites/pathogens to cross geographic boundaries and expand to new hosts. Recent studies showed that Nosema ceranae, originally considered a microsporidian parasite of Eastern honey bees, Apis cerana, is a disease agent of nosemosis in European honey bees, Apis mellifera, along with the resident species, Nosema apis. Further studies indicated that disease caused by N. ceranae in European honey bees is far more prevalent than that caused by N. apis. In order to gain more insight into the epidemiology of Nosema parasitism in honey bees, we conducted studies to investigate infection of Nosema in its original host, Eastern honey bees, using conventional PCR and duplex real time quantitative PCR methods. Our results showed that A. cerana was infected not only with N. ceranae as previously reported [Fries, I., Feng, F., Silva, A.D., Slemenda, S.B., Pieniazek, N.J., 1996. Nosema ceranae n. sp. (Microspora, Nosematidae), morphological and molecular characterization of a microsporidian parasite of the Asian honey bee Apis cerana (Hymenoptera, Apidae). Eur. J. Protistol. 32, 356-365], but also with N. apis. Both microsporidia produced single and mixed infections. Overall and at each location alone, the prevalence of N. ceranae was higher than that of N. apis. In all cases of mixed infections, the number of N. ceranae gene copies (corresponding to the parasite load) significantly out numbered those of N. apis. Phylogenetic analysis based on a variable region of small subunit ribosomal RNA (SSUrRNA) showed four distinct clades of N. apis and five clades of N. ceranae and that geographical distance does not appear to influence the genetic diversity of Nosema populations. The results from this study demonstrated that duplex real-time qPCR assay developed in this study is a valuable tool for quantitative measurement of Nosema and can be used to monitor the progression of microsprodian infections of honey bees in a timely and cost
Improving molecular discrimination of Nosema apis and Nosema ceranae.
Carletto, Jérôme; Blanchard, Philippe; Gauthier, Aurélie; Schurr, Frank; Chauzat, Marie-Pierre; Ribière, Magali
2013-05-01
Nosema apis and Nosema ceranae are the causative agents of nosemosis, a contagious honeybee disease that weakens bee colonies. The species are discriminated through several PCR-based methods including a multiplex PCR recommended by the World Organization for Animal Health (OIE). In this study, the OIE protocol was compared to two other PCR protocols using different PCR kits with the same primer pairs as described in OIE. The results showed that the three PCR protocols have similar sensitivity but only the kit dedicated to multiplex PCR could detect small quantities of one Nosema species when greater quantities of the other were also present. However, singleplex PCR methods are currently the most sensitive methods for discerning each species. These results have important implications for epidemiology and the understanding of the disease. Copyright © 2013 Elsevier Inc. All rights reserved.
Design of Continuous Reactor Systems for API Production
DEFF Research Database (Denmark)
Pedersen, Michael Jønch
engineering. A double Grignard addition (two different Grignard reagents) to a lactone was studied with continuous production in mind. The complexity of the reaction was investigated kinetically in order to optimize a potential flow setup. The investigation indicated that reaction temperatures below -40 °C....../S. The formation of a carbon-carbon bond between a tricyclic ketone and a Grignard reagent was the primary objective, this being the first step in GMP synthesis. The process was optimized to include one-step hydrolysis and dehydration, followed by phase separation of the product-containing organic phase, which...... was then precipitated with hydrogen chloride to obtain the final API. The Grignard reagent was also produced in a continuous laboratory setup involving handling of solid magnesium turnings. Likewise, the alkyl halide used in the formation of the Grignard reagent was produced continuously. The three segmented units were...
Chill sensitivity of honey bee, Apis mellifera, embryos.
Collins, Anita M; Mazur, Peter
2006-08-01
Improved methods for preservation of honey bee, Apis mellifera L., germplasm would be very welcome to beekeeping industry queen breeders. The introduction of two parasites and the emergence of an antibiotic resistant disease have increased demands for resistant stock. Techniques for artificial insemination of queens are available, and semen has been cryopreserved with limited success. However, cryopreservation of embryos for rearing queens would mesh well with current practices and also provide drones (haploid males). Eggs at five ages between twenty-four hours and sixty-two hours were exposed to 0, -6.6, and/or -15 degrees C for various times, and successful hatch measured. Honey bee embryos show chill sensitivity as do other insect embryos, and the rate of chill injury increases dramatically with decrease in holding temperature. The 48 h embryos in both groups showed the greatest tolerance to chilling, although 44 h embryos were only slightly less so.
API, Cloud computing, WebGIS and cartography
Directory of Open Access Journals (Sweden)
Andrea Favretto
2013-05-01
Full Text Available This paper explores some of the digital mapping processes available on the Internet in order to analyse their cartographic congruence. It will focus on WebGIS-based cartography in relation to what is produced using Mash-up site maps. These websites often use Googlebased maps in order to produce their own cartography. Thus, we can identify two main typologies of Internet mapping sites, which are characterized by the ownership or non-ownership of their cartographic bases. This paper will critically assess the cartography employed in the two different instances. A concise introduction to the Cloud Computing Internet propagated phenomenon is also premised in order to provide the reader with an accurate frame of reference. Cloud Computing has encouraged a significant Internet participation via the Application Programming Interface software (API, leading to mash-up cartographic websites.
Oxigenación de membrana extracorpórea para soporte cardíaco o respiratorio en adultos
Directory of Open Access Journals (Sweden)
Salvador Torregrosa
2009-04-01
Full Text Available La oxigenación de membrana extracorpórea (ECMO es un sistema de asistencia mecánica circulatoria y respiratoria extracorpórea de corta duración. Está indicado en el shock cardiogénico e insuficiencia respiratoria con compromiso vital de cualquier causa, cuando las medidas terapéuticas médicas o quirúrgicas convencionales, incluyendo el empleo del balón intraaórtico de contrapulsación, han fracasado. Sus ventajas respecto a otros sistemas de asistencia mecánica circulatoria son: 1 inicio rápido de la asistencia mediante canulación periférica; 2 es una técnica poco agresiva, por lo que es mejor tolerada en estos pacientes críticos; 3 al no necesitar toracotomía, permite continuar con las medidas de resucitación cardiopulmonar en los pacientes con parada cardíaca; 4 proporciona soporte pulmonar, univentricular o biventricular; 5 se ha mostrado eficaz como puente a una asistencia ventricular de larga duración o como puente a trasplante cardíaco, y 6 es mucho más económico que otros dispositivos de asistencia ventricular.
Directory of Open Access Journals (Sweden)
Amir Nikbakhsh
2017-12-01
Full Text Available One of the most important ways to reduce fossil fuel consumption and consequently reduce greenhouse gases and environmental pollution is the use of renewable energies such as water, sun, wind, etc. One of the most efficient ways to take advantages of the shallow flowing waters such as rivers and fountains in electrical power generation is the use of hydrodynamic screw in the direction of water flow. The design of the generator for this application results in environmental dangers decrease. On the other hand, it provides some part of electrical energy required for human beings. Generators in hydrodynamic renewable energy system ought to have features such as high efficiency, power density and reliability as well as low volume. Among various generators, the permanent magnet synchronous generator (PMSG meets these requirements very well. In this paper, first, analytical calculations and the design process of PMSG were explained. Then, the ant colony optimization (ACO was used for the optimization of design quantities. PMSG design optimization increased in efficiency and decreased in volume. By improving these two parameters in the designed PMSG, it gets very suitable to be used in hydrodynamic renewable energy system. Finally, the results of the optimized design of PMSG were validated through simulation of it in Maxwell software and applying finite element analysis (FEA. Also the final results have been compared to similar experimental researches results.
La asistencia ventricular mecánica como puente al trasplante cardíaco: fundamentos y objetivos
Directory of Open Access Journals (Sweden)
Carlos García Montero
2009-04-01
Full Text Available La introducción clínica de los dispositivos de tercera generación para asistencia cardiocirculatoria ha significado un notable avance en la terapia de los candidatos a trasplante cardíaco en fase de descompensación hemodinámica, mediante la modalidad conocida como puente al trasplante (PAT. La situación actual de dicha estrategia en nuestro país refleja una dispersión de criterios en cuanto a la selección de pacientes, indicación del dispositivo, manejo táctico de las opciones terapéuticas y, especialmente, detección del momento adecuado del trasplante. El presente trabajo: a analiza las características del régimen a flujo continuo y sus consecuencias sobre distintos órganos diana en el contexto de la estrategia PAT; b describe de forma resumida las líneas de actuación cubiertas por los dispositivos mecánicos de uso más frecuente, y, finalmente, c proporciona unas recomendaciones de manejo clínico antes, durante y para el momento de la desconexión del dispositivo. resulta imprescindible una adecuación de los distintos centros implicados en este tipo de terapia si se pretende avanzar en su aplicación y resultados.
Albo, Graciela N; Henning, Cynthia; Reynaldi, Francisco J; Ringuelet, Jorge; Cerimele, Elsa
2010-01-01
ResumenLa ascofaeriosis o cría yesificada, es una enfermedad de la abeja melífera (Apis mellifera L.) causada por el hongo Ascosphaera apis que produce la momificación de las larvas. Los aceites esenciales poseen efectos antimicrobianos y han sido utilizados para el control de cría yesificada. Por otra parte, a nivel mundial se han probado gran cantidad de productos de síntesis, pero ninguno ha resultado 100 % eficaz. SummaryChalkbrood is a disease of the honeybee (Apis mellifera L) caused by...
Clarification of some api characteristics in relation to caribou (Rangifer tarandus
Directory of Open Access Journals (Sweden)
William O. Pruitt, Jr.
1990-09-01
Full Text Available A total of 2177 comparisons of api hardness vs. density in northern Saskatchewan, southeastern Manitoba and northeastern Finland revealed no consistent correlation (r varied from +.70 to -.17. A total of 1395 comparisons of horizontal hardness of the top layer of api to vertical hardness of the same layer of api in southeastern Manitoba, northeastern Finland and far eastern middle Finland revealed no consistent correlation (r varied from +.99 to -.20. Therefore one cannot substitute density for hardness nor horizontal hardness of the top layer for vertical hardness of the top layer in the terms of the Värriö Snow Index.
IgE-Api m 4 Is Useful for Identifying a Particular Phenotype of Bee Venom Allergy.
Ruiz, B; Serrano, P; Moreno, C
Different clinical behaviors have been identified in patients allergic to bee venom. Compound-resolved diagnosis could be an appropriate tool for investigating these differences. The aims of this study were to analyze whether specific IgE to Api m 4 (sIgE-Api m 4) can identify a particular kind of bee venom allergy and to describe response to bee venom immunotherapy (bVIT). Prospective study of 31 patients allergic to bee venom who were assigned to phenotype group A (sIgE-Api m 4 Api m 4 ≥0.98 kU/L), treated with purified aqueous (PA) extract. Sex, age, cardiovascular risk, severity of preceding sting reaction, exposure to beekeeping, and immunological data (intradermal test, sIgE/sIgG4-Apis-nApi m 1, and sIgE-rApi m 2-Api m 4 were analyzed. Systemic reactions (SRs) during bVIT build-up were analyzed. Immunological and sting challenge outcomes were evaluated in each group after 1 and 2 years of bVIT. Phenotype B patients had more severe reactions (P=.049) and higher skin sensitivity (P=.011), baseline sIgE-Apis (P=.0004), sIgE-nApi m 1 (P=.0004), and sIgG4-Apis (P=.027) than phenotype A patients. Furthermore, 41% of patients in group B experienced SRs during the build-up phase with NA; the sting challenge success rate in this group was 82%. There were no significant reductions in serial intradermal test results, but an intense reduction in sIgE-nApi m 1 (P=.013) and sIgE-Api m 4 (P=.004) was observed after the first year of bVIT. Use of IgE-Api m 4 as the only discrimination criterion demonstrated differences in bee venom allergy. Further investigation with larger populations is necessary.
Qualidade de vida de pacientes submetidos ao transplante cardíaco: aplicação da escala Whoqol-Bref
Directory of Open Access Journals (Sweden)
Maria Isis Freire de Aguiar
2011-01-01
Full Text Available FUNDAMENTO: O sucesso do transplante cardíaco significa garantir a sobrevida dos pacientes com cardiopatia e permitir-lhes desenvolver suas atividades diárias. O transplante cardíaco apresenta-se como a primeira opção de tratamento na falência cardíaca, representando um aumento de sobrevida e qualidade de vida dos transplantados. OBJETIVO: Avaliar a qualidade de vida de pacientes submetidos ao transplante cardíaco através da aplicação de uma escala padronizada (Whoqol-Bref. MÉTODOS: Estudo exploratório descritivo de abordagem quantitativa, realizado com 55 pacientes submetidos ao transplante cardíaco, em um período entre o terceiro e o 103º mês, que realizam acompanhamento na Unidade de Transplante e Insuficiência Cardíaca em um Hospital de Referência em Cardiologia na cidade de Fortaleza, CE. Os dados foram coletados no período de fevereiro a abril de 2009, por meio da aplicação de um questionário padronizado pela Organização Mundial da Saúde e utilização de dados constantes nos prontuários. RESULTADOS: Com relação ao domínio físico, 62,8% e 58,3% dos pacientes, dos sexos masculino e feminino, respectivamente, estão satisfeitos. No domínio psicológico, dentre pacientes do sexo masculino, 65,1% apresentam satisfação quanto à qualidade de vida e, no sexo feminino, 58,3% encontram-se satisfeitas. No domínio das relações sociais, observou-se que, no sexo masculino, 53,5% estão muito satisfeitos, e apresentou-se um nível de satisfação de 100% no sexo feminino. No domínio do meio ambiente, 65,1% do sexo masculino encontram-se satisfeitos, e no sexo feminino, 83,3% estão satisfeitas. CONCLUSÃO: O transplante cardíaco teve bastante influência na qualidade de vida dos pacientes transplantados, pois os resultados mostram-se estatisticamente significantes no pós-transplante.
Cheung, Prudence Wing Hang; Wong, Carlos King Ho; Samartzis, Dino; Luk, Keith Dip Kei; Lam, Cindy Lo Kuen; Cheung, Kenneth Man Chee; Cheung, Jason Pui Yin
2016-01-01
Scoliosis is a common spinal deformity that occurs often during adolescence. Previous studies suggested that adolescent idiopathic scoliosis (AIS) patients can have various aspects of their lives being affected, due to disease presentation and/or treatment received. It is important to define a reliable instrument based on which the affected patients' health-related quality of life can be assessed. This study aims to assess the validity, reliability and sensitivity of the EuroQoL 5-dimension 5-level (EQ-5D-5L) in Chinese patients with AIS. Adolescent idiopathic scoliosis patients of Chinese descent were prospectively recruited to complete both the traditional Chinese versions of the EQ-5D-5L and the refined Scoliosis Research Society-22 (SRS-22r) questionnaires. Patients' demographic profiles and corresponding clinical parameters including treatment modalities, spinal curve pattern and magnitude, and duration of bracing were recorded. Telephone interviews were then conducted at least two weeks later for the assessment of test-retest reliability. Statistical analysis was performed: construct validity of the EQ-5D-5L domains were assessed using Spearman's correlation test against the SRS-22r; whereas intra-class correlation coefficient (ICC) was used to assess the test-retest reliability, and agreement over the test-retest period was expressed in percentages. Also, the sensitivity of the EQ-5D-5L in differentiating various clinical known groups was determined by effect size, independent t-test and analysis of variance. A total of 227 AIS patients were recruited. Scores of domains of the EQ-5D-5L correlated significantly (r: 0.57-0.74) with the scores of the SRS-22r domains that were intended to measure similar constructs, supporting construct validity. The EQ-5D-5L domain responses and utility scores showed good test-retest reliability (ICC: 0.777; agreement: 76.4 -98.1 %). Internal consistency was good (Cronbach's α: 0.78) for the EQ-5D-5L utility score. The EQ-5
Grassl, Julia; Peng, Yan; Baer-Imhoof, Barbara; Welch, Mat; Millar, A Harvey; Baer, Boris
2017-01-06
Honey bee (Apis mellifera) males are highly susceptible to infections with the sexually transmitted fungal pathogen Nosema apis. However, they are able to suppress this parasite in the ejaculate using immune molecules in the seminal fluid. We predicted that males respond to infections by altering the seminal fluid proteome to minimize the risk to sexually transmit the parasite to the queen and her colony. We used iTRAQ isotopic labeling to compare seminal fluid proteins from infected and noninfected males and found that N. apis infections resulted in significant abundance changes in 111 of the 260 seminal fluid proteins quantitated. The largest group of proteins with significantly changed abundances consisted of 15 proteins with well-known immune-related functions, which included two significantly more abundant chitinases in the seminal fluid of infected males. Chitinases were previously hypothesized to be involved in honey bee antifungal activity against N. apis. Here we show that infection with N. apis triggers a highly specific immune response in the seminal fluid of honey bee males.
Van Vaerenbergh, Matthias; De Smet, Lina; Rafei-Shamsabadi, David; Blank, Simon; Spillner, Edzard; Ebo, Didier G; Devreese, Bart; Jakob, Thilo; de Graaf, Dirk C
2015-02-01
Api m 10 has recently been established as novel major allergen that is recognized by more than 60% of honeybee venom (HBV) allergic patients. Previous studies suggest Api m 10 protein heterogeneity which may have implications for diagnosis and immunotherapy of HBV allergy. In the present study, RT-PCR revealed the expression of at least nine additional Api m 10 transcript isoforms by the venom glands. Two distinct mechanisms are responsible for the generation of these isoforms: while the previously known variant 2 is produced by an alternative splicing event, novel identified isoforms are intragenic chimeric transcripts. To the best of our knowledge, this is the first report of the identification of chimeric transcripts generated by the honeybee. By a retrospective proteomic analysis we found evidence for the presence of several of these isoforms in the venom proteome. Additionally, we analyzed IgE reactivity to different isoforms by protein array technology using sera from HBV allergic patients, which revealed that IgE recognition of Api m 10 is both isoform- and patient-specific. While it was previously demonstrated that the majority of HBV allergic patients display IgE reactivity to variant 2, our study also shows that some patients lacking IgE antibodies for variant 2 display IgE reactivity to two of the novel identified Api m 10 variants, i.e. variants 3 and 4. Copyright © 2014 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Guntima Suwannapong
2010-01-01
Full Text Available Hypopharyngeal glands of honeybee are age-dependent structures that change with the size of acini and are correlated with various social behaviors. The histochemical structure of Apis cerana and A. mellifera worker hypopharyngeal glands in four different developmental stages wes stained with ninhydrin Schiff's and periodic acid Schiff's reagents (PAS for localization of proteins and carbohydrates, respectively, and examined with light microscopy. Nurse bees of both honeybee species had significantly larger glands as compared to guards and forgers, but there were no statistically significant differences between these two species after accounting for caste. Gland protein concentration increased progressively in nurse bees, and this was correlated with the appearance of enriched protein granules in the cytoplasm. In addition, the hypopharyngeal gland protein concentration of A. mellifera was higher than that of A. cerana even though gland size was not significantly different between species. However, gland size was shown to have decreased progressively in foragers and guards.
Directory of Open Access Journals (Sweden)
Sierra Omar Danilo
2004-06-01
Full Text Available An index measuring the aggressiveness among ten colonies of Apis mellifera was elaborated based on the third generation synthetic indices by Charum et al. (1999. The index values are subject to a fixed parameter used as the beginning or standard value, and correspond to the aggressive features of some Africans colonies studied by Rothenbuler et al. (1968. In the ten colonies the index values are notably smaller than those of African colonies and are biased to the lowest values. This indicates, that neither of the colonies presents an extreme aggressive behavior and it is possible that they have not Africans genotypes. These results are an indirect proof of the index. Nevertheless, it could be improved by the introduction of other factors such as, climate and colony management.En este estudio se elaboró un índice para medir la agresividad en 10 colonias de Apis mellifera, con base en la metodología de índices sintéticos de tercera generación de Charum et al. (1999. Los valores de este índice están sujetos a un parámetro fijo que se usó como umbral o valor estándar y corresponde a las características agresivas las colonias africanas estudiadas por Rothenbuler et al. (1968. En las 10 colonias los valores del índice son menores a los presentados en las colonias africanas y están sesgados hacia los valores más bajos. Esto indica que ninguna de las colonias presenta un comportamiento agresivo extremo y que posiblemente ninguna tiene genotipos africanos. Estos resultados constituyen una prueba indirecta del carácter práctico de nuestro índice. No obstante, podría mejorarse incluyendo otros factores, como: clima y manejo de la colonia.
Huang, Xiu; Han, Richou
2014-01-01
Chinese honeybee Apis cerana (Ac) is one of the major Asian honeybee species for local apiculture. However, Ac is frequently damaged by Chinese sacbrood virus (CSBV), whereas Apis mellifera (Am) is usually resistant to it. Heterospecific royal jelly (RJ) breeding in two honeybee species may result in morphological and genetic modification. Nevertheless, knowledge on the resistant mechanism of Am to this deadly disease is still unknown. In the present study, heterospecific RJ breeding was conducted to determine the effects of food change on the larval mortality after CSBV infection at early larval stage. 2-DE and MALDI-TOF/TOF MS proteomic technology was employed to unravel the molecular event of the bees under heterospecific RJ breeding and CSBV challenge. The change of Ac larval food from RJC to RJM could enhance the bee resistance to CSBV. The mortality rate of Ac larvae after CSBV infection was much higher when the larvae were fed with RJC compared with the larvae fed with RJM. There were 101 proteins with altered expressions after heterospecific RJ breeding and viral infection. In Ac larvae, 6 differential expression proteins were identified from heterospecific RJ breeding only, 21 differential expression proteins from CSBV challenge only and 7 differential expression proteins from heterospecific RJ breeding plus CSBV challenge. In Am larvae, 17 differential expression proteins were identified from heterospecific RJ breeding only, 26 differential expression proteins from CSBV challenge only and 24 differential expression proteins from heterospecific RJ breeding plus CSBV challenge. The RJM may protect Ac larvae from CSBV infection, probably by activating the genes in energy metabolism pathways, antioxidation and ubiquitin-proteasome system. The present results, for the first time, comprehensively descript the molecular events of the viral infection of Ac and Am after heterospecific RJ breeding and are potentially useful for establishing CSBV resistant
Zhang, Yi; Zhang, Guozhi; Huang, Xiu; Han, Richou
2014-01-01
Chinese honeybee Apis cerana (Ac) is one of the major Asian honeybee species for local apiculture. However, Ac is frequently damaged by Chinese sacbrood virus (CSBV), whereas Apis mellifera (Am) is usually resistant to it. Heterospecific royal jelly (RJ) breeding in two honeybee species may result in morphological and genetic modification. Nevertheless, knowledge on the resistant mechanism of Am to this deadly disease is still unknown. In the present study, heterospecific RJ breeding was conducted to determine the effects of food change on the larval mortality after CSBV infection at early larval stage. 2-DE and MALDI-TOF/TOF MS proteomic technology was employed to unravel the molecular event of the bees under heterospecific RJ breeding and CSBV challenge. The change of Ac larval food from RJC to RJM could enhance the bee resistance to CSBV. The mortality rate of Ac larvae after CSBV infection was much higher when the larvae were fed with RJC compared with the larvae fed with RJM. There were 101 proteins with altered expressions after heterospecific RJ breeding and viral infection. In Ac larvae, 6 differential expression proteins were identified from heterospecific RJ breeding only, 21 differential expression proteins from CSBV challenge only and 7 differential expression proteins from heterospecific RJ breeding plus CSBV challenge. In Am larvae, 17 differential expression proteins were identified from heterospecific RJ breeding only, 26 differential expression proteins from CSBV challenge only and 24 differential expression proteins from heterospecific RJ breeding plus CSBV challenge. The RJM may protect Ac larvae from CSBV infection, probably by activating the genes in energy metabolism pathways, antioxidation and ubiquitin-proteasome system. The present results, for the first time, comprehensively descript the molecular events of the viral infection of Ac and Am after heterospecific RJ breeding and are potentially useful for establishing CSBV resistant
Directory of Open Access Journals (Sweden)
Yi Zhang
Full Text Available Chinese honeybee Apis cerana (Ac is one of the major Asian honeybee species for local apiculture. However, Ac is frequently damaged by Chinese sacbrood virus (CSBV, whereas Apis mellifera (Am is usually resistant to it. Heterospecific royal jelly (RJ breeding in two honeybee species may result in morphological and genetic modification. Nevertheless, knowledge on the resistant mechanism of Am to this deadly disease is still unknown. In the present study, heterospecific RJ breeding was conducted to determine the effects of food change on the larval mortality after CSBV infection at early larval stage. 2-DE and MALDI-TOF/TOF MS proteomic technology was employed to unravel the molecular event of the bees under heterospecific RJ breeding and CSBV challenge. The change of Ac larval food from RJC to RJM could enhance the bee resistance to CSBV. The mortality rate of Ac larvae after CSBV infection was much higher when the larvae were fed with RJC compared with the larvae fed with RJM. There were 101 proteins with altered expressions after heterospecific RJ breeding and viral infection. In Ac larvae, 6 differential expression proteins were identified from heterospecific RJ breeding only, 21 differential expression proteins from CSBV challenge only and 7 differential expression proteins from heterospecific RJ breeding plus CSBV challenge. In Am larvae, 17 differential expression proteins were identified from heterospecific RJ breeding only, 26 differential expression proteins from CSBV challenge only and 24 differential expression proteins from heterospecific RJ breeding plus CSBV challenge. The RJM may protect Ac larvae from CSBV infection, probably by activating the genes in energy metabolism pathways, antioxidation and ubiquitin-proteasome system. The present results, for the first time, comprehensively descript the molecular events of the viral infection of Ac and Am after heterospecific RJ breeding and are potentially useful for establishing CSBV
S E- GEOD-50881 Study Samples --- Candida albicans response to spaceflight (NASA STS-115) API
National Aeronautics and Space Administration — A fully queryable REST API with JSON, XML, and CSV output as well as inline, runable examples using data from the transcriptional profiling and phenotypic...
A E- GEOD-50881 Gene Chip Assay --- Candida albicans response to spaceflight (NASA STS-115) API
National Aeronautics and Space Administration — A fully queryable REST API with JSON, XML, and CSV output as well as inline, runable examples using data from the transcriptional profiling and phenotypic...
Candida albicans response to spaceflight (NASA STS-115) --- GSM1231690_Slide_43 API
National Aeronautics and Space Administration — A fully queryable REST API with JSON, XML, and CSV output as well as inline, runable examples using data from the transcriptional profiling and phenotypic...
A Novel Approach to Detect Malware Based on API Call Sequence Analysis
National Research Council Canada - National Science Library
Ki, Youngjoon; Kim, Eunjin; Kim, Huy Kang
2015-01-01
.... In this paper, we propose a novel approach for dynamic analysis of malware. We adopt DNA sequence alignment algorithms and extract common API call sequence patterns of malicious function from malware in different categories...
Social Security Administration — This dataset displays our quarterly national TIS call volume for over 45 API languages for fiscal year 2013 onward. A fiscal year runs from October through September...
The open-source, public domain JUPITER (Joint Universal Parameter IdenTification and Evaluation of Reliability) API (Application Programming Interface) provides conventions and Fortran-90 modules to develop applications (computer programs) for analyzing process models. The input ...
Fast Synchronization In IVR Using REST API For HTML5 And AJAX
National Research Council Canada - National Science Library
Sandeep Kailuke; Nekita Chavhan
2014-01-01
.... IVR system uses REST API for data access while calling. When in call process user want to access data, server need to validate it and while validation data accessing must be synchronize with mysql server...
Uma API criptográfica para aplicações embarcadas
Fontoura, Felipe Michels
2016-01-01
Neste documento, está apresentada a GEmSysC, uma API criptográfica unificada para aplicações embarcadas. Camadas de abstração compatíveis com esta API podem ser construídas sobre bibliotecas existentes, de forma que as funcionalidades criptográficas podem ser acessadas pelo software de alto nível de forma consistente e independente da implementação. As características da API foram definidas com base em boas práticas de construção de APIs, práticas indicadas em software embarcado e também com ...
Telephone Interpreter Services (TIS)-Asian and Pacific Islander (API) Language Yearly Dataset
Social Security Administration — This dataset displays our national TIS call volume for over 45 API languages for fiscal year 2011 onward. A fiscal year runs from October through September. We will...
Directory of Open Access Journals (Sweden)
Omar Mohamed O. M.
2014-06-01
Full Text Available The objective of this study was to isolate and characterize bacterial strains associated with the gut of the hybrid Carniolan honey bee, Apis mellifera carnica, and to determine their in vitro and in vivo potential against Ascosphaera apis, the causal organism of chalkbrood disease, with the purpose of exploring feasible biological control. Six bacterial strains were isolated from healthy worker honey bees by culture-dependent methods. Six fungal strains (A3, A4, A7, A8, A9, and A15 of A. apis were isolated from larvae suffering from chalkbrood disease on Yeast-Glucose-Starch agar (YGPSA medium. All bacteria were identified by a combination of morphology, Gram stain, and 16S rRNA sequence analysis, and fungal strains were identified by morphology and 5.8S rRNA. In vitro and in vivo inhibition assays were carried out to determine the ability of bacterial isolates to inhibit A. apis, the causal agent of chalkbrood disease. The analysis of 16S rRNA sequences revealed that four bacterial strains (B2, B4, B10, and B100 belong to Bacillus subtilis species, and two strains (P1 and P5 belong to Pseudomonas fluorescence. Significant differences in antagonistic activity of all bacterial strains were observed. B. subtilis isolate B2 showed the highest antagonistic activity, as measured by the inhibition zone against A. apis, followed by the P1 strain of P. fluorescence. SEM analysis also supports the antagonistic activity of these bacteria against A. apis. This study provides a theoretical basis for biological control of honey bee chalkbrood disease.
Huang, Wei-Fone; Solter, Leellen; Aronstein, Katherine; Huang, Zachary
2015-01-01
Nosema ceranae infection is ubiquitous in western honey bees, Apis mellifera, in the United States and the pathogen has apparently replaced Nosema apis in colonies nationwide. Displacement of N. apis suggests that N. ceranae has competitive advantages but N. ceranae was significantly less infective and less virulent than N. apis in commercially available lineages of honey bees in studies conducted in Illinois and Texas. At 5 days post eclosion, the most susceptible age of adult bees tested, the mean ID50 for N. apis was 359 spores compared to 3217 N. ceranae spores, a nearly 9-fold difference. Infectivity of N. ceranae was also lower than N. apis for 24-h and 14-day worker bees. N. ceranae was less infective than reported in studies using European strains of honey bees, while N. apis infectivity, tested in the same cohort of honey bees, corresponded to results reported globally from 1972 to 2010. Mortality of worker bees was similar for both pathogens at a dosage of 50 spores and was not different from the uninfected controls, but was significantly higher for N. apis than N. ceranae at dosages ⩾500 spores. Our results provide comparisons for evaluating research using different ages of bees and pathogen dosages and clarify some controversies. In addition, comparisons among studies suggest that the mixed lineages of US honey bees may be less susceptible to N. ceranae infections than are European bees or that the US isolates of the pathogen are less infective and less virulent than European isolates. Copyright © 2014 Elsevier Inc. All rights reserved.
Cría controlada de abejas reinas de Apis mellifera iberica
Flores Serrano, J. M.; Campano Cabanes, Francisco; Ruiz, J. A.; Ruz, J.M.; Puerta Puerta, F.; Bustos Ruiz, M.; Padilla-Alvarez, F.
1998-01-01
Apis mellifera iberica is the spanish bee race mostly used by breeders. Queen rearing is necessary for genetic selection . Our research team uses the Doolittle method; Mainly it is based on transfering young (a few hours old) worker larvae to artificial queen cells. Larvae are reared in queenless colonies. After sealed, queen cells are kept in an incubator chamber. Mean percentage of alive queens during a season reaches 80 p.100. Apis mellifera iberica es la abeja habitualmente usada por l...
Using DLL as Interface between API an VC#.NET Applications
Directory of Open Access Journals (Sweden)
Marian DARDALA
2006-01-01
Full Text Available This paper presents a solution for using complex Win32API data structures and functions in Visual C# .NET applications. We built DLL (Dynamic Link Library to manage the API functions and data structures and we used DLL modules in a C# application. This is an easier working way compared with the traditional way of importing and managing API’s functions in C# programs.
MONICA PÂRVU; CORINA AURELIA ZUGRAVU; IOANA CRISTINA ANDRONIE; CARMEN BERGHEŞ; IUDITH IPATE
2009-01-01
The study was conducted on bee families of Apis mellifera carpatica and Apis mellifera ligustica breeds. The bees were housed in multi-storey hives. The experimental period was of 6 months. The resistance to wintering was evaluated on the basis of several apicultural indicators: mortality, feed intake during the winter, general state of the family. Mortality was 35% during wintering for the Carpathian bee and 52% for the Italian bee. The differences were very significant (p≤0.001). When winte...
Sensitivity Analysis of Fatigue Crack Growth Model for API Steels in Gaseous Hydrogen.
Amaro, Robert L; Rustagi, Neha; Drexler, Elizabeth S; Slifka, Andrew J
2014-01-01
A model to predict fatigue crack growth of API pipeline steels in high pressure gaseous hydrogen has been developed and is presented elsewhere. The model currently has several parameters that must be calibrated for each pipeline steel of interest. This work provides a sensitivity analysis of the model parameters in order to provide (a) insight to the underlying mathematical and mechanistic aspects of the model, and (b) guidance for model calibration of other API steels.
A RESTful API for accessing microbial community data for MG-RAST.
Wilke, Andreas; Bischof, Jared; Harrison, Travis; Brettin, Tom; D'Souza, Mark; Gerlach, Wolfgang; Matthews, Hunter; Paczian, Tobias; Wilkening, Jared; Glass, Elizabeth M; Desai, Narayan; Meyer, Folker
2015-01-01
Metagenomic sequencing has produced significant amounts of data in recent years. For example, as of summer 2013, MG-RAST has been used to annotate over 110,000 data sets totaling over 43 Terabases. With metagenomic sequencing finding even wider adoption in the scientific community, the existing web-based analysis tools and infrastructure in MG-RAST provide limited capability for data retrieval and analysis, such as comparative analysis between multiple data sets. Moreover, although the system provides many analysis tools, it is not comprehensive. By opening MG-RAST up via a web services API (application programmers interface) we have greatly expanded access to MG-RAST data, as well as provided a mechanism for the use of third-party analysis tools with MG-RAST data. This RESTful API makes all data and data objects created by the MG-RAST pipeline accessible as JSON objects. As part of the DOE Systems Biology Knowledgebase project (KBase, http://kbase.us) we have implemented a web services API for MG-RAST. This API complements the existing MG-RAST web interface and constitutes the basis of KBase's microbial community capabilities. In addition, the API exposes a comprehensive collection of data to programmers. This API, which uses a RESTful (Representational State Transfer) implementation, is compatible with most programming environments and should be easy to use for end users and third parties. It provides comprehensive access to sequence data, quality control results, annotations, and many other data types. Where feasible, we have used standards to expose data and metadata. Code examples are provided in a number of languages both to show the versatility of the API and to provide a starting point for users. We present an API that exposes the data in MG-RAST for consumption by our users, greatly enhancing the utility of the MG-RAST service.
The development, validity, and reliability of the Addiction Profile Index (API).
Ögel, Kültegin; Evren, Cüneyt; Karadağ, Figen; Gürol, Defne Tamar
2012-01-01
The objective of this study was to develop a practical questionnaire for multidimensional assessment of problems associated with alcohol and substance abuse that would also be useful for treatment planning. The Addiction Profile Index (API) is a self-report questionnaire consisting of 37 items and the following 5 subscales: characteristics of substance use; dependency diagnosis; the effects of subsance use on the user; craving; motivation to quit using substances. The study included 345 alcohol and/or substance abusers from 2 addiction treatment clinics and a prison addiction service. The validity of the questionnaire was assessed using the Michigan Alcoholism Screening Test (MAST), Readiness to Change Questionnaire (SOCRATES), Penn Alcohol Craving Scale (PACS), Drug Craving Scale (DCS), Structured Clinical Interview for DSM-IV Axis I Disorders (SCID-I), and Addiction Severity Index (ASI). The Cronbach's alpha coefficient for the total API was 0.89 and for the subscales it ranged from 0.63 to 0.86. Item-total correlation coefficients ranged from 0.42 to 0.89. The Spearman Brown split-half method coefficient for the total API was 0.83. In all, 4 factors were obtained using explanatory factor analysis that represented 52.3% of the total variance. The API craving subscale was observed to be consistent with PACS and the API motivation subscale was consistent with SOCRATES. The API total score was strongly correlated with the mean MAST score, and the composite ASI medical status, substance use, legal status, and family social relations subscale scores. Based on ROC analyses, the area under curve was 0.90. With a total API cut-off score of 4, the scale's sensitivity and specificity 0.85 was 0.78, respectively. The findings show that the API is a valid and reliable questionnaire that can be used to measure the severity of different dimensions of substance dependency.
A RESTful API for accessing microbial community data for MG-RAST.
Directory of Open Access Journals (Sweden)
Andreas Wilke
2015-01-01
Full Text Available Metagenomic sequencing has produced significant amounts of data in recent years. For example, as of summer 2013, MG-RAST has been used to annotate over 110,000 data sets totaling over 43 Terabases. With metagenomic sequencing finding even wider adoption in the scientific community, the existing web-based analysis tools and infrastructure in MG-RAST provide limited capability for data retrieval and analysis, such as comparative analysis between multiple data sets. Moreover, although the system provides many analysis tools, it is not comprehensive. By opening MG-RAST up via a web services API (application programmers interface we have greatly expanded access to MG-RAST data, as well as provided a mechanism for the use of third-party analysis tools with MG-RAST data. This RESTful API makes all data and data objects created by the MG-RAST pipeline accessible as JSON objects. As part of the DOE Systems Biology Knowledgebase project (KBase, http://kbase.us we have implemented a web services API for MG-RAST. This API complements the existing MG-RAST web interface and constitutes the basis of KBase's microbial community capabilities. In addition, the API exposes a comprehensive collection of data to programmers. This API, which uses a RESTful (Representational State Transfer implementation, is compatible with most programming environments and should be easy to use for end users and third parties. It provides comprehensive access to sequence data, quality control results, annotations, and many other data types. Where feasible, we have used standards to expose data and metadata. Code examples are provided in a number of languages both to show the versatility of the API and to provide a starting point for users. We present an API that exposes the data in MG-RAST for consumption by our users, greatly enhancing the utility of the MG-RAST service.
Consequences of Nosema apis infection for male honey bees and their fertility.
Peng, Yan; Baer-Imhoof, Barbara; Millar, A Harvey; Baer, Boris
2015-06-30
The queens of eusocial bees, ants and wasps mate only during a very short period early in life and males therefore produce ejaculates consisting of large numbers of high quality sperm. Such extreme selection for high fecundity resulted in males investing minimally into their somatic survival, including their immune system. However, if susceptible males are unable to protect their reproductive tissue from infections, they compromise queen fitness if they transfer pathogens during mating. We used the honey bee Apis mellifera and investigated the course of infection of the sexually transmitted pathogen Nosema apis. We predicted that honey bee males are susceptible but protect their reproductive tissues from infections. We investigated the effects of N. apis infections on the midgut, the accessory glands and the accessory testes and quantified the consequences of infection on male survival and fecundity. We found that N. apis is able to infect males, and as infections progressed, it significantly impacted fertility and survival in older males. Even though we confirm males to be able to minimize N. apis infections of their reproductive tissues, the parasite is present in ejaculates of older males. Consequently N. apis evolved alternative routes to successfully infect ejaculates and get sexually transmitted.
Buske, Orion J; Schiettecatte, François; Hutton, Benjamin; Dumitriu, Sergiu; Misyura, Andriy; Huang, Lijia; Hartley, Taila; Girdea, Marta; Sobreira, Nara; Mungall, Chris; Brudno, Michael
2015-10-01
Despite the increasing prevalence of clinical sequencing, the difficulty of identifying additional affected families is a key obstacle to solving many rare diseases. There may only be a handful of similar patients worldwide, and their data may be stored in diverse clinical and research databases. Computational methods are necessary to enable finding similar patients across the growing number of patient repositories and registries. We present the Matchmaker Exchange Application Programming Interface (MME API), a protocol and data format for exchanging phenotype and genotype profiles to enable matchmaking among patient databases, facilitate the identification of additional cohorts, and increase the rate with which rare diseases can be researched and diagnosed. We designed the API to be straightforward and flexible in order to simplify its adoption on a large number of data types and workflows. We also provide a public test data set, curated from the literature, to facilitate implementation of the API and development of new matching algorithms. The initial version of the API has been successfully implemented by three members of the Matchmaker Exchange and was immediately able to reproduce previously identified matches and generate several new leads currently being validated. The API is available at https://github.com/ga4gh/mme-apis. © 2015 WILEY PERIODICALS, INC.
Programmatic access to logical models in the Cell Collective modeling environment via a REST API.
Kowal, Bryan M; Schreier, Travis R; Dauer, Joseph T; Helikar, Tomáš
2016-01-01
Cell Collective (www.cellcollective.org) is a web-based interactive environment for constructing, simulating and analyzing logical models of biological systems. Herein, we present a Web service to access models, annotations, and simulation data in the Cell Collective platform through the Representational State Transfer (REST) Application Programming Interface (API). The REST API provides a convenient method for obtaining Cell Collective data through almost any programming language. To ensure easy processing of the retrieved data, the request output from the API is available in a standard JSON format. The Cell Collective REST API is freely available at http://thecellcollective.org/tccapi. All public models in Cell Collective are available through the REST API. For users interested in creating and accessing their own models through the REST API first need to create an account in Cell Collective (http://thecellcollective.org). thelikar2@unl.edu. Technical user documentation: https://goo.gl/U52GWo. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Shen, Chen-Hua, E-mail: shenandchen01@163.com [College of Geographical Science, Nanjing Normal University, Nanjing 210046 (China); Jiangsu Center for Collaborative Innovation in Geographical Information Resource, Nanjing 210046 (China); Key Laboratory of Virtual Geographic Environment of Ministry of Education, Nanjing 210046 (China)
2015-12-04
To analyze the unique contribution of meteorological factors to the air pollution index (API), a new method, the detrended semipartial cross-correlation analysis (DSPCCA), is proposed. Based on both a detrended cross-correlation analysis and a DFA-based multivariate-linear-regression (DMLR), this method is improved by including a semipartial correlation technique, which is used to indicate the unique contribution of an explanatory variable to multiple correlation coefficients. The advantages of this method in handling nonstationary time series are illustrated by numerical tests. To further demonstrate the utility of this method in environmental systems, new evidence of the primary contribution of meteorological factors to API is provided through DMLR. Results show that the most important meteorological factors affecting API are wind speed and diurnal temperature range, and the explanatory ability of meteorological factors to API gradually strengthens with increasing time scales. The results suggest that DSPCCA is a useful method for addressing environmental systems. - Highlights: • A detrended multiple linear regression is shown. • A detrended semipartial cross correlation analysis is proposed. • The important meteorological factors affecting API are assessed. • The explanatory ability of meteorological factors to API gradually strengthens with increasing time scales.
Marcapasso cardíaco artificial: considerações pré e per-operatórias
Directory of Open Access Journals (Sweden)
Ramos Gilson
2003-01-01
Full Text Available JUSTIFICATIVA E OBJETIVOS: O avanço tecnológico da propedêutica médica diagnóstica em cardiologia difundiu grandemente a indicação de marcapasso (MP cardíaco artificial, definitivo ou temporário. Isso fez com que outros especialistas, além dos cardiologistas, se envolvessem ainda mais no manuseio desses aparelhos. Quando pacientes portadores de MP se apresentam para cirurgia, a participação do anestesiologista pode ser decisiva para o sucesso do procedimento. O objetivo da presente revisão é familiarizar o anestesiologista com as principais indicações clínicas e com o funcionamento desses dispositivos, além dos cuidados pré e per-operatório que se deve ter. CONTEÚDO: Foram tratadas a classificação, funcionamento e as principais indicações clínicas para o implante de MP. Da mesma forma, procurou-se elucidar os principais cuidados pré e per-operatórios relativos ao uso de MP para lograr êxito no procedimento indicado. CONCLUSÕES: O principais conhecimentos sobre o funcionamento do MP e suas indicações clínicas devem fazer parte da prática diária do anestesiologista. Assim, o manuseio e a indicação do MP temporário amplia a atuação desses especialistas, além do que pode salvar vidas, inclusive em situações emergenciais dentro do centro cirúrgico. O uso de eletrocautério deveria ser evitado em portadores de MP.
Parhusip, H. A.; Trihandaru, S.; Susanto, B.; Prasetyo, S. Y. J.; Agus, Y. H.; Simanjuntak, B. H.
2017-03-01
Several algorithms and objective functions on paddy crops have been studied to get optimal paddy crops in Central Java based on the data given from Surakarta and Boyolali. The algorithms are linear solver, least square and Ant Colony Algorithms (ACO) to develop optimization procedures on paddy crops modelled with Modified GSTAR (Generalized Space-Time Autoregressive) and nonlinear models where the nonlinear models are quadratic and power functions. The studied data contain paddy crops from Surakarta and Boyolali determining the best period of planting in the year 1992-2012 for Surakarta where 3 periods for planting are known and the optimal amount of paddy crops in Boyolali in the year 2008-2013. Having these analyses may guide the local agriculture government to give a decision on rice sustainability in its region. The best period for planting in Surakarta is observed, i.e. the best period is in September-December based on the data 1992-2012 by considering the planting area, the cropping area, and the paddy crops are the most important factors to be taken into account. As a result, we can refer the paddy crops in this best period (about 60.4 thousand tons per year) as the optimal results in 1992-2012 where the used objective function is quadratic. According to the research, the optimal paddy crops in Boyolali about 280 thousand tons per year where the studied factors are the amount of rainfalls, the harvested area and the paddy crops in 2008-2013. In this case, linear and power functions are studied to be the objective functions. Compared to all studied algorithms, the linear solver is still recommended to be an optimization tool for a local agriculture government to predict paddy crops in future.
Moriarty, Orla; Gorman, Claire L; McGowan, Fiona; Ford, Gemma K; Roche, Michelle; Thompson, Kerry; Dockery, Peter; McGuire, Brian E; Finn, David P
2016-01-01
Although neuropathic pain is known to negatively affect cognition, the neural mechanisms involved are poorly understood. Chronic pain is associated with changes in synaptic plasticity in the brain which may impact on cognitive functioning. The aim of this study was to model neuropathic pain in mid-aged rats using spinal nerve ligation (SNL). Following establishment of allodynia and hyperalgesia, behaviour was assessed in a battery of cognitive tests. Expression of the presynaptic protein, synaptophysin, and its colocalisation with the vesicular GABA and glutamate transporters (vGAT and vGLUT, respectively), was investigated in the medial prefrontal cortex (mPFC) and hippocampus. Nine month old male Sprague Dawley rats underwent L5-L6 spinal nerve ligation or a sham procedure. Mechanical and cold allodynia and thermal hyperalgesia were assessed using von Frey, acetone and Hargreaves tests, respectively. Cognition was assessed in the novel-object recognition, air-puff passive avoidance and Morris water maze behavioural tasks. Immunohistochemistry was used to examine the expression of synaptophysin in the mPFC and CA1 region of the hippocampus and double labelling of synaptophysin and the vesicular transporters vGAT and vGlut was used to investigate the distribution of synaptophysin on GABAergic and glutamatergic neurons. SNL rats displayed impaired performance in the novel-object recognition task. Passive-avoidance responding, and spatial learning and memory in the Morris water maze, were unaffected by SNL surgery. However, in the water maze reversal task, pain-related impairments were evident during training and probe trials. SNL surgery was not associated with any differences in the expression of synaptophysin or its colocalisation with vGAT or vGLUT in the mPFC or the hippocampal CA1 region. These results suggest that the SNL model of neuropathic pain is associated with deficits in recognition memory and cognitive flexibility, but these deficits are not associated
Liu, Liu; Li, Shunping; Wang, Min; Chen, Gang
2017-01-01
The objective of this study was to compare the differences in the five-level EuroQol-5 dimensions (EQ-5D-5L) health state utility scores derived from Chinese, Japanese, Korean, and UK tariffs. Six hundred and twenty-one breast cancer patients were invited for a face-to-face interview in Qingdao Municipal Hospital, China. EQ-5D-5L was scored using tariffs from China, Japan, Korea, and the UK. The null hypothesis of normal distribution of the EQ-5D-5L utility score was tested by the Shapiro-Wilk test. Nonparametric Friedman test and Wilcoxon signed-rank test were used to determine the difference among the four tariffs. The intraclass correlation coefficients (ICCs) and Bland-Altman plots were used to study the agreement among the four EQ-5D-5L scores. Known-groups validity was studied using a regression framework. There were 608 participants in the final analysis, with a mean ± standard deviation (SD) age of 48.0±9.6 years. EQ-5D-5L utility scores were non-normally distributed. The means (median) ± SD of EQ-5D-5L utilities derived from Chinese, Japanese, Korean, and UK tariffs were 0.828 (0.879) ±0.184, 0.802 (0.823) ±0.164, 0.831 (0.829) ±0.137, and 0.838 (0.866) ±0.154, respectively. Among pairwise comparisons, the difference of median EQ-5D-5L utility scores was only insignificant between Chinese and UK tariffs. Excellent agreements (with ICCs >0.9) were found among the four tariffs albeit the limits of agreement between each pair of tariffs were wide. Known-groups validity was supported. Although four country-specific EQ-5D-5L tariffs have shown an overall high level of correlation and agreement, none of them could be regarded as interchangeable. The higher correlation and agreement between Chinese and UK tariffs may be due to the similar functions that were used in the tariff development. In the absence of Chinese-specific tariff, the UK tariff is the second-best option to be applied in the Chinese population. Results of this study further contribute to
Comparative Sucrose Responsiveness in Apis mellifera and A. cerana Foragers
Yang, Wenchao; Kuang, Haiou; Wang, Shanshan; Wang, Jie; Liu, Wei; Wu, Zhenhong; Tian, Yuanyuan; Huang, Zachary Y.; Miao, Xiaoqing
2013-01-01
In the European honey bee, Apis mellifera, pollen foragers have a higher sucrose responsiveness than nectar foragers when tested using a proboscis extension response (PER) assay. In addition, Africanized honey bees have a higher sucrose responsiveness than European honey bees. Based on the biology of the Eastern honey bee, A. cerana, we hypothesized that A. cerana should also have a higher responsiveness to sucrose than A. mellifera. To test this hypothesis, we compared the sucrose thresholds of pollen foragers and nectar foragers in both A. cerana and A. mellifera in Fujian Province, China. Pollen foragers were more responsive to sucrose than nectar foragers in both species, consistent with previous studies. However, contrary to our hypothesis, A. mellifera was more responsive than A. cerana. We also demonstrated that this higher sucrose responsiveness in A. mellifera was not due to differences in the colony environment by co-fostering two species of bees in the same mixed-species colonies. Because A. mellifera foragers were more responsive to sucrose, we predicted that their nectar foragers should bring in less concentrated nectar compared to that of A. cerana. However, we found no differences between the two species. We conclude that A. cerana shows a different pattern in sucrose responsiveness from that of Africanized bees. There may be other mechanisms that enable A. cerana to perform well in areas with sparse nectar resources. PMID:24194958
Nosema Tolerant Honeybees (Apis mellifera) Escape Parasitic Manipulation of Apoptosis.
Kurze, Christoph; Le Conte, Yves; Dussaubat, Claudia; Erler, Silvio; Kryger, Per; Lewkowski, Oleg; Müller, Thomas; Widder, Miriam; Moritz, Robin F A
2015-01-01
Apoptosis is not only pivotal for development, but also for pathogen defence in multicellular organisms. Although numerous intracellular pathogens are known to interfere with the host's apoptotic machinery to overcome this defence, its importance for host-parasite coevolution has been neglected. We conducted three inoculation experiments to investigate in the apoptotic respond during infection with the intracellular gut pathogen Nosema ceranae, which is considered as potential global threat to the honeybee (Apis mellifera) and other bee pollinators, in sensitive and tolerant honeybees. To explore apoptotic processes in the gut epithelium, we visualised apoptotic cells using TUNEL assays and measured the relative expression levels of subset of candidate genes involved in the apoptotic machinery using qPCR. Our results suggest that N. ceranae reduces apoptosis in sensitive honeybees by enhancing inhibitor of apoptosis protein-(iap)-2 gene transcription. Interestingly, this seems not be the case in Nosema tolerant honeybees. We propose that these tolerant honeybees are able to escape the manipulation of apoptosis by N. ceranae, which may have evolved a mechanism to regulate an anti-apoptotic gene as key adaptation for improved host invasion.
Energetic feedings influence beeswax production by Apis mellifera L. honeybees
Directory of Open Access Journals (Sweden)
Marcela Pedraza Carrillo
2015-02-01
Full Text Available The effect of different types of energy feeding (sugar syrup, inverted sugar and juice of sugar-cane on beeswax production and its economic feasibility are evaluated. Twenty beehives of Africanized Apis mellifera were selected, and five were used for each type of feeding. The treatments were T1 (sugar-cane juice, T2 (sugar syrup and T3 (inverted sugar. Feedings was provided by Boardman feeders and the amount was adjusted according to consumption. A layer of beeswax was manually set up into the honeybee nest and beeswax built area was measured weekly. Total reducing sugar, calorimetry, dry matter and ashes of all feedings were analyzed. Data were analyzed by analysis of variance with Tukey’s test to determine differences among averages. The average consumption of inverted sugar was significantly lower than that of other treatments. The highest beeswax production average occurred in the sugar syrup treatment. The highest average of ashes, dry matter and reducing sugar occurred, respectively, in sugar-cane juice, inverted sugar and sugar syrup. Sugar syrup may be an alternative energy source for beeswax production, although sugar-cane juice may be more profitable.
Mating flights select for symmetry in honeybee drones (Apis mellifera).
Jaffé, Rodolfo; Moritz, Robin F A
2010-03-01
Males of the honeybee (Apis mellifera) fly to specific drone congregation areas (DCAs), which virgin queens visit in order to mate. From the thousands of drones that are reared in a single colony, only very few succeed in copulating with a queen, and therefore, a strong selection is expected to act on adult drones during their mating flights. In consequence, the gathering of drones at DCAs may serve as an indirect mate selection mechanism, assuring that queens only mate with those individuals having a better flight ability and a higher responsiveness to the queen's visual and chemical cues. Here, we tested this idea relying on wing fluctuating asymmetry (FA) as a measure of phenotypic quality. By recapturing marked drones at a natural DCA and comparing their size and FA with a control sample of drones collected at their maternal hives, we were able to detect any selection on wing size and wing FA occurring during the mating flights. Although we found no solid evidence for selection on wing size, wing FA was found to be significantly lower in the drones collected at the DCA than in those collected at the hives. Our results demonstrate the action of selection during drone mating flights for the first time, showing that developmental stability can influence the mating ability of honeybee drones. We therefore conclude that selection during honeybee drone mating flights may confer some fitness advantages to the queens.
ANALISA KUALITAS LAYANAN SISTEM KOMUNIKASI TETRA PADA KERETA API INDONESIA
Directory of Open Access Journals (Sweden)
Rakhmadany Primananda
2014-07-01
Full Text Available Pada sistem komunikasi dan informasi yang ada pada Perusahaan Terbatas Kereta Api Indonesia (PT KAI Persero masih belum terintegrasi semua untuk saat ini. Sistem komunikasinya masih menggunakan sistem komunikasi analog seperti Very High Frequency (VHF dengan frekuensi 400 MHz dan microwave yang mempunyai frekuensi 2 GHz, dimana kedua frekuensi tersebut terjadi interferensi terhadap frekuensi komunikasi selular. Sistem komunikasi analog ini tidak memungkinkan untuk bisa terintegrasi dengan informasi yang diberikan, karena membutuhkan pengubahan secara digital. Pada penelitian ini dibahas mengenai topologi jaringan TETRA untuk area Daop 1 Jakarta dalam hal ini KRL Jabodetabek dan TETRA untuk area Daop 8 Surabaya dengan simulator OPNET modeler. Hasil uji coba QoS menunjukkan bahwa hasil pembagian trafik yang ada pada 4 slot TDMA masih kurang maksimal untuk mendekati 115,2 kbps dalam hal throughput karena penggunaan channel yang kurang. Untuk SNR sudah didapatkan hasil yang baik yaitu rata-rata di atas 30dB. Perbedaan topologi dan penempatan BTS pada komunikasi sangat berpengaruh terhadap hasil kualitas jaringan yang didapatkan.
Effects of Oxalic Acid on Apis mellifera (Hymenoptera: Apidae).
Rademacher, Eva; Harz, Marika; Schneider, Saskia
2017-08-07
Abstract: Oxalic acid dihydrate is used to treat varroosis of Apis mellifera. This study investigates lethal and sublethal effects of oxalic acid dihydrate on individually treated honeybees kept in cages under laboratory conditions as well as the distribution in the colony. After oral application, bee mortality occurred at relatively low concentrations (No Observed Adverse Effect Level (NOAEL) 50 µg/bee; Lowest Observed Adverse Effect Level (LOAEL) 75 µg/bee) compared to the dermal treatment (NOAEL 212.5 µg/bee; LOAEL 250 µg/bee). The dosage used in regular treatment via dermal application (circa 175 µg/bee) is below the LOAEL, referring to mortality derived in the laboratory. However, the treatment with oxalic acid dihydrate caused sublethal effects: This could be demonstrated in an increased responsiveness to water, decreased longevity and a reduction in pH-values in the digestive system and the hemolymph. The shift towards stronger acidity after treatment confirms that damage to the epithelial tissue and organs is likely to be caused by hyperacidity. The distribution of oxalic acid dihydrate within a colony was shown by macro-computed tomography; it was rapid and consistent. The increased density of the individual bee was continuous for at least 14 days after the treatment indicating the presence of oxalic acid dihydrate in the hive even long after a treatment.
elevatr: Access Elevation Data from Various APIs | Science ...
Several web services are available that provide access to elevation data. This package provides access to several of those services and returns elevation data either as a SpatialPointsDataFrame from point elevation services or as a raster object from raster elevation services. Currently, the package supports access to the Mapzen Elevation Service, Mapzen Terrain Service, and the USGS Elevation Point Query Service. The R language for statistical computing is increasingly used for spatial data analysis . This R package, elevatr, is in response to this and provides access to elevation data from various sources directly in R. The impact of `elevatr` is that it will 1) facilitate spatial analysis in R by providing access to foundational dataset for many types of analyses (e.g. hydrology, limnology) 2) open up a new set of users and uses for APIs widely used outside of R, and 3) provide an excellent example federal open source development as promoted by the Federal Source Code Policy (https://sourcecode.cio.gov/).
blend4php: a PHP API for galaxy.
Wytko, Connor; Soto, Brian; Ficklin, Stephen P
2017-01-01
Galaxy is a popular framework for execution of complex analytical pipelines typically for large data sets, and is a commonly used for (but not limited to) genomic, genetic and related biological analysis. It provides a web front-end and integrates with high performance computing resources. Here we report the development of the blend4php library that wraps Galaxy's RESTful API into a PHP-based library. PHP-based web applications can use blend4php to automate execution, monitoring and management of a remote Galaxy server, including its users, workflows, jobs and more. The blend4php library was specifically developed for the integration of Galaxy with Tripal, the open-source toolkit for the creation of online genomic and genetic web sites. However, it was designed as an independent library for use by any application, and is freely available under version 3 of the GNU Lesser General Public License (LPGL v3.0) at https://github.com/galaxyproject/blend4phpDatabase URL: https://github.com/galaxyproject/blend4php. © The Author(s) 2017. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
SjAPI, the first functionally characterized Ascaris-type protease inhibitor from animal venoms.
Directory of Open Access Journals (Sweden)
Zongyun Chen
Full Text Available BACKGROUND: Serine protease inhibitors act as modulators of serine proteases, playing important roles in protecting animal toxin peptides from degradation. However, all known serine protease inhibitors discovered thus far from animal venom belong to the Kunitz-type subfamily, and whether there are other novel types of protease inhibitors in animal venom remains unclear. PRINCIPAL FINDINGS: Here, by screening scorpion venom gland cDNA libraries, we identified the first Ascaris-type animal toxin family, which contains four members: Scorpiops jendeki Ascaris-type protease inhibitor (SjAPI, Scorpiops jendeki Ascaris-type protease inhibitor 2 (SjAPI-2, Chaerilus tricostatus Ascaris-type protease inhibitor (CtAPI, and Buthus martensii Ascaris-type protease inhibitor (BmAPI. The detailed characterization of Ascaris-type peptide SjAPI from the venom gland of scorpion Scorpiops jendeki was carried out. The mature peptide of SjAPI contains 64 residues and possesses a classical Ascaris-type cysteine framework reticulated by five disulfide bridges, different from all known protease inhibitors from venomous animals. Enzyme and inhibitor reaction kinetics experiments showed that recombinant SjAPI was a dual function peptide with α-chymotrypsin- and elastase-inhibiting properties. Recombinant SjAPI inhibited α-chymotrypsin with a Ki of 97.1 nM and elastase with a Ki of 3.7 μM, respectively. Bioinformatics analyses and chimera experiments indicated that SjAPI contained the unique short side chain functional residues "AAV" and might be a useful template to produce new serine protease inhibitors. CONCLUSIONS/SIGNIFICANCE: To our knowledge, SjAPI is the first functionally characterized animal toxin peptide with an Ascaris-type fold. The structural and functional diversity of animal toxins with protease-inhibiting properties suggested that bioactive peptides from animal venom glands might be a new source of protease inhibitors, which will accelerate the
Woltedji, Dereje; Song, Feifei; Zhang, Lan; Gala, Alemayehu; Han, Bin; Feng, Mao; Fang, Yu; Li, Jianke
2012-09-07
The honeybees Apis mellifera ligustica (Aml) and Apis cerana cerana (Acc) are two different western and eastern bee species that evolved in distinct ecologies and developed specific antennal olfactory systems for their survival. Knowledge of how their antennal olfactory systems function in regards to the success of each respective bee species is scarce. We compared the antennal morphology and proteome between respective sexually mature drones and foraging workers of both species using a scanning electron microscope, two-dimensional electrophoresis, mass spectrometry, bioinformatics, and quantitative real-time polymerase chain reaction. Despite the general similarities in antennal morphology of the drone and worker bees between the two species, a total of 106 and 100 proteins altered their expression in the drones' and the workers' antennae, respectively. This suggests that the differences in the olfactory function of each respective bee are supported by the change of their proteome. Of the 106 proteins that altered their expression in the drones, 72 (68%) and 34 (32%) were overexpressed in the drones of Aml and Acc, respectively. The antennae of the Aml drones were built up by the highly expressed proteins that were involved in carbohydrate metabolism and energy production, molecular transporters, antioxidation, and fatty acid metabolism in contrast to the Acc drones. This is believed to enhance the antennal olfactory functions of the Aml drones as compared to the Acc drones during their mating flight. Likewise, of the 100 proteins with expression changes between the worker bees of the two species, 67% were expressed in higher levels in the antennae of Aml worker contrasting to 33% in the Acc worker. The overall higher expressions of proteins related to carbohydrate metabolism and energy production, molecular transporters, and antioxidation in the Aml workers compared with the Acc workers indicate the Aml workers require more antennal proteins for their olfactory
Intoxicación con glicósidos cardíacos en un perro debido a la ingestión de Cotyledon orbiculata
Planellas, Marta
2010-01-01
Las intoxicaciones por plantas son comunes en animales. En este articulo exponemos un caso de intoxicación en un perro debido a la ingestión de una planta cardiotóxica, Cotyledon orbiculata.. El paciente se presentó con un cuadro agudo gastrointestinal (vómitos y diarreas) y cardíaco (bradicardia severa de 20-40 ppm, con bloqueos atrioventriculares). En la historia clínica destacó la presencia de fragmentos de una planta de jardín en los vómitos del paciente. Después de seis días de hospitali...
Directory of Open Access Journals (Sweden)
Luiz Carlos Pereira Bin
2014-07-01
Full Text Available Objetivo Discutir os significados da vivência de episódios maníacos para pacientes com transtorno bipolar (TAB. Métodos Trata-se de uma pesquisa qualitativa, feita por meio de entrevistas semidirigidas em profundidade, em uma amostra fechada pelo critério de saturação com oito pacientes com TAB em remissão. A técnica de tratamento de dados foi feita por meio da análise de conteúdo das entrevistas transcritas na íntegra e categorização. Os resultados foram submetidos à validação externa, no Laboratório de Pesquisa Clínico-Qualitativa do Departamento de Psicologia Médica e Psiquiatria da Unicamp, composto por 37 pesquisadores do método, entre eles mestrandos, doutorandos, pós-doutorados e pesquisadores seniores. Resultados Foram identificadas três categorias – Ambivalência e vergonha: pensar ou não pensar sobre os episódios maníacos; Organizando sentimentos pessoais: a remissão como um momento de autoconsciência; Episódios maníacos estruturando relações interpessoais versus projeções da angústia. Conclusão Os achados da presente pesquisa contribuem para a maior compreensão dos quadros maníacos no TAB, que podem auxiliar nas reflexões acerca da relação profissional-paciente, para elaborar estratégias para aderência e para as medidas terapêuticas e preventivas da recorrência dos episódios. Podem auxiliar a equipe de saúde envolvida no acompanhamento desses casos e também os pesquisadores na investigação da contribuição dos significados aqui discutidos nos fenômenos de aderência ao tratamento e de um melhor prognóstico.
Thorpe, Stephen E
2017-01-26
An opinion piece was recently published in this journal which, remarkably, is less than one page in length, but has 493 authors (signatories) and has gained over 15 thousand reads on ResearchGate in a very short time. Ceríaco et al. (2016) argue for a blanket ban to be imposed on the uncommon practice of basing new species descriptions in zoology on photographic evidence only of the animal. I herein aim to show that their argument is a non sequitur, i.e. their stated reasons do not support their desired conclusion.
Taponamiento cardíaco debido a perforación de la aurícula derecha por catéter venoso central
V. Ramos Medina; I. Palomo Gómez; Aranda Granados, P.J.; J.L. Palomo Rando; M. Salguero Villadiego
2014-01-01
El taponamiento cardíaco es una complicación devastadora de los catéteres venosos centrales. Se debe en general a que la punta del catéter alcanza indebidamente las cavidades cardíacas derechas. Para la correcta identificación en la autopsia por el patólogo forense es importante que a los pacientes fallecidos en los hospitales que van a ser sometidos a autopsia no se les retiren los dispositivos que tengan insertados, e igualmente que no se les retiren en la sala de autopsias hasta que no se ...
Feng, Mao; Ramadan, Haitham; Han, Bin; Fang, Yu; Li, Jianke
2014-07-05
Hemolymph plays key roles in honey bee molecule transport, immune defense, and in monitoring the physiological condition. There is a lack of knowledge regarding how the proteome achieves these biological missions for both the western and eastern honey bees (Apis mellifera and Apis cerana). A time-resolved proteome was compared using two-dimensional electrophoresis-based proteomics to reveal the mechanistic differences by analysis of hemolymph proteome changes between the worker bees of two bee species during the larval to pupal stages. The brood body weight of Apis mellifera was significantly heavier than that of Apis cerana at each developmental stage. Significantly, different protein expression patterns and metabolic pathways were observed in 74 proteins (166 spots) that were differentially abundant between the two bee species. The function of hemolymph in energy storage, odor communication, and antioxidation is of equal importance for the western and eastern bees, indicated by the enhanced expression of different protein species. However, stronger expression of protein folding, cytoskeletal and developmental proteins, and more highly activated energy producing pathways in western bees suggests that the different bee species have developed unique strategies to match their specific physiology using hemolymph to deliver nutrients and in immune defense. Our disparate findings constitute a proof-of-concept of molecular details that the ecologically shaped different physiological conditions of different bee species match with the hemolymph proteome during the brood stage. This also provides a starting point for future research on the specific hemolymph proteins or pathways related to the differential phenotypes or physiology.
Windows API funkcijų sekų perėmimo bibliotekų tyrimas Windows API Hooking Libraries Research
Directory of Open Access Journals (Sweden)
Lukas Radvilavičius
2011-08-01
Full Text Available
Nagrinėjamos bibliotekos, skirtos Windows API funkcijų sekų perėmimui. Sekų perėmimas gali būti panaudojamas įvairiose srityse: siekiant išsiaiškinti operacinės sistemos veikimo principus, norint atlikti programos derinimą arba pridėti papildomą funkcionalumą prie jau esamo. Straipsnyje apžvelgiamos Windows API ir pateikiamos trečiųjų šalių priemonės funkcijų sekoms perimti. Aptariamos jų teikiamos galimybės, panaudojimo specifika. Taip pat atlikti testai, siekiant išsiaiškinti, kuri biblioteka su užduotimis susitvarko greičiausiai. Tyrimui pasirinkti du nemokami gaminiai: Microsoft Detours ir EasyHook bibliotekos.
Straipsnis lietuvių kalba
The paper describes methods how to apply Windows API hooking with third party libraries and solutions. In this research were used Windows API function SetWindowsHookEx, Detours and EasyHook libraries. Libraries methods, features and advantages were discussed in this paper. The practical part contains libraries tests. In analysis we tested target program start with hooking library and injected function call.
Article in Lithuanian
Development of API 5 CT grade P110 steel casing; Desenvolvimento de tubos casing API 5 CT grau P110
Energy Technology Data Exchange (ETDEWEB)
Kojima, Sergio Seijo; Roza, Juliana Espinossi
2003-07-01
This paper has as objective to discuss the results gotten in experiences carried through in industrial scale for the development of pipes class API 5CT P110 (1), with 244 mm of diameter and 12 mm of thickness. The pipes were welded longitudinally by process ERW (electric resistance welding) and submitted to quenching and tempering heat treatments. A C-Mn-Cr alloy with adequate quenching ability was used for the attainment of a martensite microstructure after quenching. The pipes at a temperature of 880 deg C were quenched in water and subsequently tempered at 515 deg C. The integrity of the weld region was evaluated through non destructive tests and flattening tests, Charpy impact tests and fracture toughness tests (CTOD). The pipes achieved the tension properties stipulated in the standard (yield strength bigger limit of 758 Mpa), and also the energy in the Charpy impact test (transversal), considering that the energy value obtained was 55 J (at 0 deg C) for base metal and 44 J in the weld metal. (author)
Li, Zhiguo; Li, Meng; He, Jingfang; Zhao, Xiaomeng; Chaimanee, Veeranan; Huang, Wei-Fone; Nie, Hongyi; Zhao, Yazhou; Su, Songkun
2017-08-01
Acute toxicities (LD50s) of imidacloprid and clothianidin to Apis mellifera and A. cerana were investigated. Changing patterns of immune-related gene expressions and the activities of four enzymes between the two bee species were compared and analyzed after exposure to sublethal doses of insecticides. Results indicated that A. cerana was more sensitive to imidacloprid and clothianidin than A. mellifera. The acute oral LD50 values of imidacloprid and clothianidin for A. mellifera were 8.6 and 2.0ng/bee, respectively, whereas the corresponding values for A. cerana were 2.7 and 0.5ng/bee. The two bee species possessed distinct abilities to mount innate immune response against neonicotinoids. After 48h of imidacloprid treatment, carboxylesterase (CCE), prophenol oxidase (PPO), and acetylcholinesterase (AChE) activities were significantly downregulated in A. mellifera but were upregulated in A. cerana. Glutathione-S-transferase (GST) activity was significantly elevated in A. mellifera at 48h after exposure to imidacloprid, but no significant change was observed in A. cerana. AChE was downregulated in both bee species at three different time points during clothianidin exposure, and GST activities were upregulated in both species exposed to clothianidin. Different patterns of immune-related gene expression and enzymatic activities implied distinct detoxification and immune responses of A. cerana and A. mellifera to imidacloprid and clothianidin. Copyright © 2017 Elsevier Inc. All rights reserved.
Liu, Yu-Jia; Zhao, Tian-Rui; Zhao, Feng-Yun
2013-01-01
In 2010 and 2011, the honey samples of Apis cerana cerana and A. mellifera ligustica were collected from Kunming and Mengzi of Yunnan Province, respectively, aimed to analyze the melissopalynology and tropic niche of the two bee species. The absolute pollen concentration of the honey of A. cerana cerana was 1.55 x 10(4) ind x g(-1), being significantly higher than that (1.01 x 10(4) ind x g(-1)) of A. mellifera ligustica, and the number of nectar plant species collected by A. cerana cerana was 12.9, also significantly higher than that (7.7) collected by A. mellifera ligustica, indicating that A. cerana cerana could utilize more nectar plants, while A. mellifera ligustica had stronger selectivity to the nectar plants. The trophic niche breadth of A. cerana cerana was 0.35, which was significantly higher than that (0.23) of A. mellifera ligustica. The trophic niche overlap index between the two bee species was 0.71, and the interspecific competition index was 0.93, suggesting that the food competition between A. cerana cerana and A. mellifera ligustica was fierce.
Espectro óculo-aurículo-vertebral em pacientes com defeitos cardíacos congênitos
Directory of Open Access Journals (Sweden)
Rafael Fabiano Machado Rosa
2010-10-01
Full Text Available FUNDAMENTO: Há poucos estudos avaliando a frequência do espectro óculo-aurículo-vertebral (EOAV nos pacientes com defeitos cardíacos congênitos (DCC. OBJETIVO: Verificar a frequência do EOAV em uma amostra de pacientes com malformações cardíacas graves. MÉTODOS: Avaliamos uma coorte prospectiva de pacientes com DCC, admitidos em uma unidade de terapia intensiva (UTI cardiopediátrica no Brasil. O diagnóstico de EOAV foi feito com base em dados clínicos, considerando critérios padrões. Os pacientes que preenchiam esses critérios foram submetidos ao cariótipo de alta resolução com bandamento GTG e hibridização fluorescente in situ para a microdeleção 22q11.2. O teste exato de Fisher (P < 0,05 foi usado para as análises estatísticas. RESULTADOS: Durante o período de avaliação, 330 pacientes foram hospitalizados pela primeira vez na UTI, mas trinta deles não participaram deste estudo. Dos 300 pacientes que constituíram a amostragem final, o EOAV foi verificado em três casos (1%. Todos apresentaram estudos citogenéticos normais. CONCLUSÃO: O EOAV parece ser uma condição frequente em pacientes com DCC. Contudo, não podemos excluir a possibilidade de que a frequência de EOAV encontrada em nosso estudo possa ter sido subestimada devido à baixa taxa de detecção pré-natal de DCC e ao acesso limitado dos pacientes ao tratamento médico apropriado em nosso meio. Estudos prospectivos futuros com critérios clínicos bem definidos e pacientes com defeitos leves e graves serão importantes para avaliar o papel do EOAV na população em geral de indivíduos com malformações cardíacas.
Resultados del tratamiento quirúrgico en el traumatismo cardíaco y de grandes vasos
Directory of Open Access Journals (Sweden)
Armando Leal Mursulí
2000-12-01
Full Text Available Se informa que la frecuencia de lesiones cardíacas y vasculares tratadas quirúrgicamente ha aumentado considerablemente, por un aumento de la violencia urbana y el mejoramiento de los servicios de emergencia médica, fundamentalmente en el transporte hospitalario que ha permitido que pacientes con lesiones cardiovasculares lleguen vivos a los centros hospitalarios. Con el objetivo de conocer características del trauma y resultados del tratamiento, se realizó una investigación retrospectiva desde 1987 hasta 1999, en estos pacientes. Se intervinieron 15, 11 del sexo masculino; con una edad promedio de 29 años; 11 pacientes mostraban heridas cardíacas, 2 de vena cava superior, 1 de la ácigos y 1 de vena cava inferior. Predominaron lesiones por arma blanca (93,3 %. La principal forma de presentación fue el taponamiento cardíaco (40 %. El abordaje quirúrgico que más se usó fue la toracotomía posterolateral y la anterolateral izquierda. La lesión asociada más frecuente fue la laceración pulmonar (46,6 %. Las infecciones respiratorias fueron la principal complicación. Hubo un solo fallecido. Se demuestra la necesidad de un tratamiento quirúrgico inmediato, pues sólo así se logrará una supervivencia mayorIt is reported that the frequency of surgically treated heart and vascular injuries has increased considerable due to a rise of urban violence and to the improvement of the emergency medical services, mainly in the hospital transportation that has allowed that patients with cardiovascular injuries arrive alive to the hospitals. In order to know the characteristics of the trauma and the results of the treatment, a retrospective research was made among these patients from 1987 to 1999. 15,11 males with an average age of 29 years old were operated on. 11 patients had heart wounds, 2 of the superior vena cava, 1 of the azygous vein and 1 of the inferior vena cava. A prevalence of steel arm lesions (93,3% was observed. The main form of
A pro-inflammatory role of C5L2 in C5a-primed neutrophils for ANCA-induced activation.
Directory of Open Access Journals (Sweden)
Jian Hao
Full Text Available BACKGROUND: The complement system is crucial for the development of antineutrophil cytoplasmic antibody (ANCA-associated vasculitis (AAV. In particular, C5a and its receptor on neutrophils, CD88, play a central role. The functional role of the second receptor of C5a, C5L2, remains unclear. In the current study, we investigated the role of C5L2 in C5a-primed neutrophils for ANCA-induced activation. METHODS: The effect of blocking C5L2 by anti-human C5L2 blocking antibody were tested on respiratory burst and degranulation of C5a-primed neutrophils activated with ANCA, as well as on membrane-bound proteinase 3 (mPR3 and concentration of myeloperoxidase (MPO in supernatant of C5a-primed neutrophils. An antagonist for CD88 was also employed. RESULTS: Blocking C5L2 resulted in a significantly decreased MPO concentration in the supernatant of C5a-primed neutrophils. mPR3 expression increased from 209.0±43.0 in untreated cells to 444.3±60.8 after C5a treatment (P<0.001, and decreased to 375.8±65.44, 342.2±54.3 and 313.7±43.6 by pre-incubating blocking C5L2 antibody at 2.5 µg/ml, 5 µg/ml or 10 µg/ml (compared with C5a-priming group, P<0.001, P<0.001, and P<0.001, respectively. In C5a-primed neutrophils, subsequently activating with MPO-ANCA-positive IgG, the MFI value was 425.8±160.6, which decreased to 292.8±141.2, 289.7±130.0 and 280.3±136.4 upon pre-incubation with mouse anti-human C5L2 blocking antibody at 2.5 µg/ml, 5 µg/ml or 10 µg/ml (compared with C5a-primed neutrophils, for MPO-ANCA-positive IgG-induced activation, P<0.05, P<0.05, and P<0.05, respectively. Blocking C5L2 also resulted in significantly decreased C5a-primed neutrophils for PR3-ANCA-positive IgG-induced activation. Moreover, the lactoferrin concentration in the supernant significantly decreased in pre-incubation with anti-human C5L2 blocking antibody, compared with C5a-primed neutrophils induced by PR3- or MPO-ANCA-positive IgG. CONCLUSIONS: C5L2 may be implicated in
Acaricide, fungicide and drug interactions in honey bees (Apis mellifera).
Johnson, Reed M; Dahlgren, Lizette; Siegfried, Blair D; Ellis, Marion D
2013-01-01
Chemical analysis shows that honey bees (Apis mellifera) and hive products contain many pesticides derived from various sources. The most abundant pesticides are acaricides applied by beekeepers to control Varroa destructor. Beekeepers also apply antimicrobial drugs to control bacterial and microsporidial diseases. Fungicides may enter the hive when applied to nearby flowering crops. Acaricides, antimicrobial drugs and fungicides are not highly toxic to bees alone, but in combination there is potential for heightened toxicity due to interactive effects. Laboratory bioassays based on mortality rates in adult worker bees demonstrated interactive effects among acaricides, as well as between acaricides and antimicrobial drugs and between acaricides and fungicides. Toxicity of the acaricide tau-fluvalinate increased in combination with other acaricides and most other compounds tested (15 of 17) while amitraz toxicity was mostly unchanged (1 of 15). The sterol biosynthesis inhibiting (SBI) fungicide prochloraz elevated the toxicity of the acaricides tau-fluvalinate, coumaphos and fenpyroximate, likely through inhibition of detoxicative cytochrome P450 monooxygenase activity. Four other SBI fungicides increased the toxicity of tau-fluvalinate in a dose-dependent manner, although possible evidence of P450 induction was observed at the lowest fungicide doses. Non-transitive interactions between some acaricides were observed. Sublethal amitraz pre-treatment increased the toxicity of the three P450-detoxified acaricides, but amitraz toxicity was not changed by sublethal treatment with the same three acaricides. A two-fold change in the toxicity of tau-fluvalinate was observed between years, suggesting a possible change in the genetic composition of the bees tested. Interactions with acaricides in honey bees are similar to drug interactions in other animals in that P450-mediated detoxication appears to play an important role. Evidence of non-transivity, year-to-year variation
Studies of learned helplessness in honey bees (Apis mellifera ligustica).
Dinges, Christopher W; Varnon, Christopher A; Cota, Lisa D; Slykerman, Stephen; Abramson, Charles I
2017-04-01
The current study reports 2 experiments investigating learned helplessness in the honey bee (Apis mellifera ligustica). In Experiment 1, we used a traditional escape method but found the bees' activity levels too high to observe changes due to treatment conditions. The bees were not able to learn in this traditional escape procedure; thus, such procedures may be inappropriate to study learned helplessness in honey bees. In Experiment 2, we used an alternative punishment, or passive avoidance, method to investigate learned helplessness. Using a master and yoked design where bees were trained as either master or yoked and tested as either master or yoked, we found that prior training with unavoidable and inescapable shock in the yoked condition interfered with avoidance and escape behavior in the later master condition. Unlike control bees, learned helplessness bees failed to restrict their movement to the safe compartment following inescapable shock. Unlike learned helplessness studies in other animals, no decrease in general activity was observed. Furthermore, we did not observe a "freezing" response to inescapable aversive stimuli-a phenomenon, thus far, consistently observed in learned helplessness tests with other species. The bees, instead, continued to move back and forth between compartments despite punishment in the incorrect compartment. These findings suggest that, although traditional escape methods may not be suitable, honey bees display learned helplessness in passive avoidance procedures. Thus, regardless of behavioral differences from other species, honey bees can be a unique invertebrate model organism for the study of learned helplessness. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Detection of Illicit Drugs by Trained Honeybees (Apis mellifera.
Directory of Open Access Journals (Sweden)
Matthias Schott
Full Text Available Illegal drugs exacerbate global social challenges such as substance addiction, mental health issues and violent crime. Police and customs officials often rely on specially-trained sniffer dogs, which act as sensitive biological detectors to find concealed illegal drugs. However, the dog "alert" is no longer sufficient evidence to allow a search without a warrant or additional probable cause because cannabis has been legalized in two US states and is decriminalized in many others. Retraining dogs to recognize a narrower spectrum of drugs is difficult and training new dogs is time consuming, yet there are no analytical devices with the portability and sensitivity necessary to detect substance-specific chemical signatures. This means there is currently no substitute for sniffer dogs. Here we describe an insect screening procedure showing that the western honeybee (Apis mellifera can sense volatiles associated with pure samples of heroin and cocaine. We developed a portable electroantennographic device for the on-site measurement of volatile perception by these insects, and found a positive correlation between honeybee antennal responses and the concentration of specific drugs in test samples. Furthermore, we tested the ability of honeybees to learn the scent of heroin and trained them to show a reliable behavioral response in the presence of a highly-diluted scent of pure heroin. Trained honeybees could therefore be used to complement or replace the role of sniffer dogs as part of an automated drug detection system. Insects are highly sensitive to volatile compounds and provide an untapped resource for the development of biosensors. Automated conditioning as presented in this study could be developed as a platform for the practical detection of illicit drugs using insect-based sensors.
Viruses associated with ovarian degeneration in Apis mellifera L. queens.
Directory of Open Access Journals (Sweden)
Laurent Gauthier
Full Text Available Queen fecundity is a critical issue for the health of honeybee (Apis mellifera L. colonies, as she is the only reproductive female in the colony and responsible for the constant renewal of the worker bee population. Any factor affecting the queen's fecundity will stagnate colony development, increasing its susceptibility to opportunistic pathogens. We discovered a pathology affecting the ovaries, characterized by a yellow discoloration concentrated in the apex of the ovaries resulting from degenerative lesions in the follicles. In extreme cases, marked by intense discoloration, the majority of the ovarioles were affected and these cases were universally associated with egg-laying deficiencies in the queens. Microscopic examination of the degenerated follicles showed extensive paracrystal lattices of 30 nm icosahedral viral particles. A cDNA library from degenerated ovaries contained a high frequency of deformed wing virus (DWV and Varroa destructor virus 1 (VDV-1 sequences, two common and closely related honeybee Iflaviruses. These could also be identified by in situ hybridization in various parts of the ovary. A large-scale survey for 10 distinct honeybee viruses showed that DWV and VDV-1 were by far the most prevalent honeybee viruses in queen populations, with distinctly higher prevalence in mated queens (100% and 67%, respectively for DWV and VDV-1 than in virgin queens (37% and 0%, respectively. Since very high viral titres could be recorded in the ovaries and abdomens of both functional and deficient queens, no significant correlation could be made between viral titre and ovarian degeneration or egg-laying deficiency among the wider population of queens. Although our data suggest that DWV and VDV-1 have a role in extreme cases of ovarian degeneration, infection of the ovaries by these viruses does not necessarily result in ovarian degeneration, even at high titres, and additional factors are likely to be involved in this pathology.
Acaricide, fungicide and drug interactions in honey bees (Apis mellifera.
Directory of Open Access Journals (Sweden)
Reed M Johnson
Full Text Available BACKGROUND: Chemical analysis shows that honey bees (Apis mellifera and hive products contain many pesticides derived from various sources. The most abundant pesticides are acaricides applied by beekeepers to control Varroa destructor. Beekeepers also apply antimicrobial drugs to control bacterial and microsporidial diseases. Fungicides may enter the hive when applied to nearby flowering crops. Acaricides, antimicrobial drugs and fungicides are not highly toxic to bees alone, but in combination there is potential for heightened toxicity due to interactive effects. METHODOLOGY/PRINCIPAL FINDINGS: Laboratory bioassays based on mortality rates in adult worker bees demonstrated interactive effects among acaricides, as well as between acaricides and antimicrobial drugs and between acaricides and fungicides. Toxicity of the acaricide tau-fluvalinate increased in combination with other acaricides and most other compounds tested (15 of 17 while amitraz toxicity was mostly unchanged (1 of 15. The sterol biosynthesis inhibiting (SBI fungicide prochloraz elevated the toxicity of the acaricides tau-fluvalinate, coumaphos and fenpyroximate, likely through inhibition of detoxicative cytochrome P450 monooxygenase activity. Four other SBI fungicides increased the toxicity of tau-fluvalinate in a dose-dependent manner, although possible evidence of P450 induction was observed at the lowest fungicide doses. Non-transitive interactions between some acaricides were observed. Sublethal amitraz pre-treatment increased the toxicity of the three P450-detoxified acaricides, but amitraz toxicity was not changed by sublethal treatment with the same three acaricides. A two-fold change in the toxicity of tau-fluvalinate was observed between years, suggesting a possible change in the genetic composition of the bees tested. CONCLUSIONS/SIGNIFICANCE: Interactions with acaricides in honey bees are similar to drug interactions in other animals in that P450-mediated detoxication
Student project of optical system analysis API-library development
Ivanova, Tatiana; Zhukova, Tatiana; Dantcaranov, Ruslan; Romanova, Maria; Zhadin, Alexander; Ivanov, Vyacheslav; Kalinkina, Olga
2017-08-01
In the paper API-library software developed by students of Applied and Computer Optics Department (ITMO University) for optical system design is presented. The library performs paraxial and real ray tracing, calculates 3d order (Seidel) aberration and real ray aberration of axis and non-axis beams (wave, lateral, longitudinal, coma, distortion etc.) and finally, approximate wave aberration by Zernike polynomials. Real aperture can be calculated by considering of real rays tracing failure on each surface. So far we assume optical system is centered, with spherical or 2d order aspherical surfaces. Optical glasses can be set directly by refraction index or by dispersion coefficients. The library can be used for education or research purposes in optical system design area. It provides ready to use software functions for optical system simulation and analysis that developer can simply plug into their software development for different purposes, for example for some specific synthesis tasks or investigation of new optimization modes. In the paper we present an example of using the library for development of cemented doublet synthesis software based on Slusarev's methodology. The library is used in optical system optimization recipes course for deep studying of optimization model and its application for optical system design. Development of such software is an excellent experience for students and help to understanding optical image modeling and quality analysis. This development is organized as student group joint project. We try to organize it as a group in real research and development project, so each student has his own role in the project and then use whole library functionality in his own master or bachelor thesis. Working in such group gives students useful experience and opportunity to work as research and development engineer of scientific software in the future.
Transcriptome analysis of the Asian honey bee Apis cerana cerana.
Directory of Open Access Journals (Sweden)
Zi Long Wang
Full Text Available BACKGROUND: The Eastern hive honey bee, Apis cerana cerana is a native and widely bred honey bee species in China. Molecular biology research about this honey bee species is scarce, and genomic information for A. c. cerana is not currently available. Transcriptome and expression profiling data for this species are therefore important resources needed to better understand the biological mechanisms of A. c. cerana. In this study, we obtained the transcriptome information of A. c. cerana by RNA-sequencing and compared gene expression differences between queens and workers of A. c. cerana by digital gene expression (DGE analysis. RESULTS: Using high-throughput Illumina RNA sequencing we obtained 51,581,510 clean reads corresponding to 4.64 Gb total nucleotides from a single run. These reads were assembled into 46,999 unigenes with a mean length of 676 bp. Based on a sequence similarity search against the five public databases (NR, Swissport, GO, COG, KEGG with a cut-off E-value of 10(-5 using BLASTX, a total of 24,630 unigenes were annotated with gene descriptions, gene ontology terms, or metabolic pathways. Using these transcriptome data as references we analyzed the gene expression differences between the queens and workers of A. c. cerana using a tag-based digital gene expression method. We obtained 5.96 and 5.66 million clean tags from the queen and worker samples, respectively. A total of 414 genes were differentially expressed between them, with 189 up-regulated and 225 down-regulated in queens. CONCLUSIONS: Our transcriptome data provide a comprehensive sequence resource for future A. c. cerana study, establishing an important public information platform for functional genomic studies in A. c. cerana. Furthermore, the DGE data provide comprehensive gene expression information for the queens and workers, which will facilitate our understanding of the molecular mechanisms of the different physiological aspects of the two castes.
Antibacterial Activity of a Cardanol from Thai Apis mellifera Propolis
Boonsai, Pattaraporn; Phuwapraisirisan, Preecha; Chanchao, Chanpen
2014-01-01
Background: Propolis is a sticky, dark brown resinous residue made by bees that is derived from plant resins. It is used to construct and repair the nest, and in addition possesses several diverse bioactivities. Here, propolis from Apis mellifera from Nan province, Thailand, was tested for antibacterial activity against Gram+ve (Staphylococcus aureus and Paenibacillus larvae) and Gram-ve (Escherichia coli) bacteria. Materials and methods: The three bacterial isolates were confirmed for species designation by Gram staining and analysis of the partial sequence of 16S rDNA. Propolis was sequentially extracted by methanol, dichloromethane and hexane. The antibacterial activity was determined by agar well diffusion and microbroth dilution assays using streptomycin as a positive control. The most active crude extract was further purified by quick column and adsorption chromatography. The apparent purity of each bioactive fraction was tested by thin layer chromatography. The chemical structure of the isolated bioactive compound was analyzed by nuclear magnetic resonance (NMR). Results: Crude methanol extract of propolis showed the best antibacterial activity with a minimum inhibition concentration (MIC) value of 5 mg/mL for S. aureus and E. coli and 6.25 mg/mL for P. larvae. After quick column chromatography, only three active fractions were inhibitory to the growth of S. aureus and E. coli with MIC values of 6.25 and 31.3 µg/mL, respectively. Further adsorption chromatography yielded one pure bioactive fraction (A1A) with an IC50 value of 0.175 µg/mL for E. coli and 0.683 µg/mL for P. larvae, and was determined to be cardanol by NMR analysis. Scanning and transmission electron microscopy analysis revealed unusual shaped (especially in dividing cells), damaged and dead cells in cardanol-treated E. coli. Conclusion: Thai propolis contains a promising antibacterial agent. PMID:24578609
Acaricide, Fungicide and Drug Interactions in Honey Bees (Apis mellifera)
Johnson, Reed M.; Dahlgren, Lizette; Siegfried, Blair D.; Ellis, Marion D.
2013-01-01
Background Chemical analysis shows that honey bees (Apis mellifera) and hive products contain many pesticides derived from various sources. The most abundant pesticides are acaricides applied by beekeepers to control Varroa destructor. Beekeepers also apply antimicrobial drugs to control bacterial and microsporidial diseases. Fungicides may enter the hive when applied to nearby flowering crops. Acaricides, antimicrobial drugs and fungicides are not highly toxic to bees alone, but in combination there is potential for heightened toxicity due to interactive effects. Methodology/Principal Findings Laboratory bioassays based on mortality rates in adult worker bees demonstrated interactive effects among acaricides, as well as between acaricides and antimicrobial drugs and between acaricides and fungicides. Toxicity of the acaricide tau-fluvalinate increased in combination with other acaricides and most other compounds tested (15 of 17) while amitraz toxicity was mostly unchanged (1 of 15). The sterol biosynthesis inhibiting (SBI) fungicide prochloraz elevated the toxicity of the acaricides tau-fluvalinate, coumaphos and fenpyroximate, likely through inhibition of detoxicative cytochrome P450 monooxygenase activity. Four other SBI fungicides increased the toxicity of tau-fluvalinate in a dose-dependent manner, although possible evidence of P450 induction was observed at the lowest fungicide doses. Non-transitive interactions between some acaricides were observed. Sublethal amitraz pre-treatment increased the toxicity of the three P450-detoxified acaricides, but amitraz toxicity was not changed by sublethal treatment with the same three acaricides. A two-fold change in the toxicity of tau-fluvalinate was observed between years, suggesting a possible change in the genetic composition of the bees tested. Conclusions/Significance Interactions with acaricides in honey bees are similar to drug interactions in other animals in that P450-mediated detoxication appears to play an
Intraspecific Aggression in Giant Honey Bees (Apis dorsata
Directory of Open Access Journals (Sweden)
Frank Weihmann
2014-09-01
Full Text Available We investigated intraspecific aggression in experimental nests (expN1, expN2 of the giant honey bee Apis dorsata in Chitwan (Nepal, focusing on interactions between surface bees and two other groups of bees approaching the nest: (1 homing “nestmate” foragers landing on the bee curtain remained unmolested by guards; and (2 supposed “non-nestmate” bees, which were identified by their erratic flight patterns in front of the nest, such as hovering or sideways scanning and splaying their legs from their body, and were promptly attacked by the surface bees after landing. These supposed non-nestmate bees only occurred immediately before and after migration swarms, which had arrived in close vicinity (and were most likely scouting for a nesting site. In total, 231 of the “nestmate” foragers (fb and 102 approaches of such purported “non-nestmate” scouts (sc were analysed (total observation time expN1: 5.43 min regarding the evocation of shimmering waves (sh. During their landing the “nestmate” foragers provoked less shimmering waves (relnsh[fb] = 23/231 = 0.0996, relnsh[sc] = 75/102 = 0.7353; p <0.001, χ2-test with shorter duration (Dsh[fb] = 197 ± 17 ms, Dsh[sc] = 488 ± 16 ms; p <0.001; t-test than “non-nestmates”. Moreover, after having landed on the nest surface, the “non-nestmates” were attacked by the surface bees (expN1, expN2: observation time >18 min quite similarly to the defensive response against predatory wasps. Hence, the surface members of settled colonies respond differently to individual giant honey bees approaching the nest, depending on whether erratic flight patterns are displayed or not.
Energy Technology Data Exchange (ETDEWEB)
Souza, Kleber Eduardo Siqueira; Maciel, Theophilo Moura; Albuquerque, Maria Clea Soares de; Almeida, Daisy Martins de [Universidade Federal de Campina Grande, PB (Brazil). Dept. de Engenharia de Materiais
2004-12-15
In this work the influence of the variation of the welding parameters and chemical composition of weld metal obtained with different filler metals and b different welding process on the microhardness values and on the acicular ferrite (AF) and primary ferrite (PF) percentiles from the columnar grain region were evaluated. Thee welding processes used were Shielded Manual Metal Arc Welding (SMAW) and semiautomatic processes, such as Flux Cored Arc Welding (FCAW), with protection of CO{sub 2} and inner shield, process MGAW with protection of CO{sub 2} and of CO{sub 2} + Argon and process MGAW with protection of argon. The obtained results indicated that the percentile of AF and PF vary from 48 to 61 per cent and from 28 to 44 per cent respectively. The weld metals that obtained the higher values of A F were those welded by process FCAW inner shield and MGAW with higher values of Equivalent Carbon and with lower heat input. (author)
JEnsembl: a version-aware Java API to Ensembl data systems
Paterson, Trevor; Law, Andy
2012-01-01
Motivation: The Ensembl Project provides release-specific Perl APIs for efficient high-level programmatic access to data stored in various Ensembl database schema. Although Perl scripts are perfectly suited for processing large volumes of text-based data, Perl is not ideal for developing large-scale software applications nor embedding in graphical interfaces. The provision of a novel Java API would facilitate type-safe, modular, object-orientated development of new Bioinformatics tools with which to access, analyse and visualize Ensembl data. Results: The JEnsembl API implementation provides basic data retrieval and manipulation functionality from the Core, Compara and Variation databases for all species in Ensembl and EnsemblGenomes and is a platform for the development of a richer API to Ensembl datasources. The JEnsembl architecture uses a text-based configuration module to provide evolving, versioned mappings from database schema to code objects. A single installation of the JEnsembl API can therefore simultaneously and transparently connect to current and previous database instances (such as those in the public archive) thus facilitating better analysis repeatability and allowing ‘through time’ comparative analyses to be performed. Availability: Project development, released code libraries, Maven repository and documentation are hosted at SourceForge (http://jensembl.sourceforge.net). Contact: jensembl-develop@lists.sf.net, andy.law@roslin.ed.ac.uk, trevor.paterson@roslin.ed.ac.uk PMID:22945789
Distribution of Nosema ceranae in the European honeybee, Apis mellifera in Japan.
Yoshiyama, Mikio; Kimura, Kiyoshi
2011-02-01
The microsporidian species, Nosema apis and Nosema ceranae are both known to infect the European honeybee, Apis mellifera. Nosema disease has a global distribution and is responsible for considerable economic losses among apiculturists. In this study, 336 honeybee samples from 18 different prefectures in Japan were examined for the presence of N. apis and N. ceranae using a PCR technique. Although N. ceranae was not detected in most of the apiaries surveyed, the parasite was detected at three of the sites examined. Further, N. ceranae appears to be patchily distributed across Japan and no apparent geographic difference was observed among the areas surveyed. In addition, the apparent absence of N. apis suggests that N. ceranae may be displacing N. apis in A. mellifera in Japan. Partial SSU rRNA gene sequence analysis revealed the possible existence of two N. ceranae groups from different geographic regions in Japan. It seems likely that these microsporidian parasites were introduced into Japan through the importation of either contaminated honeybee-related products or infected queens. This study confirmed that PCR detection is effective for indicating the presence of this pathogen in seemingly healthy colonies. It is therefore hoped that the results presented here will improve our understanding of the epidemiology of Nosema disease so that effective controls can be implemented. Copyright © 2010 Elsevier Inc. All rights reserved.
Nabian, S; Ahmadi, K; Nazem Shirazi, Mh; Gerami Sadeghian, A
2011-08-01
Nosemosis of European honey bee (Apis mellifera) is present in bee colonies worldwide. Until recently, Nosema apis had been regarded as the causative agent of the disease, that causes heavy economic losses in apicultures. Nosema ceranae is an emerging microsporidian parasite of European honeybees, A. mellifera, but its distribution is not well known. Previously, nosemosis in honeybees in Iran was attributed exclusively to N. apis. Six Nosema positive samples (determined from light microscopy of spores) of adult worker bees from one province of Iran (Savadkouh- Mazandaran, northern Iran) were tested to determine Nosema species using previously- developed PCR primers of the 16 S rRNA gene. As it is difficult to distinguish N. ceranae and N. apis morphologically, a PCR assay based on 16 S ribosomal RNA has been used to differentiate N. apis and N. ceranae. Only N. ceranae was found in all samples, indicating that this species present in Iran apiaries. This is the first report of N. ceranae in colonies of A. mellifera in Iran. It seems that intensive surveys are needed to determine the distribution and prevalence of N. ceranae in different regions of Iran.
JEnsembl: a version-aware Java API to Ensembl data systems.
Paterson, Trevor; Law, Andy
2012-11-01
The Ensembl Project provides release-specific Perl APIs for efficient high-level programmatic access to data stored in various Ensembl database schema. Although Perl scripts are perfectly suited for processing large volumes of text-based data, Perl is not ideal for developing large-scale software applications nor embedding in graphical interfaces. The provision of a novel Java API would facilitate type-safe, modular, object-orientated development of new Bioinformatics tools with which to access, analyse and visualize Ensembl data. The JEnsembl API implementation provides basic data retrieval and manipulation functionality from the Core, Compara and Variation databases for all species in Ensembl and EnsemblGenomes and is a platform for the development of a richer API to Ensembl datasources. The JEnsembl architecture uses a text-based configuration module to provide evolving, versioned mappings from database schema to code objects. A single installation of the JEnsembl API can therefore simultaneously and transparently connect to current and previous database instances (such as those in the public archive) thus facilitating better analysis repeatability and allowing 'through time' comparative analyses to be performed. Project development, released code libraries, Maven repository and documentation are hosted at SourceForge (http://jensembl.sourceforge.net).
Xiong, Wenhao; Tian, Xin; Chen, Genshe; Pham, Khanh; Blasch, Erik
2017-05-01
Software defined radio (SDR) has become a popular tool for the implementation and testing for communications performance. The advantage of the SDR approach includes: a re-configurable design, adaptive response to changing conditions, efficient development, and highly versatile implementation. In order to understand the benefits of SDR, the space telecommunication radio system (STRS) was proposed by NASA Glenn research center (GRC) along with the standard application program interface (API) structure. Each component of the system uses a well-defined API to communicate with other components. The benefit of standard API is to relax the platform limitation of each component for addition options. For example, the waveform generating process can support a field programmable gate array (FPGA), personal computer (PC), or an embedded system. As long as the API defines the requirements, the generated waveform selection will work with the complete system. In this paper, we demonstrate the design and development of adaptive SDR following the STRS and standard API protocol. We introduce step by step the SDR testbed system including the controlling graphic user interface (GUI), database, GNU radio hardware control, and universal software radio peripheral (USRP) tranceiving front end. In addition, a performance evaluation in shown on the effectiveness of the SDR approach for space telecommunication.
Using Map Service API for Driving Cycle Detection for Wearable GPS Data: Preprint
Energy Technology Data Exchange (ETDEWEB)
Zhu, Lei [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Gonder, Jeffrey D [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-12-06
Following advancements in smartphone and portable global positioning system (GPS) data collection, wearable GPS data have realized extensive use in transportation surveys and studies. The task of detecting driving cycles (driving or car-mode trajectory segments) from wearable GPS data has been the subject of much research. Specifically, distinguishing driving cycles from other motorized trips (such as taking a bus) is the main research problem in this paper. Many mode detection methods only focus on raw GPS speed data while some studies apply additional information, such as geographic information system (GIS) data, to obtain better detection performance. Procuring and maintaining dedicated road GIS data are costly and not trivial, whereas the technical maturity and broad use of map service application program interface (API) queries offers opportunities for mode detection tasks. The proposed driving cycle detection method takes advantage of map service APIs to obtain high-quality car-mode API route information and uses a trajectory segmentation algorithm to find the best-matched API route. The car-mode API route data combined with the actual route information, including the actual mode information, are used to train a logistic regression machine learning model, which estimates car modes and non-car modes with probability rates. The experimental results show promise for the proposed method's ability to detect vehicle mode accurately.
U.S. Department of Health & Human Services — The Advance Payment Model is designed for physician-based and rural providers who have come together voluntarily to give coordinated high quality care to the...
Directory of Open Access Journals (Sweden)
Guillermo Sánchez Vanegas
2016-04-01
Full Text Available
El marcapasos es actualmente la prótesis más utilizada en el mundo, por lo cual es importante que la comunidad médica conozca sus características y diferentes usos en este momento; además ha sido uno de los dispositivos más accesibles a la comunidad, mejorando la calidad de vida de los pacientes.
En 1932 el médico Albert Hyman describió un aparato que generaba impulsos eléctricos al músculo miocárdico, considerándose así el padre del marcapasos, y a través del tiempo ha sido modificado y mejorado por múltiples médicos y electrofisiólogos. Está compuesto de una batería, un generador de impulsos y electrodos conductores que están ubicados en las cámaras o en la cámara del corazón que sea necesario, siendo estos los encargados de generar el impulso y así mantener un ritmo estable.
La primera patología en que se implantó un marcapasos fue el bloqueo aurículo-ventricular y actualmente es el motivo por el que más se usa, aunque también se ha utilizado en múltiples patologías como arritmias y bloqueos causados por infarto agudo de miocardio, entre otras.
Los pacientes que tienen marcapasos necesitan una serie de recomendaciones que deben ser dadas por el médico, por lo cual es importante conocer, por parte de la comunidad médica, qué puede interferir con su adecuado funcionamiento: la resonancia magnética, los teléfonos, los procesos dentales, los defectos del marcapasos y los traumas y ocasionar daño de alguna de sus partes.
Angiosarcomas cardíacos. Implicación diagnóstica, pronóstica y terapéutica
Directory of Open Access Journals (Sweden)
Luciana Schocron
2007-01-01
Full Text Available Los tumores cardíacos primarios constituyen una entidad rara. Sólo el 10% a 25% de ellos son malignos y el angiosarcoma es el más frecuente. Ocasionan sintomatología cardíaca y sistémica variada, por sí mismos o por compromiso de otros órganos, lo que puede simular otras patologías y derivar en un retraso del diagnóstico de certeza.Se describen dos casos de angiosarcoma cardíaco con presentaciones atípicas, por lo que inicialmente no se consideró esta patología como un diagnóstico probable.Se requiere un alto grado de sospecha clínica, junto con métodos por imágenes de alta resolución como la resonancia magnética, para la aproximación diagnóstica correcta y el tratamiento adecuado.
Directory of Open Access Journals (Sweden)
Andrey José Monteiro
2008-09-01
Full Text Available Tamponamento cardíaco secundário ao uso de cateter venoso central é uma complicação rara, porém potencialmente tratável, quando identificada a tempo. Nós relatamos dois casos de tamponamento cardíaco, diagnosticados por ecocardiograma transtorácico, seguido de pericardiocentese de urgência e drenagem pericárdica cirúrgica como complicação de cateterização venosa umbilical. Em um caso, a ponta do cateter estava adequadamente localizada e, no outro caso, não. Em ambos os casos, solução hiperosmolar estava sendo infundida. Apesar de situação incomum, esta deve ser sempre considerada em neonato, evoluindo com choque cardiogênico sem causa aparente.Cardiac tamponade secondary to the use of central venous catheter is a rare complication; however, it is potentially reversible when it is caught in time. We report two cases of cardiac tamponade that was diagnosed using a transthoracic echocardiography, followed by urgent pericardiocentesis and surgical pericardial drainage as a complication from umbilical venous catheterization. In one case, the tip of the catheter was properly placed, and in the other case, it was not. In both cases, a hyperosmolar solution was being injected. Although it may be an uncommon situation, it should be always considered as a possibility in a newborn who develops cardiogenic shock without an apparent cause.
Mixomas cardíacos: presentación clínica, resultados quirúrgicos y pronóstico a largo plazo
Directory of Open Access Journals (Sweden)
María N. Pizzi
2010-01-01
Full Text Available RESUMENIntroducciónLos tumores cardíacos primarios constituyen una patología poco frecuente y de ellos elmixoma es el más común. Con el progreso acelerado de los métodos por imágenes se haincrementado la frecuencia de su identificación in vivo. El cuadro clínico de presentaciónvaría ampliamente de acuerdo con el tamaño y la localización tumoral. En Latinoaméricason escasas las comunicaciones acerca de los resultados quirúrgicos de la resección demixomas cardíacos y del pronóstico a largo plazo.ObjetivosAnalizar la forma de presentación anatomoclínica, los resultados perioperatorios y la evoluciónde pacientes con mixoma cardíaco sometidos a resección quirúrgica.Material y métodosRevisión de 59 casos de mixomas cardíacos operados en nuestro centro entre 1992 y 2006.El seguimiento se realizó mediante consulta clínica, encuesta telefónica y ecocardiografía.ResultadosLa edad media fue de 53 ± 16,8 años. El 54,2% eran mujeres. La localización tumoral másfrecuente fue en la aurícula izquierda en el 81% de los casos. La forma clínica de presentaciónfue obstructiva en el 52,5%, embólica en el 37,2%, constitucional en el 27,1%, arritmiasupraventricular en el 22% y asintomática en el 10,1%. En dos casos (3,4% se trató derecurrencias tumorales. El diámetro tumoral mayor se relacionó con la presentaciónobstructiva y la arritmia supraventricular. El diámetro tumoral menor se asoció con la presentaciónembólica. La localización ventricular se observó en pacientes más jóvenes. Serealizó resección tumoral asociada con revascularización coronaria en el 8,4% y cirugíavalvular y/o de grandes vasos en el 13,5%. La mortalidad posoperatoria fue del 1,7% y lascomplicaciones más frecuentes fueron bloqueo auriculoventricular completo en el 23,7%,arritmia supraventricular en el 23,7% y bajo volumen minuto en el 18,6%. El seguimientoalejado se realizó en el 94,8% de los casos, con un promedio de 78,3 meses. El 65
Directory of Open Access Journals (Sweden)
Ricardo Pereira Silva
2003-10-01
Full Text Available OBJECTIVE: The purpose of our paper was clinical and echocardiographic characterisation of patients with cardiac tumours and the evaluation of the surgery and tumour recurrence. METHOD: The first part of research was a retrospective investigation to identify cardiac tumours identification and to collect data from patients' records of the Messejana Hospital and Walter Cantídio University Hospital, from 1981 to 2001. In this period, 19 cases of cardiac tumours were discovered. The patients were submitted to clinical, electrocardiographic and echocardiographic re-evaluation from March to July 2002. RESULTS: Congestive symptoms and thoracic pain were the most frequent symptoms. The location in which most of the tumours were identified was left atrium. Among patients submitted to surgery, all of them had the tumour extracted from atrium. The most common histopathologic type was myxoma (78%. Surgical mortality was 14%. Tumour recurrence occurred in one patient. CONCLUSION: Cardiac tumours were more frequent in left atrium, benign tumours were more frequent than malignant tumours, and the most frequent histopathologic type was myxoma.OBJETIVO: Caracterização clínica e ecocardiográfica dos pacientes com tumores cardíacos, avaliação da terapêutica cirúrgica e da recidiva dos tumores. MÉTODO: Na primeira parte da pesquisa, o delineamento metodológico foi do tipo retrospectivo, através da identificação de tumores cardíacos e coleta de dados dos prontuários do Hospital Universitário Walter Cantídio (UFCE e Hospital de Messejana, no período de 1981 a 2001, onde foram encontrados 19 casos de tumores cardíacos. Os pacientes foram submetidos a uma reavaliação clínica, eletro e ecocardiográfica durante o período de março a julho de 2002. RESULTADOS: Sintomas congestivos e dor torácica foram os sintomas mais freqüentes em nossa série. A localização preferencial dos tumores cardíacos em nossa série foi no átrio esquerdo. Entre os
Directory of Open Access Journals (Sweden)
Luis A. Díaz Moreno
2012-03-01
Full Text Available Resumen Introducción y objetivos: La hipertensión es la complicación médica más común del embarazo, y puede dejar secuelas permanentes como: alteraciones neurológicas, hepáticas, hematológicas o renales. Cada tres minutos muere una mujer debido a la preeclampsia. Durante el embarazo el gasto cardíaco sufre un incremento de hasta 40 %. Este incremento es secundario al aumento de aproximadamente 30 % del volumen sistólico. El objetivo de la investigación fue predecir la aparición del síndrome de preeclampsia-eclampsia mediante la identificación de alteraciones del gasto cardíaco. Método: Se realizó un estudio observacional, descriptivo, longitudinal y analítico, de cohorte prospectiva, donde se determinó, por ecocardiografía, el gasto cardíaco en 31 embarazadas, entre las semanas 11 y 13,6 de gestación como único valor; y mediante seguimiento prenatal, se observó la aparición o no del síndrome de Preeclampsia-Eclampsia. Resultados: Se logró el seguimiento de 31 embarazadas a las que se le midió el gasto cardíaco, y se encontró una prevalecía de la enfermedad de 12,9 % con un 64,5 % de pacientes correctamente diagnosticados, con una sensibilidad de 75 %, con valor predictivo positivo de 23 %, especificidad de 62 % y valor predictivo negativo de 94%, con un riesgo relativo de 4,1 (intervalo de confianza 95 %, 0,48-35,6. Conclusiones: Es posible establecer la medición de gasto cardíaco como estudio de escrutinio para predecir la aparición del síndrome de Preeclampsia desde el control prenatal, y contribuir así a la disminución de la muerte materna. / Abstract Introduction and Objectives: Hypertension is the most common medical complication of pregnancy, and it can leave permanent sequelae such as neurological, hepatic, hematological or renal disorders. Every three minutes a woman dies due to preeclampsia. During pregnancy, cardiac output suffers an increase of 40%. This increase is secondary to an increase of
Directory of Open Access Journals (Sweden)
Renata Leonardo Lomele
2010-07-01
Full Text Available Os objetivos do estudo foram investigar a influência de produtos naturais como capim-limão (Cymbopogon citratus, folhas de abacateiro (Persea americana, casca de café (Coffea arabica e sementes de mamona (Ricinus communis na defensividade de Apis mellifera, e avaliar o efeito destes produtos no desenvolvimento populacional da colmeia. O comportamento defensivo foi avaliado por meio do tempo da primeira ferroada (TPF, número de ferrões (NFB e, o desenvolvimento populacional, pela área de cria aberta e fechada. Observou-se que o tratamento fumaça + sete sementes de mamona apresentou aumento significativo no TPF, em relação ao tratamento sem e com fumaça de maravalha. Com relação ao NFB, verificou-se que os tratamentos fumaça de maravalha + sete sementes de mamona e fumaça de maravalha + 20% de folhas de café foram diferentes do tratamento sem e com fumaça. Os demais tratamentos não diferiram significativamente em relação ao uso da fumaça ou sua ausência. A casca de café e a semente de mamona nãointerferiram no desenvolvimento populacional, sugerindo que estes compostos não foram tóxicos. Pode-se concluir que o uso de sementes de mamona e casca de café na fumaça pode representar importante ferramenta para a redução da defensividade, sem promover toxicidade para A. mellifera.The goal was to investigate the influence of natural products such as lemongrass (Cymbopogon citratus, dried avocado leaves (Persea americana, coffee husk (Coffea arabica and castor bean (Ricinus communis in the defense of Apis mellifera, as well the effect of these products on the population development of the beehive. Defensive behavior was evaluated by time of first sting (TFS and number of stingers (NS, and population development, by open brood area and operculated brood. It was observed that the treatment with smoke + seven castor beans presented significant increase in the TFS, for treatment without and with smoke. Regarding NS, it was verified
Okosun, Olabimpe O; Pirk, Christian W W; Crewe, Robin M; Yusuf, Abdullahi A
2017-10-01
Pheromonal control by the honey bee queen is achieved through the use of secretions from diverse glandular sources, but the use of pheromones from a variety of glandular sources by reproductively dominant workers, has not previously been explored. Using the social parasite, Apis mellifera capensis clonal worker we studied the diversity of glandular sources used for pheromonal control of reproductively subordinate A. m. scutellata workers. To determine whether pheromones from different glandular sources are used by reproductively active workers to achieve dominance and evaluate the degree of pheromonal competition between workers of the two sub-species, we housed groups of workers of the two sub-species together in cages and analysed mandibular and tergal gland secretions as well as, ovarian activation status of each worker after 21days. The results showed that A. m. capensis invasive clones used both mandibular and tergal gland secretions to achieve reproductive dominance and suppress ovarian activation in their A. m. scutellata host workers. The reproductively dominant workers (false queens) produced more queen-like pheromones and inhibited ovarian activation in subordinate A. m. scutellata workers. These results show that tergal gland pheromones working in synergy with pheromones from other glands allow individual workers (false queens) to establish reproductive dominance within these social groups and to act in a manner similar to that of queens. Thus suggesting that, the evolution of reproductively dominant individuals (queens or false queens) and subordinate individuals (workers) in social insects like the honey bee is the result of a complex interplay of pheromonal signals from different exocrine glands. Copyright © 2017 Elsevier Ltd. All rights reserved.
Iliadis, A; Brown, A C; Huggins, M L
1992-08-01
APIS is a software package based on mathematical modelling which provides a reliable approach in optimizing drug therapy. It was designed to assist clinicians in interpreting blood drug levels so that drug therapy may be better and more cost-effective. It is a methodological approach to describe, predict and control the kinetic behaviour of a drug. This software incorporates the principle of Bayesian procedures, i.e. one can use all available patient information (population) to determine patient-specific parameter estimates. These estimates can then be used to design an optimal and individualized drug regimen. APIS is an attractive and useful tool for clinical and experimental pharmacokinetics. APIS may be used on any IBM compatible computer using the Microsoft-Windows environment. The software is menu driven to provide a very user-friendly tool for analysing pharmacokinetic data and for designing dosage regimens.
The SEMAINE API: Towards a Standards-Based Framework for Building Emotion-Oriented Systems
Directory of Open Access Journals (Sweden)
Marc Schröder
2010-01-01
Full Text Available This paper presents the SEMAINE API, an open source framework for building emotion-oriented systems. By encouraging and simplifying the use of standard representation formats, the framework aims to contribute to interoperability and reuse of system components in the research community. By providing a Java and C++ wrapper around a message-oriented middleware, the API makes it easy to integrate components running on different operating systems and written in different programming languages. The SEMAINE system 1.0 is presented as an example of a full-scale system built on top of the SEMAINE API. Three small example systems are described in detail to illustrate how integration between existing and new components is realised with minimal effort.
Using the RxNorm web services API for quality assurance purposes.
Peters, Lee; Bodenreider, Olivier
2008-11-06
Auditing large, rapidly evolving terminological systems is still a challenge. In the case of RxNorm, a standardized nomenclature for clinical drugs, we argue that quality assurance processes can benefit from the recently released application programming interface (API) provided by RxNav. We demonstrate the usefulness of the API by performing a systematic comparison of alternative paths in the RxNorm graph, over several thousands of drug entities. This study revealed potential errors in RxNorm, currently under review. The results also prompted us to modify the implementation of RxNav to navigate the RxNorm graph more accurately. The RxNav web services API used in this experiment is robust and fast.
An API for Integrating Spatial Context Models with Spatial Reasoning Algorithms
DEFF Research Database (Denmark)
Kjærgaard, Mikkel Baun
2006-01-01
The integration of context-aware applications with spatial context models is often done using a common query language. However, algorithms that estimate and reason about spatial context information can benefit from a tighter integration. An object-oriented API makes such integration possible...... and can help reduce the complexity of algorithms making them easier to maintain and develop. This paper propose an object-oriented API for context models of the physical environment and extensions to a location modeling approach called geometric space trees for it to provide adequate support for location...... modeling. The utility of the API is evaluated in several real-world cases from an indoor location system, and spans several types of spatial reasoning algorithms....
MicroRNA-1 promotes apoptosis of hepatocarcinoma cells by targeting apoptosis inhibitor-5 (API-5).
Li, Dong; Liu, Yu; Li, Hua; Peng, Jing-Jing; Tan, Yan; Zou, Qiang; Song, Xiao-Feng; Du, Min; Yang, Zheng-Hui; Tan, Yong; Zhou, Jin-Jun; Xu, Tao; Fu, Zeng-Qiang; Feng, Jian-Qiong; Cheng, Peng; chen, Tao; Wei, Dong; Su, Xiao-Mei; Liu, Huan-Yi; Qi, Zhong-Chun; Tang, Li-Jun; Wang, Tao; Guo, Xin; Hu, Yong-He; Zhang, Tao
2015-01-02
Although microRNA-1 (miR-1) is a known liver cancer suppressor, the role of miR-1 in apoptosis of hepatoma cells has remained largely unknown. Our study shows that ectopic miR-1 overexpression induced apoptosis of liver hepatocellular carcinoma (HepG2) cells. Apoptosis inhibitor 5 (API-5) was found to be a potential regulator of miR-1 induced apoptosis, using a bioinformatics approach. Furthermore, an inverse relationship between miR-1 and API-5 expression was observed in human liver cancer tissues and adjacent normal liver tissues. Negative regulation of API-5 expression by miR-1 was demonstrated to promote apoptosis of HepG2 cells. Our study provides a novel regulatory mechanism of miR-1 in the apoptosis of hepatoma cells. Copyright © 2014 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.
360-MAM-Affect: Sentiment Analysis with the Google Prediction API and EmoSenticNet
Directory of Open Access Journals (Sweden)
Eleanor Mulholland
2015-08-01
Full Text Available Online recommender systems are useful for media asset management where they select the best content from a set of media assets. We have developed an architecture for 360-MAM- Select, a recommender system for educational video content. 360-MAM-Select will utilise sentiment analysis and gamification techniques for the recommendation of media assets. 360-MAM-Select will increase user participation with digital content through improved video recommendations. Here, we discuss the architecture of 360-MAM-Select and the use of the Google Prediction API and EmoSenticNet for 360-MAM-Affect, 360-MAM-Select's sentiment analysis module. Results from testing two models for sentiment analysis, Sentiment Classifier (Google Prediction API and EmoSenticNetClassifer (Google Prediction API + EmoSenticNet are promising. Future work includes the implementation and testing of 360-MAM-Select on video data from YouTube EDU and Head Squeeze.
Directory of Open Access Journals (Sweden)
R.R. Vienna Sona Saputri Soetadi
2012-09-01
Full Text Available Untuk mendapatkan kompor bioetanol efisiensi thermal maksimal diperlukan penelitian komprehensif. Salah satunya adalah penelitian terhadap posisi peletakkan beban pada kompor bioetanol kompak. Pengujian dilakukan pada kompor uji bioetanol dengan kadar 99%, yaitu kompor bioetanol tipe side burner dengan firewall 2.5 inci dan firewall 3 inci. Pengukuran temperatur api dengan 13 thermocouple K dengan pengukuran searah api keatas setiap 5 mm-an. Kemudian, water boiling test dilakukan untuk mendapatkan daya dan beban dan dilanjutkan mengukur waktu pendidihan air. Hasil penelitian ini menunjukkan gambaran total distribusi temperatur nyala api difusi. Hasil menunjukkan untuk kompor 2.5 inci dengan daya 1.6 kW mempunyai temperatur 542 ºC dengan jarak ketinggian 5 mm dari rim kompor sedangkan kompor 3 inci menghasilkan daya 2.38 kW dengan temperatur 516 ºC.
A Comparison of Article Search APIs via Blinded Experiment and Developer Review
Directory of Open Access Journals (Sweden)
Jonathan Rochkind
2013-01-01
Full Text Available This study looks at perceived user preference between products that can provide a scholarly article search service via an application programming interface (API. The study set up a blinded review and asked users at Johns Hopkins to select the service that provided the most useful results. Few statistically significant preferences were detected, and some interpretation is provided of what the results might tell us. The specific products evaluated for this study are: Serials Solutions Summon, Ex Libris Primo, EBSCO EDS, EBSCOHost ‘traditional’ API, and Elsevier Scopus. Re-usable open source tools for implementing article search were created to support the study and future development, and a developer review of the APIs is included based on the developer's experience in this implementation.
TUMBUHAN YANG DIKUNJUNGI LEBAH PEKERJA Apis (Hymenoptera: Apidae DI SUMATERA BARAT
Directory of Open Access Journals (Sweden)
Jasmi Jasmi
2016-09-01
Full Text Available Research about plant visited by Apis forager was conducted at altitude < 500 m and 600-1400 m of West Sumatra from December 2009-July 2010. The plant visited by forager was collected at radius 500 m from nests in fruits cropping, coffea and cinnamom plantation and forest edge. Honeybee from genus Apisvisit on plant consisted of four species, those are A. andreniformis, A. cerana, A. dorsata and A. koschevnikovi. Plant visited by forager Apis consisted of 61 species belong to 26 families. The number of 36 plant species found at lowland and highland, 20 species only at lowland and five species at highland. Most of plant species visited by Apis forager are Asteraceae and Leguminoceae. About 29 plant species visited by Apis were agriculture crop and 32 species of non agriculture. Apis andreniformis visited 29 plant species, A. cerana 56 species, A. dorsata 57 species and A. koschevnikovi one plant species. Cucumis sativus was visited by four bee species, Galiansoga farviflora was visited only by A. cerana. Five plant species (Rorippa indica, Cinnamomum burmanii, Nasturrium indicum, Rorippa indica and Eryngium foetidum were visited by only A. dorsata. Other three plants species (Mangifera indica, Cytrus aurantifoliaand Oryza sativa were visited by A. cerana and A. andreniformis, 31 plant species were visited by A. cerana and A. dorsata, 21 species were visited by A. andreniformis, A. cerana and A. dorsata. Keywords: lebah madu, Apis forager, food source plant, visit
Directory of Open Access Journals (Sweden)
Preiss Anette
2008-06-01
Full Text Available Abstract Background The Notch signaling pathway is fundamental to the regulation of many cell fate decisions in eumetazoans. Not surprisingly, members of this pathway are highly conserved even between vertebrates and invertebrates. There is one notable exception, Hairless, which acts as a general Notch antagonist in Drosophila. Hairless silences Notch target genes by assembling a repressor complex together with Suppressor of Hairless [Su(H] and the co-repressors Groucho (Gro and C-terminal binding protein (CtBP. Now with the availability of genomic databases, presumptive Hairless homologues are predicted, however only in insect species. To further our understanding of Hairless structure and function, we have cloned the Hairless gene from Apis mellifera (A.m.H and characterized its functional conservation in Drosophila. Results The Apis Hairless protein is only one third of the size of the Drosophila orthologue. Interestingly, the defined Suppressor of Hairless binding domain is interrupted by a nonconserved spacer sequence and the N-terminal motif is sufficient for binding. In contrast to Apis Hairless, the Drosophila orthologue contains a large acidic domain and we provide experimental evidence that this acidic domain is necessary to silence Hairless activity in vivo. Despite the dramatic size differences, Apis Hairless binds to the Drosophila Hairless interactors Su(H, Gro, CtBP and Pros26.4. Hence, Apis Hairless assembles a repressor complex with Drosophila components that may have a different topology. Nevertheless, Apis Hairless is sufficient to repress the Notch target gene vestigial in Drosophila. Moreover, it is able to rescue Hairless mutant phenotypes, providing in vivo evidence for its function as a bona fide Notch antagonist. Conclusion This is the first interspecies-complementation analysis of the Hairless gene. Guided by evolutionary comparisons, we hope to eventually identify all the relevant structural domains and cofactors of
Maier, Dieter; Chen, Anna X; Preiss, Anette; Ketelhut, Manuela
2008-06-17
The Notch signaling pathway is fundamental to the regulation of many cell fate decisions in eumetazoans. Not surprisingly, members of this pathway are highly conserved even between vertebrates and invertebrates. There is one notable exception, Hairless, which acts as a general Notch antagonist in Drosophila. Hairless silences Notch target genes by assembling a repressor complex together with Suppressor of Hairless [Su(H)] and the co-repressors Groucho (Gro) and C-terminal binding protein (CtBP). Now with the availability of genomic databases, presumptive Hairless homologues are predicted, however only in insect species. To further our understanding of Hairless structure and function, we have cloned the Hairless gene from Apis mellifera (A.m.H) and characterized its functional conservation in Drosophila. The Apis Hairless protein is only one third of the size of the Drosophila orthologue. Interestingly, the defined Suppressor of Hairless binding domain is interrupted by a nonconserved spacer sequence and the N-terminal motif is sufficient for binding. In contrast to Apis Hairless, the Drosophila orthologue contains a large acidic domain and we provide experimental evidence that this acidic domain is necessary to silence Hairless activity in vivo. Despite the dramatic size differences, Apis Hairless binds to the Drosophila Hairless interactors Su(H), Gro, CtBP and Pros26.4. Hence, Apis Hairless assembles a repressor complex with Drosophila components that may have a different topology. Nevertheless, Apis Hairless is sufficient to repress the Notch target gene vestigial in Drosophila. Moreover, it is able to rescue Hairless mutant phenotypes, providing in vivo evidence for its function as a bona fide Notch antagonist. This is the first interspecies-complementation analysis of the Hairless gene. Guided by evolutionary comparisons, we hope to eventually identify all the relevant structural domains and cofactors of Hairless, thereby opening an avenue for further insights
An overview of the CellML API and its implementation
Directory of Open Access Journals (Sweden)
Halstead Matt
2010-04-01
Full Text Available Abstract Background CellML is an XML based language for representing mathematical models, in a machine-independent form which is suitable for their exchange between different authors, and for archival in a model repository. Allowing for the exchange and archival of models in a computer readable form is a key strategic goal in bioinformatics, because of the associated improvements in scientific record accuracy, the faster iterative process of scientific development, and the ability to combine models into large integrative models. However, for CellML models to be useful, tools which can process them correctly are needed. Due to some of the more complex features present in CellML models, such as imports, developing code ab initio to correctly process models can be an onerous task. For this reason, there is a clear and pressing need for an application programming interface (API, and a good implementation of that API, upon which tools can base their support for CellML. Results We developed an API which allows the information in CellML models to be retrieved and/or modified. We also developed a series of optional extension APIs, for tasks such as simplifying the handling of connections between variables, dealing with physical units, validating models, and translating models into different procedural languages. We have also provided a Free/Open Source implementation of this application programming interface, optimised to achieve good performance. Conclusions Tools have been developed using the API which are mature enough for widespread use. The API has the potential to accelerate the development of additional tools capable of processing CellML, and ultimately lead to an increased level of sharing of mathematical model descriptions.
Sipos, Barbara; Pintye-Hódi, Klára; Kónya, Zoltán; Kelemen, András; Regdon, Géza; Sovány, Tamás
2017-02-25
Titanate nanotube (TNT) has recently been explored as a new carrier material for active pharmaceutical ingredients (API). The aim of the present work was to reveal the physicochemical properties of API-TNT composites, focusing on the interactions between the TNTs and the incorporated APIs. Drugs belonging to different Biopharmaceutical Classification System (BCS) classes were loaded into TNTs: diltiazem hydrochloride (BCS I.), diclofenac sodium (BCS II.), atenolol (BCS III.) and hydrochlorothiazide (BCS IV.). Experimental results demonstrated that it is feasible for spiral cross-sectioned titanate nanotubes to carry drugs and maintain their bioactivity. The structural properties of the composites were characterized by a range of analytical techniques, including FT-IR, DSC, TG-MS, etc. The interactions between APIs and TNTs were identified as electrostatic attractions, mainly dominated by hydrogen bonds. Based on the results, it can be stated that the strength of the association depends on the hydrogen donor strength of the API. The drug release of incorporated APIs was evaluated from compressed tablets and compared to that of pure APIs. Differences noticed in the dissolution profiles due to incorporation showed a correlation with the strength of interactions between the APIs and the TNTs observed in the above analytical studies. Copyright © 2016 Elsevier B.V. All rights reserved.
A geographical information system using the Google Map API for guidance to referral hospitals.
Kobayashi, Shinji; Fujioka, Tetsushi; Tanaka, Yuji; Inoue, Michiyoshi; Niho, Yoshiyuki; Miyoshi, Akira
2010-12-01
Our hospital acts as a regional core hospital through inter-hospital collaboration. Geographical information is necessary to guide patients to the other hospitals. Although paper maps, which contain directions, nearest public transportation, etc., are usually provided to guide patients to the hospitals, the geographical information tends to change daily. However, updating the geographical information on the maps is costly. We constructed an electronic geographical information system using the Google Map API ( http://code.google.com/apis/maps/ ) with open source software to improve our ability to collaborate with other clinics.
APIs semánticas para la web orientada a datos enlazados
Garrote Hernández, Antonio
2014-01-01
[ES] Uno de los principales problemas que se plantean en el desarrollo actual de apli- caciones web y m ¿oviles consiste en la definici ¿on de Interfaces de Programaci ¿on de Aplicaciones (APIs) entre clientes y proveedores de datos. Nuestra propuesta de solu- cio ¿n para este problema se basa en el uso de componentes b ¿asicos desarrollados en el a ¿rea de la Web Sema ¿ntica, la iniciativa de Datos Enlazados Abiertos y los principios arquitecturales REST con el fin de desarrollar APIs Sem ¿a...
Flores, J M; Gutiérrez, I; Espejo, R
2005-01-01
Chalkbrood in honeybees (Apis mellifera L. Himenoptera: Apidae) is a fungal disease caused by Ascosphaera apis (Maassen ex Claussen) Olive and Spiltoir. This disease requires the presence of fungal spores and a predisposing condition in the susceptible brood for the disease to develop. In this study we examined the role of pollen in the development of chalkbrood disease under two experimental conditions: (i) pollen combs were transferred from infected to uninfected beehives and (ii) colonies were deprived of adequate pollen supplies to feed the brood. The results of both treatments confirmed that pollen is an element that should be taken into account when controlling this honeybee disease.
Auto-Populating an ILL form with the Serial Solutions Link Resolver API
Directory of Open Access Journals (Sweden)
Daniel Talsky
2008-09-01
Full Text Available In this article we'll take a tour of the OpenURL protocol; discover how to use it to get an XML API response from the Serial Solutions link resolver; and see how to receive and process that XML data using PHP to create an Interlibrary Loan webform. Finally, we'll see a few examples of how to handle form processing. This article will be of interest to beginner programmers interested in examples of programming with OpenURL and XML in PHP, and to more experienced programmers interested in taking a look at the Serial Solutions 360 Link API.
DEFF Research Database (Denmark)
Frick, Marcel; Fischer, Jörg; Helbing, Arthur
2016-01-01
BACKGROUND: Component resolution recently identified distinct sensitization profiles in honey bee venom (HBV) allergy, some of which were dominated by specific IgE to Api m 3 and/or Api m 10, which have been reported to be underrepresented in therapeutic HBV preparations. OBJECTIVE: We performed...... a retrospective analysis of component-resolved sensitization profiles in HBV-allergic patients and association with treatment outcome. METHODS: HBV-allergic patients who had undergone controlled honey bee sting challenge after at least 6 months of HBV immunotherapy (n = 115) were included and classified...
Heterosis en la longevidad de obreras Apis mielífera
Directory of Open Access Journals (Sweden)
J. Tello
2001-07-01
Full Text Available Se estimó la media y la heterosis de la longevidad en obreras de abejas Apis mellifera. El expe-rimento fue desarrollado en el Apiario del Departamento de Genética de la Facultad de Medi-cina de la USP-Ribeirão Preto-Brasil y en Jaboticabal-SP, de 03/1997 a 05/1999. Seleccionamos 8 matrices inseminadas del apiário-USP (2africanizadas, 2italianas, 2cárnicasy 2italianas*cárnicos y 2 matrices (grupo-testigo de abejas Africanizadas-Silvestres.
Japanese population norms for preference-based measures: EQ-5D-3L, EQ-5D-5L, and SF-6D.
Shiroiwa, Takeru; Fukuda, Takashi; Ikeda, Shunya; Igarashi, Ataru; Noto, Shinichi; Saito, Shinya; Shimozuma, Kojiro
2016-03-01
The purpose of this study was to measure the population norms for the Japanese versions of preference-based measures (EQ-5D-3L, EQ-5D-5L, and SF-6D). We also considered the relations between QOL score in the general population and socio-demographic factors. A total of 1143 adult respondents (aged ≥ 20 years) were randomly sampled from across Japan using data from the Basic Resident Register. The health status of each respondent was measured using the EQ-5D-3L, EQ-5D-5L, and SF-6D, and responses regarding socio-demographic data as well as subjective diseases and symptoms were obtained. The responses were converted to a QOL score using Japanese value sets. The percentages of respondents with full health scores were 68 % (EQ-5D-3L), 55 % (EQ-5D-5L), and 4 % (SF-6D). The QOL score measured using the SF-6D was significantly lower than those measured using either EQ-5D score. The QOL score was significantly lower among respondents over the age of 60 years, those who had a lower income, and those who had a shorter period of education. Intraclass correlation coefficient showed a poor agreement between the EQ-5D and SF-6D scores. The differences in QOL scores between respondents with and those without any disease were 0.064 for the EQ-5D-3L, 0.061 for the EQ-5D-5L, and 0.073 for the SF-6D; these differences are regarded as between-group minimal important differences in the general population. The Japanese population norms of three preference-based QOL measures were examined for the first time. Such information is useful for economic evaluations and research examining QOL score.
Rand-Hendriksen, Kim; Ramos-Goñi, Juan Manuel; Augestad, Liv Ariane; Luo, Nan
The conventional method for modeling of the five-level EuroQol five-dimensional questionnaire (EQ-5D-5L) health state values in national valuation studies is an additive 20-parameter main-effects regression model. Statistical models with many parameters are at increased risk of overfitting-fitting to noise and measurement error, rather than the underlying relationship. To compare the 20-parameter main-effects model to simplified, nonlinear, multiplicative regression models in terms of how accurately they predict mean values of out-of-sample health states. We used data from the Spanish, Singaporean, and Chinese EQ-5D-5L valuation studies. Four models were compared: an 8-parameter model with single parameter per dimension, multiplied by cross-dimensional parameters for levels 2, 3, and 4; 9- and 11-parameter extensions with handling of differences in the wording of level 5; and the "standard" additive 20-parameter model. Fixed- and random-intercept variants of all models were tested using two cross-validation methods: leave-one-out at the level of valued health states, and of health state blocks used in EQ-5D-5L valuation studies. Mean absolute error, Lin concordance correlation coefficient, and Pearson R between observed health state means and out-of-sample predictions were compared. Predictive accuracy was generally best using random intercepts. The 8-, 9-, and 11-parameter models outperformed the 20-parameter model in predicting out-of-sample health states. Simplified nonlinear regression models look promising and should be investigated further using other EQ-5D-5L data sets. To reduce the risk of overfitting, cross-validation is recommended to inform model selection in future EQ-5D valuation studies. Copyright © 2017 International Society for Pharmacoeconomics and Outcomes Research (ISPOR). Published by Elsevier Inc. All rights reserved.
Harting, Julia; Kleinebudde, Peter
2018-02-02
Raman spectroscopy was evaluated as a process analytical technology (PAT) tool for continuous API quantification during twin-screw wet granulation. Therefore, a Raman probe was implemented in front of the granulator barrel. This setup enabled the collection of Raman spectra upon a constant granule flow. To develop an in-line PLS calibration model, eight binary mixtures of the API and lactose monohydrate with API contents between 5-50% were pre-blended and granulated in a twin-screw granulator with a screw speed of 150 rpm and a powder feed rate of 40 g/min. Water was used as a granulation liquid with different liquid to solid ratios depending on the API content. Ibuprofen and diclofenac sodium were chosen as model drugs and separated PLS models were built for each API. The predictive performance of the developed PLS models was determined by granulating and monitoring new test samples containing different API concentrations. This evaluation showed that the models were able to predict the API concentration with an RMSEP of 0.59% for ibuprofen and 1.5% for diclofenac sodium. In a second part, the developed in-line Raman spectroscopic method was used to determine the API concentration during a split feeding process. Therefore, the API and lactose monohydrate were added by two independently adjustable feeders into the twin-screw granulator barrel. The in-line spectroscopy analysis which was verified by UV-analysis indicated that the mixing ability of the twin-screw granulator was good for the used settings and all adjusted API concentrations. Copyright © 2018. Published by Elsevier B.V.
Petzoldt, Christine; Bley, Oliver; Byard, Stephen J; Andert, Doris; Baumgartner, Bruno; Nagel, Norbert; Tappertzhofen, Christoph; Feth, Martin Philipp
2014-04-01
The so-called pharmaceutical solid chain, which encompasses drug substance micronisation to the final tablet production, at pilot plant scale is presented as a case study for a novel, highly potent, pharmaceutical compound: SAR114137. Various solid-state analytical methods, such as solid-state Nuclear Magnetic Resonance (ssNMR), Differential Scanning Calorimetry (DSC), Dynamic Water Vapour Sorption Gravimetry (DWVSG), hot-stage Raman spectroscopy and X-ray Powder Diffraction (XRPD) were applied and evaluated to characterise and quantify amorphous content during the course of the physical treatment of crystalline active pharmaceutical ingredient (API). DSC was successfully used to monitor the changes in amorphous content during micronisation of the API, as well as during stability studies. (19)F solid-state NMR was found to be the method of choice for the detection and quantification of low levels of amorphous API, even in the final drug product (DP), since compaction during tablet manufacture was identified as a further source for the formation of amorphous API. The application of different jet milling techniques was a critical factor with respect to amorphous content formation. In the present case, the change from spiral jet milling to loop jet milling led to a decrease in amorphous API content from 20-30 w/w% to nearly 0 w/w% respectively. The use of loop jet milling also improved the processability of the API. Stability investigations on both the milled API and the DP showed a marked tendency for recrystallisation of the amorphous API content on exposure to elevated levels of relative humidity. No significant impact of amorphous API on either the chemical stability or the dissolution rate of the API in drug formulation was observed. Therefore, the presence of amorphous content in the oral formulation was of no consequence for the clinical trial phases I and II. Copyright © 2013 Elsevier B.V. All rights reserved.
Avaliação do sopro cardíaco na infância Assessment of heart murmurs in childhood
Directory of Open Access Journals (Sweden)
Maria Elisabeth B.A. Kobinger
2003-06-01
Full Text Available OBJETIVO: discutir a avaliação clínica e laboratorial do sopro cardíaco, considerando sua alta freqüência no atendimento ambulatorial do pediatra geral. FONTE DE DADOS: revisão baseada na análise crítica da literatura atual e consulta a compêndios de cardiologia pediátrica e pediatria contendo informações básicas sobre o tema. SÍNTESE DOS DADOS: os principais destaques do artigo referem-se à importância da anamnese e exame físico do sistema cardiovascular, essenciais para o pediatra geral diagnosticar o sopro cardíaco inocente, e identificar situações que indiquem a ocorrência de cardiopatias congênitas, ou adquiridas, e a necessidade de encaminhamento ao especialista. CONCLUSÕES: o pediatra geral é geralmente o primeiro médico a detectar um sopro cardíaco e deve estar apto a reconhecer o sopro inocente, assim como a suspeitar precocemente de doenças cardiovasculares.OBJECTIVE: to discuss clinical and laboratorial evaluation of heart murmurs in children, an important problem faced by pediatricians in their practice. SOURCES OF DATA: this review was based on a critical analysis of the current literature, as well as pediatrics and pediatric cardiology textbooks, which were found to be an important source of information on the subject. SUMMARY OS THE FINDINGS: it is important for pediatricians to know how to obtain precise information regarding the patient's medical history and to perform extensive physical examination of a child with heart murmur. The diagnosis of innocent heart murmur is essentially clinical and it can help the pediatrician to identify situations which are associated with cardiovascular diseases. CONCLUSIONS: in our series, short-term video-EEG monitoring established a reliable diagnosis in most patients due to correlation between clinical and EEG data. This procedure was well tolerated by children, including infants and those with psychiatric disorders.
Mostafavi-Pour-Manshadi, Seyed-Mohammad-Yousof; Naderi, Nafiseh; Barrecheguren, Miriam; Dehghan, Abolfazl; Bourbeau, Jean
2017-12-21
During the last decade, many articles have been published, including reviews on fractional exhaled nitric oxide (FeNO) use and utility in clinical practice and for monitoring and identifying eosinophilic airway inflammation, especially in asthma, and evaluating corticosteroid responsiveness. However, the exact role of FeNO in patients with chronic obstructive pulmonary disease (COPD) and its ability to distinguish patients with COPD and those having concomitant asthma, that is, asthma-COPD overlap (ACO) is still unclear and needs to be defined. Due to the broad topics of FeNO in chronic airway disease, we undertook a scoping review. The present article describes the protocol of a scoping review of peer-reviewed published literature specific to FeNO in COPD/ACO over the last decade. We used Joanna Briggs Institute Reviewers' Manual scoping review methodology as well as Levac et al 's and Arksey et al 's framework as guides. We searched a variety of databases, including Medline, Embase, Cumulative Index to Nursing and Allied Health Literature (CINAHL), Cochrane Library, Web of Science, and BioSciences Information Service (BIOSIS) on 29 June 2016. Additional studies will be recognised by exploring the reference list of identified eligible studies. Screening of eligible studies will be independently performed by two reviewers and any disagreement will be solved by the third reviewer. We will analyse the gathered data from article bibliographies and abstracts. To investigate the body of published studies regarding the role of FeNO in patients with COPD and its usefulness in the clinical setting, a scoping review can be used as a modern and pioneer model, which does not need ethics approval. By this review, new insights for conducting new research specific to FeNO in COPD/ACO population will emerge. The results of this study will be reported in the scientific meetings and conferences, which aim to provide information to the clinicians, primary care providers and basic