Directory of Open Access Journals (Sweden)
Kulnaree Phetrong
2008-05-01
Full Text Available Marine bacterium strain SM7 was isolated as a bioemulsifier-producing bacterium from oil-spilled seawater in Songkhla lagoon, Thailand. It was identified as Acinetobacter calcoaceticus subsp. anitratus based on morphology, biochemicalcharacteristics and 16S rRNA sequence. A. calcoaceticus subsp. anitratus SM7 produced an extracellular emulsifying agent when grown in a minimal salt medium (pH 7.0 containing 0.3% (v/v n-heptadecane and 0.1% (w/v ammoniumhydrogen carbonate as carbon source and nitrogen source, respectively, at 30oC with agitation rate of 200 rpm. Crude bioemulsifier was recovered from the culture supernatant by ethanol precipitation with a yield of 2.94 g/l and had a criticalemulsifier concentration of 0.04 g/ml. The crude bioemulsifier was capable of emulsifying n-hexadecane in a broad pH range (6-12, temperatures (30-121oC and in the presence of NaCl up to 12% (w/v. The bioemulsifier was stable in saltsolution ranging from 0 to 0.1% (w/v of MgCl2 and CaCl2. The broad range of pH stability, thermostability and salt tolerance suggested that the bioemulsifier from A. calcoaceticus subsp. anitratus SM7 could be useful in environmentalapplication, especially bioremediation of oil-polluted seawater.
Chen, J; Huang, P T; Zhang, K Y; Ding, F R
2012-04-01
To screen and identify biosurfactant producers from petroleum-contaminated soil; to use response surface methodology (RSM) for medium optimization to enhance biosurfactant production; and to study the properties of the newly obtained biosurfactant towards pH, temperature and salinity. We successfully isolated three biosurfactant producers from petroleum-contaminated soil and identified them through 16S rRNA sequence analysis, which exhibit the highest similarities to Acinetobacter beijerinckii (100%), Kocuria marina (99%) and Kineococcus marinus (99%), respectively. A quadratic response model was constructed through RSM designs, leading to a 57·5% increase of the growth-associated biosurfactant production by Acinetobacter sp. YC-X 2 with an optimized medium: beef extract 3·12 g l(-1) ; peptone 20·87 g l(-1) ; NaCl 1·04 g l(-1); and n-hexadecane 1·86 g l(-1). Biosurfactant produced by Acinetobacter sp. YC-X 2 retained its properties during exposure to a wide range of pH values (5-11), high temperatures (up to 121°C) and high salinities [up to 18% (w/v) Na(+) and Ca(2+) ], which was more sensitive to Ca(2+) than Na(+). Two novel biosurfactant producers were isolated from petroleum-contaminated soil. Biosurfactant from Acinetobacter sp. YC-X 2 has good properties to a wide range of pH, high temperature and high salinity, and its production was optimized successfully through RSM. The fact, an increasing demand of high-quality surfactants and the lack of cost-competitive bioprocesses of biosurfactants for commercial utilization, motivates researchers to develop cost-effective strategies for biosurfactant production through isolating new biosurfactant producers with special surface-active properties and optimizing their cultural conditions. Two novel biosurfactant producers in this study will widen our knowledge about this kind of micro-organism. This work is the first application of RSM designs for cultural optimization of biosurfactant produced by Acinetobacter
Liu, Hui; Lu, Qian; Wang, Qin; Liu, Wen; Wei, Qian; Ren, Hongyan; Ming, Caibing; Min, Min; Chen, Paul; Ruan, Roger
2017-07-01
Algae were able to grow healthy on bacteria-containing centrate wastewater in a pilot-scale bioreactor. The batch experiment indicated that the co-cultivation of algae and wastewater-borne bacteria improved the removal efficiencies of chemical oxygen demand and total phosphorus in centrate wastewater to 93.01% and 98.78%, respectively. A strain of beneficial aerobic bacteria, Acinetobacter sp., was isolated and its biochemical characteristics were explored. Synergistic cooperation was observed in the growth of algae and Acinetobacter sp. Removal efficiencies of some nutrients were improved significantly by the co-cultivation of algae and Acinetobacter sp. After treatment, residual nutrients in centrate wastewater reached the permissible discharge limit. The cooperation between algae and Acinetobacter sp. was in part attributed to the exchange of carbon dioxide and oxygen between the algae and bacteria. This synergetic relationship between algae and Acinetobacter sp. provided a promising way to treat the wastewater by improving the nutrients removal and biomass production. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Fabiola G Zuno-Floriano
Full Text Available One of the most serious diseases in potato cultivars is caused by the pathogen Phytophthora infestans, which affects leaves, stems and tubers. Metalaxyl is a fungicide that protects potato plants from Phytophthora infestans. In Mexico, farmers apply metalaxyl 35 times during the cycle of potato production and the last application is typically 15 days before harvest. There are no records related to the presence of metalaxyl in potato tubers in Mexico. In the present study, we evaluated the effect of Acinetobacter sp on metalaxyl degradation in potato seedlings. The effect of bacteria and metalaxyl on the growth of potato seedlings was also evaluated. A metabolite profile analysis was conducted to determine potential molecular biomarkers produced by potato seedlings in the presence of Acinetobacter sp and metalaxyl. Metalaxyl did not affect the growth of potato seedlings. However, Acinetobacter sp strongly affected the growth of inoculated seedlings, as confirmed by plant length and plant fresh weights which were lower in inoculated potato seedlings (40% and 27%, respectively compared to the controls. Acinetobacter sp also affected root formation. Inoculated potato seedlings showed a decrease in root formation compared to the controls. LC-MS/MS analysis of metalaxyl residues in potato seedlings suggests that Acinetobacter sp did not degrade metalaxyl. GC-TOF-MS platform was used in metabolic profiling studies. Statistical data analysis and metabolic pathway analysis allowed suggesting the alteration of metabolic pathways by both Acinetobacter sp infection and metalaxyl treatment. Several hundred metabolites were detected, 137 metabolites were identified and 15 metabolic markers were suggested based on statistical change significance found with PLS-DA analysis. These results are important for better understanding the interactions of putative endophytic bacteria and pesticides on plants and their possible effects on plant metabolism.
Acinetobacter lactucae sp. nov., isolated from iceberg lettuce (Asteraceae: Lactuca sativa).
Rooney, Alejandro P; Dunlap, Christopher A; Flor-Weiler, Lina B
2016-09-01
Strain NRRL B-41902T and three closely related strains were isolated from iceberg lettuce. The strain was found to consist of strictly aerobic, Gram-stain-negative rods that formed cocci in late stationary phase. 16S rRNA gene sequence analysis showed that strain NRRL B-41902T was most closely related to species within the genera Acinetobacter, and that a grouping of it and the three other closely related strains was most closely related to the type strain of Acinetobacter pittii, which was also confirmed through a phylogenomic analysis. Moreover, in silico DNA-DNA hybridization analysis revealed a substantial amount of genomic divergence (39.1 %) between strain NRRL B-41902T and the type strain of A. pittii, which is expected if the strains represent distinct species. Further phenotypic analysis revealed that strain NRRL B-41902T was able to utilize a combination of l-serine, citraconic acid and citramalic acid, which differentiated it from other, closely related Acinetobacter species. Therefore, strain NRRL B-41902T (=CCUG 68785T) is proposed as the type strain of a novel species, Acinetobacter lactucae sp. nov.
Energy Technology Data Exchange (ETDEWEB)
Silambarasan, Sivagnanam [Department of Biochemistry, Faculty of Science, Chulalongkorn University, Bangkok 10330 (Thailand); Vangnai, Alisa S., E-mail: alisa.v@chula.ac.th [Department of Biochemistry, Faculty of Science, Chulalongkorn University, Bangkok 10330 (Thailand); Center of Excellence on Hazardous Substance Management (HSM), Chulalongkorn University, Bangkok 10330 (Thailand)
2016-01-25
Highlights: • Acinetobacter sp. AVLB2 is a PGPB able to degrade high concentration of 4-NA. • Growth and degradation kinetics for 4-NA removal by AVLB2 were studied. • A novel biodegradation pathway for 4-nitroaniline has been proposed. • Toxicological studies revealed non-toxic nature of 4-NA biodegraded metabolites. • Acinetobacter sp. AVLB2 could maintain PGP traits under 4-NA stress. - Abstract: 4-nitroaniline (4-NA) is one of the major priority pollutants generated from industrial productions and pesticide transformation; however very limited biodegradation details have been reported. This work is the first to report 4-NA biodegradation kinetics and toxicity reduction using a newly isolated plant-growth promoting bacterium, Acinetobacter sp. AVLB2. The 4-NA-dependent growth kinetics parameters: μ{sub max}, K{sub s} and K{sub i}, were determined to be 0.039 h{sup −1}, 6.623 mg L{sup −1} and 25.57 mg L{sup −1}, respectively using Haldane inhibition model, while the maximum biodegradation rate (V{sub max}) of 4-NA was at 0.541 mg L{sup −1} h{sup −1} and 0.551 mg L{sup −1} h{sup −1}, following Michaelis–Menten and Hanes–Woolf models, respectively. Biodegradation pathway of 4-NA by Acinetobacter sp. AVLB2 was proposed, and successfully led to the reduction of 4-NA toxicity according to the following toxicity assessments: microbial toxicity using Escherichia coli DH5α, phytotoxicity with Vigna radiata and Crotalaria juncea, and cytogenotoxicity with Allium cepa root-tip cells. In addition, Acinetobacter sp. AVLB2 possess important plant-growth promoting traits, both in the presence and absence of 4-NA. This study has provided a new insight into 4-NA biodegradation ability and concurrent plant-growth promoting activities of Acinetobacter sp. AVLB2, which may indicate its potential role for rhizoremediation, while sustaining crop production even under 4-NA stressed environment.
Khoramnia, Anahita; Ebrahimpour, Afshin; Beh, Boon Kee; Lai, Oi Ming
2011-01-01
The lipase production ability of a newly isolated Acinetobacter sp. in submerged (SmF) and solid-state (SSF) fermentations was evaluated. The results demonstrated this strain as one of the rare bacterium, which is able to grow and produce lipase in SSF even more than SmF. Coconut oil cake as a cheap agroindustrial residue was employed as the solid substrate. The lipase production was optimized in both media using artificial neural network. Multilayer normal and full feed forward backpropagation networks were selected to build predictive models to optimize the culture parameters for lipase production in SmF and SSF systems, respectively. The produced models for both systems showed high predictive accuracy where the obtained conditions were close together. The produced enzyme was characterized as a thermotolerant lipase, although the organism was mesophile. The optimum temperature for the enzyme activity was 45°C where 63% of its activity remained at 70°C after 2 h. This lipase remained active after 24 h in a broad range of pH (6-11). The lipase demonstrated strong solvent and detergent tolerance potentials. Therefore, this inexpensive lipase production for such a potent and industrially valuable lipase is promising and of considerable commercial interest for biotechnological applications.
Directory of Open Access Journals (Sweden)
Vani Dos Santos Laranjeira
2010-08-01
Full Text Available INTRODUÇÃO: O aparecimento de Pseudomonas aeruginosa e Acinetobacter sp produtores de metalo-β-lactamases (MBLs é um desafio para os hospitais. MÉTODOS: Verificou-se a produção de MBL em cepas clínicas de Pseudomonas aeruginosa e Acinetobacter sp de um hospital de emergência de Porto Alegre pelo método de aproximação de disco e E-test MBL. Os genes bla foram pesquisados pela PCR. RESULTADOS: Duas cepas de Pseudomonas aeruginosa e oito Acinetobacter sp demonstraram fenótipo de MBLs. A amplificação do gene blaSPM-1 confirmou a enzima em P. aeruginosa.. CONCLUSÕES: Deve-se ter cautela ao avaliar testes fenotípicos utilizados na detecção rotineira de metalo-enzima.INTRODUCTION: The appearance of metallo-β-lactamase (MBL-producing Pseudomonas aeruginosa and Acinetobacter sp. is a challenge for hospitals. METHODS: The production of MBL in clinical isolates of Pseudomonas aeruginosa and Acinetobacter sp. From an emergency hospital in Porto Alegre was investigated using the disk approximation test and MBL E-test. The bla genes were determined using PCR. RESULTS: Two strains of Pseudomonas aeruginosa and eight of Acinetobacter sp were shown to be MBL phenotypes. Amplification of the blaSPM-1 gene confirmed the presence of the enzyme in P. aeruginosa. CONCLUSIONS: Caution is needed in evaluating phenotype tests used for routine detection of metallo-β-lactamases.
Directory of Open Access Journals (Sweden)
M. Ivahniuk
2015-05-01
Full Text Available Introduction.Microbial exopolysaccharides (EPS by the ability of their solutions to change the rheological properties of aqueous systems are widely used in various industries. In recent years, research on the use of industrial waste (including oil-containing to obtain practically valuable microbial metabolites intensified. Materials and methods.Cultivation of Acinetobactersp. IМV B-7005 strain was performed in liquid medium, containing as a carbon source sunflower oil (1−5 %, v/v, a source of nitrogen – ammonium nitrate (0.4−0.8 g/l, a source of pantothenate − multivitamin complex «Complevit» (0.00085 and0.00095 %. EPSconcentration was determined gravimetrically after precipitation with isopropanol, EPS-synthesizing ability − as a ratio of EPS concentration to biomass concentration, wich was expressed as g EPS / g biomass. Results and discussions. It was established that increasing the concentration of sunflower oil in basic medium for Acinetobacter sp. IMV B -7005 cultivation to 4−5% was accompanied by decrease of ethapolan synthesis compared with those in the medium containing lower (2−3 % substrate concentration. Increasing ammonium nitrate content to 0.6 g/l and/or pantothenate concentration to 0.00095% in a medium with 5% sunflower oil allowed to increase the amount of ethapolan synthesized up to 6.6−6.7 g/l, that is in 1.3−1.4 times higher than in the basic medium with the same concentration of the substrate but lower NH4NO3 (0.4 g/l and pantothenate (0.00085 %. Conclusion. The obtained results indicate the possibility of microbial polysaccharide ethapolan synthesis under Acinetobacter sp. ІMV B -7005 cultivation in the medium with a high content of sunflower oil. These data are the basis for the development of ethapolan technology using as a substrate fried oil.
Gao, Y; Yu, X Z; Wu, S C; Cheung, K C; Tam, N F Y; Qian, P Y; Wong, M H
2006-12-15
The effects of cultivation of rice (Oryza sativa L.) and PAH-degrading bacteria (Acinetobacter sp.) separately, and in combination, on the dissipation of spiked phenanthrene and pyrene (0, 50+50, 100+100, 200+200 mg kg(-1)) in waterlogged soil were studied using pot trials. The population of introduced PAH-degrading bacteria remained at 10(5) CFU g(-1) dry soil after 20 days of treatment with Acinetobacter sp. only, but increased to 10(6) when planted with rice simultaneously. Shoot and root biomass of rice when grown alone was adversely affected by spiked PAHs, but significantly increased by 2-55% and 8-409%, respectively, when inoculated with Acinetobacter sp.. Phenanthrene and pyrene concentrations in roots ranged from 1-27 and 20-98 mg kg(-1), respectively, while their concentrations in shoots were generally lower than 0.2 mg kg(-1). The dissipation of phenanthrene was mainly due to abiotic loss as 70-78% phenanthrene was lost from the control soil at the end of 80 days, while removal of 86-87% phenanthrene had been achieved after 40 days in the treatment co-cultivated with Acinetobacter sp. and rice. Compared with the control where only 6-15% of pyrene was removed from soil, a much higher dissipation of pyrene (43-62%) was attained for the treatments co-cultivated with Acinetobacter sp. and rice at the end of 80 days. The results demonstrated that co-cultivation of rice and PAH-degrading bacteria may have a great potential to accelerate the bioremediation process of PAH-contaminated soil under waterlogged conditions.
Directory of Open Access Journals (Sweden)
Wei Lu
Full Text Available Ventilator-associated pneumonia (VAP is a common complication and cause of death in neonates on mechanical ventilation. However, it is difficult to define the causes of VAP. To understand the causes of VAP, we undertook a prospective study based on the diversity of the microflora in VAP. The experimental group consisted of newborns who suffered from respiratory distress syndrome (RDS and VAP, while the control group suffered from RDS without VAP. Sputa were collected within 1, 3, and 5 days of ventilation and were divided into six groups. DNA was extracted from the samples, and the 16S rDNA was PCR amplified, separated using denaturing gradient gel electrophoresis (DGGE, cloned and sequenced. The resulting sequences were compared using BLAST. The DGGE pictures were measured, and the richness, Shannon-Wiener index, and cluster maps were analyzed. No differences were found regarding the constituent ratio of any genus between the Non-VAP and VAP group within 1 day after intubation. After 1 to 3 days, the constituent ratios of Klebsiella sp., Acinetobacter sp., and Streptococcus sp. in the VAP group were higher than those in the Non-VAP group, and the ratios of Serratia sp. and Achromobacter sp. were lower. After 3 to 5 days, the ratios of Klebsiella sp., Acinetobacter sp., Serratia sp., and Achromobacter sp. were lower than those in the Non-VAP group. The richness and Shannon-Wiener index of the Non-VAP group were higher than those of the VAP group from 1 to 3 days after intubation, while no differences were found within 1 day and from 3 to 5 days. We conclude that during the first three days of intubation, the microflora diversity in the lower respiratory tract was reduced due to VAP, and the greater constituent ratios of Klebsiella sp., Acinetobacter sp., and Streptococcus sp. in the sputum may be indicators of VAP.
Energy Technology Data Exchange (ETDEWEB)
Hendrickx, L
2002-07-01
This study focussed on the localization and quantification of natural genetic transformation using neutral and disadvantageous genes in monoculture biofilms to investigate gene transfer and expression of the transferred genes in the absence of a selective advantage. Data obtained by this investigation were regarded as initial steps for evaluating the applicability of adding catabolic traits into the indigenous bacterial community of biofilm reactors by in situ natural genetic transformation. Because Acinetobacter spp. strains are readily found in waste water treatment plants and because Acinetobacter sp. BD413 possesses a high effective level of competence, natural genetic transformation was investigated in monoculture Acinetobacter sp. BD413 biofilms. The genes used for transformation encoded for the green fluorescent protein (GFP) and its variants. Monitoring of transformation events were performed with the use of automated confocal laser scanning microscopy (CLSM) and semi automated digital image processing and analysis. (orig.)
Enzymic Dehalogenation of 4-Chlorobenzoyl Coenzyme A in Acinetobacter sp. Strain 4-CB1
Copley, Shelley D.; Crooks, Gwen P.
1992-01-01
4-Chlorobenzoate degradation in cell extracts of Acinetobacter sp. strain 4-CB1 occurs by initial synthesis of 4-chlorobenzoyl coenzyme A (4-chlorobenzoyl CoA) from 4-chlorobenzoate, CoA, and ATP. 4-Chlorobenzoyl CoA is dehalogenated to 4-hydroxybenzoyl CoA. Following the dehalogenation reaction, 4-hydroxybenzoyl CoA is hydrolyzed to 4-hydroxybenzoate and CoA. Possible roles for the CoA moiety in the dehalogenation reaction are discussed.
Enzymic Dehalogenation of 4-Chlorobenzoyl Coenzyme A in Acinetobacter sp. Strain 4-CB1
Copley, Shelley D.; Crooks, Gwen P.
1992-01-01
4-Chlorobenzoate degradation in cell extracts of Acinetobacter sp. strain 4-CB1 occurs by initial synthesis of 4-chlorobenzoyl coenzyme A (4-chlorobenzoyl CoA) from 4-chlorobenzoate, CoA, and ATP. 4-Chlorobenzoyl CoA is dehalogenated to 4-hydroxybenzoyl CoA. Following the dehalogenation reaction, 4-hydroxybenzoyl CoA is hydrolyzed to 4-hydroxybenzoate and CoA. Possible roles for the CoA moiety in the dehalogenation reaction are discussed. PMID:16348702
Directory of Open Access Journals (Sweden)
Wadhwani SA
2017-09-01
Full Text Available Sweety A Wadhwani,1 Mahadeo Gorain,2 Pinaki Banerjee,2 Utkarsha U Shedbalkar,3 Richa Singh,1 Gopal C Kundu,2 Balu A Chopade1,4 1Department of Microbiology, Savitribai Phule Pune University, 2Laboratory of Tumor Biology, Angiogenesis and Nanomedicine Research, National Center for Cell Science, Savitribai Phule Pune University Campus, Pune, 3Department of Biochemistry, The Institute of Science, Mumbai, 4Dr Babasaheb Ambedkar Marathwada University, Aurangabad, Maharashtra, India Abstract: The aim of this study was to synthesize selenium nanoparticles (SeNPs using cell suspension and total cell protein of Acinetobacter sp. SW30 and optimize its synthesis by studying the influence of physiological and physicochemical parameters. Also, we aimed to compare its anticancer activity with that of chemically synthesized SeNPs in breast cancer cells. Cell suspension of Acinetobacter sp. SW30 was exposed to various physiological and physicochemical conditions in the presence of sodium selenite to study their effects on the synthesis and morphology of SeNPs. Breast cancer cells (4T1, MCF-7 and noncancer cells (NIH/3T3, HEK293 were exposed to different concentrations of SeNPs. The 18 h grown culture with 2.7×109 cfu/mL could synthesize amorphous nanospheres of size 78 nm at 1.5 mM and crystalline nanorods at above 2.0 mM Na2SeO3 concentration. Polygonal-shaped SeNPs of average size 79 nm were obtained in the supernatant of 4 mg/mL of total cell protein of Acinetobacter sp. SW30. Chemical SeNPs showed more anticancer activity than SeNPs synthesized by Acinetobacter sp. SW30 (BSeNPs, but they were found to be toxic to noncancer cells also. However, BSeNPs were selective against breast cancer cells than chemical ones. Results suggest that BSeNPs are a good choice of selection as anticancer agents. Keywords: comparison, selective, 4T1, MCF7
Zhang, Qiuzhuo; Wang, Duanchao; Li, Mengmeng; Xiang, Wei-Ning; Achal, Varenyam
2014-03-01
Two indigenous bacteria of petroleum contaminated soil were characterized to utilize diesel fuel as the sole carbon and energy sources in this work. 16S rRNA gene sequence analysis identified these bacteria as Sphingomonas sp. and Acinetobacter junii. The ability to degrade diesel fuel has been demonstrated for the first time by these isolates. The results of IR analyses showed that Sphingomonas sp. VA1 and A. junii VA2 degraded up to 82.6% and 75.8% of applied diesel over 15 days, respectively. In addition, Sphingomonas sp. VA1 possessed the higher cellular hydrophobicities of 94% for diesel compared to 81% by A. junii VA2. The isolates Sphingomonas sp. VA1 and A. junii VA2 exhibited 24% and 18%, respectively emulsification activity. This study reports two new diesel degrading bacterial species, which can be effectively used for bioremediation of petroleum contaminated sites.
Directory of Open Access Journals (Sweden)
Gabriele Mariani Machado
2011-04-01
Full Text Available INTRODUÇÃO: O principal mecanismo de resistência entre isolados de Pseudomonas aeruginosa e Acinetobacter sp. é a produção de metalo-β-lactamases (MβLs. As MβLs são enzimas capazes de hidrolisar cefalosporinas, penicilinas e carbapenêmicos, mas não monobactâmicos (aztreonam antibióticos que se encontram entre as principais opções terapêuticas para o tratamento de infecções causadas por bactérias não fermentadoras de glicose. MÉTODOS: Um estudo observacional, transversal, descritivo e retrospectivo foi desenvolvido para avaliar a frequência e o perfil de susceptibilidade cepas de P. aeruginosa e Acinetobacter sp. produtoras de MβLs isoladas no Hospital São Vicente de Paulo, Passo Fundo, Brasil. RESULTADOS: A produção de MβLs foi observada em 77,6% (n = 173/223 dos isolados de P. aeruginosa e em 22,4% (n = 50/223 dos isolados de Acinetobacter sp. Dentre as cepas produtoras de MβL, a maioria apresentou mais de 90% de resistência a seis antimicrobianos dos 12 testados, enfatizando a resistência a ceftazidima, gentamicina, aztreonam, piperaciclina/tazobactam, cefepime, ciprofloxacina, meropenem e tobramicina. CONCLUSÕES: Os índices de MβL encontrados confirmam a preocupação mundial com a disseminação desse mecanismo de resistência.
Exopolysaccharides play a role in the swarming of the benthic bacterium Pseudoalteromonas sp. SM9913
Directory of Open Access Journals (Sweden)
Ang eLiu
2016-04-01
Full Text Available Most marine bacteria secrete exopolysaccharide (EPS, which is important for bacterial survival in the marine environment. However, it is still unclear whether the self-secreted EPS is involved in marine bacterial motility. Here we studied the role of EPS in the lateral flagella-driven swarming motility of benthic bacterium Pseudoalteromonas sp. SM9913 (SM9913 by a comparison of wild SM9913 and ΔepsT, an EPS synthesis defective mutant. Reduction of EPS production in ΔepsT did not affect the growth rate or the swimming motility, but significantly decreased the swarming motility on a swarming plate, suggesting that the EPS may play a role in SM9913 swarming. However, the expression and assembly of lateral flagella in ΔepsT were not affected. Instead, ΔepsT had a different swarming behavior from wild SM9913. The swarming of ΔepsT did not have an obvious rapid swarming period, and its rate became much lower than that of wild SM9913 after 35 h incubation. An addition of surfactin or SM9913 EPS on the surface of the swarming plate could rescue the swarming level. These results indicate that the self-secreted EPS is required for the swarming of SM9913. This study widens our understanding of the function of the EPS of benthic bacteria.
Kurth, Daniel; Belfiore, Carolina; Gorriti, Marta F; Cortez, Néstor; Farias, María E; Albarracín, Virginia H
2015-01-01
Ultraviolet radiation can damage biomolecules, with detrimental or even lethal effects for life. Even though lower wavelengths are filtered by the ozone layer, a significant amount of harmful UV-B and UV-A radiation reach Earth's surface, particularly in high altitude environments. high-altitude Andean lakes (HAALs) are a group of disperse shallow lakes and salterns, located at the Dry Central Andes region in South America at altitudes above 3,000 m. As it is considered one of the highest UV-exposed environments, HAAL microbes constitute model systems to study UV-resistance mechanisms in environmental bacteria at various complexity levels. Herein, we present the genome sequence of Acinetobacter sp. Ver3, a gammaproteobacterium isolated from Lake Verde (4,400 m), together with further experimental evidence supporting the phenomenological observations regarding this bacterium ability to cope with increased UV-induced DNA damage. Comparison with the genomes of other Acinetobacter strains highlighted a number of unique genes, such as a novel cryptochrome. Proteomic profiling of UV-exposed cells identified up-regulated proteins such as a specific cytoplasmic catalase, a putative regulator, and proteins associated to amino acid and protein synthesis. Down-regulated proteins were related to several energy-generating pathways such as glycolysis, beta-oxidation of fatty acids, and electronic respiratory chain. To the best of our knowledge, this is the first report on a genome from a polyextremophilic Acinetobacter strain. From the genomic and proteomic data, an "UV-resistome" was defined, encompassing the genes that would support the outstanding UV-resistance of this strain.
Directory of Open Access Journals (Sweden)
Daniel eKurth
2015-04-01
Full Text Available Ultraviolet radiation can damage biomolecules, with detrimental or even lethal effects for life. Even though lower wavelengths are filtered by the ozone layer, a significant amount of harmful UV-B and UV-A radiation reach Earth’s surface, particularly in high altitude environments. High-Altitude Andean Lakes (HAAL are a group of disperse shallow lakes and salterns, located at the Dry Central Andes region in South America at altitudes above 3,000 m. As it is considered one of the highest UV-exposed environments, HAAL microbes constitute model systems to study UV-resistance mechanisms in environmental bacteria at various complexity levels. Herein, we present the genome sequence of Acinetobacter sp. Ver3, a gammaproteobacterium isolated from Lake Verde (4,400 m, together with further experimental evidence supporting the phenomenological observations regarding this bacterium ability to cope with increased UV-induced DNA damage. Comparison with the genomes of other Acinetobacter strains highlighted a number of unique genes, such as a novel cryptochrome. Proteomic profiling of UV-exposed cells identified up-regulated proteins such as a specific cytoplasmic catalase, a putative regulator, and proteins associated to amino acid and protein synthesis. Down-regulated proteins were related to several energy-generating pathways such as glycolysis, beta-oxidation of fatty acids and electronic respiratory chain. To the best of our knowledge, this is the first report on a genome from a polyextremophilic Acinetobacter strain. From the genomic and proteomic data, an UV-resistome was defined, encompassing the genes that would support the outstanding UV-resistance of this strain.
Directory of Open Access Journals (Sweden)
Morahem Ashengroph
2014-04-01
Full Text Available Introduction: The biological synthesis of nanoparticles has gained enormous importance due to the development of clean and environmentally-friendly processes. Silver is highly toxic to microbial cells, Nevertheless, it has been reported that several microorganisms are silver resistance and corroborate the microbial reduction of water soluble Ag+ to Ag0 nanoparticles. In this study, native strains of bacteria screen for use as biocatalysts for extracellular synthesis of silver nanoparticles. Materials and methods: Eight different strains of bacteria exhibiting high silver tolerance were isolated from collecting soil samples from copper and gold mines and characterized using morphological observations and preliminary biochemical tests. The bacterial strains in the presence of 1 g/l Ag+ solution at pH 7 were incubated at 28º C for 48 h in an orbital shaker. The silver nanoparticles formation was investigated by visual observations (changing the color of the reaction solution, spectroscopic techniques and microscopic observations. Results: Among the 8 strains giving high Ag+ tolerance, the strain SM8, isolated from the Sarcheshmeh Copper Mine, Kerman, showed the capability of promoting the formation extracellular Ag nanoparticles. The strain was selected and identified as Ralstonia sp. SM8 (GenBank accession number KF264453 based on morphological and biochemical characteristics and its molecular phylogenetic analysis. Results obtained by visual observations, spectral data achieved from UV–vis, XRD spectrum and SEM micrographs revealed the extracellular formation of spherical silver nanoparticles in the size range of 20-50 nm with the culture supernatants of Ralstonia sp. SM8. Discussion and conclusion: Based on the results obtained, fast and extracellular synthesis of silver nanoparticles, without the need for complicated extraction steps, can be taken by using the culture supernatants of Ralstonia sp. SM8. The current study is the first report
Coaggregation between Rhodococcus and Acinetobacter strains isolated from the food industry.
Møretrø, Trond; Sharifzadeh, Shahab; Langsrud, Solveig; Heir, Even; Rickard, Alexander H
2015-07-01
In this study, coaggregation interactions between Rhodococcus and Acinetobacter strains isolated from food-processing surfaces were characterized. Rhodococcus sp. strain MF3727 formed intrageneric coaggregates with Rhodococcus sp. strain MF3803 and intergeneric coaggregates with 2 strains of Acinetobacter calcoaceticus (MF3293, MF3627). Stronger coaggregation between A. calcoaceticus MF3727 and Rhodococcus sp. MF3293 was observed after growth in batch culture at 30 °C than at 20 °C, after growth in tryptic soy broth than in liquid R2A medium, and between cells in exponential and early stationary phases than cells in late stationary phase. The coaggregation ability of Rhodococcus sp. MF3727 was maintained even after heat and Proteinase K treatment, suggesting its ability to coaggregate was protein independent whereas the coaggregation determinants of the other strains involved proteinaceous cell-surface-associated polymers. Coaggregation was stable at pH 5-9. The mechanisms of coaggregation among Acinetobacter and Rhodococcus strains bare similarity to those displayed by coaggregating bacteria of oral and freshwater origin, with respect to binding between proteinaceous and nonproteinaceous determinants and the effect of environmental factors on coaggregation. Coaggregation may contribute to biofilm formation on industrial food surfaces, protecting bacteria against cleaning and disinfection.
Growth, and magnetic study of Sm0.4Er0.6FeO3 single crystal grown by optical floating zone technique
Wu, Anhua; Zhao, Xiangyang; Man, Peiwen; Su, Liangbi; Kalashnikova, A. M.; Pisarev, R. V.
2018-03-01
Sm0.4Er0.6FeO3 single crystals were successfully grown by optical floating zone method; high quality samples with various orientations were manufactured. Based on these samples, Magnetic property of Sm0.4Er0.6FeO3 single crystals were investigated systemically by means of the temperature dependence of magnetization. It indicated that compositional variations not only alter the spin reorientation temperature, but also the compensation temperature of the orthoferrites. Unlike single rare earth orthoferrites, the reversal transition temperature point of Sm0.4Er0.6FeO3 increases as magnetic field increases, which is positive for designing novel spin switching or magnetic sensor device.
Galíndez-Nájera, S P; Llamas-Martínez, M A; Ruiz-Ordaz, N; Juárez-Ramírez, C; Mondragón-Parada, M E; Ahuatzi-Chacón, D; Galíndez-Mayer, J
2009-02-01
Cyanuric acid (1,3,5-triazine-2,4,6-triol [OOOT]) is a common biodegradation byproduct of triazinic herbicides, frequently accumulated in soils or water when supplementary carbon sources are absent. A binary bacterial culture able to degrade OOOT was selected through a continuous selection process accomplished in a chemostat fed with a mineral salt (MS) medium containing cyanuric acid as the sole carbon and nitrogen source. By sequence comparison of their 16S rDNA amplicons, bacterial strains were identified as Agrobacterium tumefaciens, and Acinetobacter sp. When the binary culture immobilized in a packed bed reactor (PBR) was fed with MS medium containing OOOT (50 mg L(-1)), its removal efficiencies were about 95%; when it was fed with OOOT plus glucose (120 mg L(-1)) as a supplementary carbon source, its removal efficiencies were closer to 100%. From sessile cells, attached to PBR porous support, or free cells present in the outflowing medium, DNA was extracted and used for Random Amplification of Polymorphic DNA analysis. Electrophoretic patterns obtained were compared to those of pure bacterial strains, a clear predominance of A. tumefaciens in PBR was observed. Although in continuous suspended cell culture, a stable binary community could be maintained, the attachment capability of A. tumefaciens represented a selective advantage over Acinetobacter sp. in the biofilm reactor, favoring its predominance in the porous stone support.
Purification and Characterization of Catalase from Marine Bacterium Acinetobacter sp. YS0810
Directory of Open Access Journals (Sweden)
Xinhua Fu
2014-01-01
Full Text Available The catalase from marine bacterium Acinetobacter sp. YS0810 (YS0810CAT was purified and characterized. Consecutive steps were used to achieve the purified enzyme as follows: ethanol precipitation, DEAE Sepharose ion exchange, Superdex 200 gel filtration, and Resource Q ion exchange. The active enzyme consisted of four identical subunits of 57.256 kDa. It showed a Soret peak at 405 nm, indicating the presence of iron protoporphyrin IX. The catalase was not apparently reduced by sodium dithionite but was inhibited by 3-amino-1,2,4-triazole, hydroxylamine hydrochloride, and sodium azide. Peroxidase-like activity was not found with the substrate o-phenylenediamine. So the catalase was determined to be a monofunctional catalase. N-terminal amino acid of the catalase analysis gave the sequence SQDPKKCPVTHLTTE, which showed high degree of homology with those of known catalases from bacteria. The analysis of amino acid sequence of the purified catalase by matrix-assisted laser desorption ionization time-of-flight mass spectrometry showed that it was a new catalase, in spite of its high homology with those of known catalases from other bacteria. The catalase showed high alkali stability and thermostability.
Energy Technology Data Exchange (ETDEWEB)
Xu, M.L.; Wu, Q.; Li, Y.Q.; Liu, W.Q.; Lu, Q.M.; Yue, M., E-mail: yueming@bjut.edu.cn
2015-08-01
The microstructure, crystal structure and magnetic properties were studied for Sm{sub 0.6}Pr{sub 0.4}Co{sub 5} nanoflakes prepared by surfactant-assisted high-energy ball milling (SAHEBM). Effect of ball-milling time on the c-axis crystallographic alignment, morphology and magnetic properties of Sm{sub 0.6}Pr{sub 0.4}Co{sub 5} nanoflakes was systematically investigated. With increasing milling time from 1 h to 7 h, the intensity ratio between (002) and (111) reflection peaks indicating degree of c-axis crystal texture of the (Sm, Pr)Co{sub 5} phase increases first, peaks at 3 h, then drops again, revealing that the strongest c-axis crystal texture was obtained in the nanoflakes milled for 3 h. On the other hand, the coercivity (H{sub ci}) of the flakes increases gradually from 1.71 to 14.65 kOe with the increase of ball milling time. As a result, an optimal magnetic properties of M{sub r} of 10.23 kGs, H{sub ci} of 11.45 kOe and (BH){sub max} of 24.40 MGOe was obtained in Sm{sub 0.6}Pr{sub 0.4}Co{sub 5} nanoflakes milled for 3 h, which also displayed a high aspect ratio, small in-plane size, pronounced (001) out-of-plane texture. - Highlights: • Anisotropic Sm{sub 0.6}Pr{sub 0.4}Co{sub 5} nanoflakes with strong c-axis texture were prepared. • Effects of ball-milling time on structure and magnetic properties were studied. • (BH){sub max} value of Sm{sub 0.6}Pr{sub 0.4}Co{sub 5} nanoflakes is larger than that of SmCo{sub 5} nanoflakes.
Zeng, Zhenshun; Cai, Xingsheng; Wang, Pengxia; Guo, Yunxue; Liu, Xiaoxiao; Li, Baiyuan; Wang, Xiaoxue
2017-01-01
Pseudoalteromonas is an important bacterial genus present in various marine habitats. Many strains of this genus are found to be surface colonizers on marine eukaryotes and produce a wide range of pigments. However, the exact physiological role and mechanism of pigmentation were less studied. Pseudoalteromonas sp. SM9913 (SM9913), an non-pigmented strain isolated from the deep-sea sediment, formed attached biofilm at the solid-liquid interface and pellicles at the liquid-air interface at a wide range of temperatures. Lower temperatures and lower nutrient levels promoted the formation of attached biofilm, while higher nutrient levels promoted pellicle formation of SM9913. Notably, after prolonged incubation at higher temperatures growing planktonically or at the later stage of the biofilm formation, we found that SM9913 released a brownish pigment. By comparing the protein profile at different temperatures followed by qRT-PCR, we found that the production of pigment at higher temperatures was due to the induction of melA gene which is responsible for the synthesis of homogentisic acid (HGA). The auto-oxidation of HGA can lead to the formation of pyomelanin, which has been shown in other bacteria. Fourier Transform Infrared Spectrometer analysis confirmed that the pigment produced in SM9913 was pyomelanin-like compound. Furthermore, we demonstrated that, during heat stress and during biofilm formation, the induction level of melA gene was significantly higher than that of the hmgA gene which is responsible for the degradation of HGA in the L-tyrosine catabolism pathway. Collectively, our results suggest that the production of pyomelanin of SM9913 at elevated temperatures or during biofilm formation might be one of the adaptive responses of marine bacteria to environmental cues.
Directory of Open Access Journals (Sweden)
Zhenshun Zeng
2017-09-01
Full Text Available Pseudoalteromonas is an important bacterial genus present in various marine habitats. Many strains of this genus are found to be surface colonizers on marine eukaryotes and produce a wide range of pigments. However, the exact physiological role and mechanism of pigmentation were less studied. Pseudoalteromonas sp. SM9913 (SM9913, an non-pigmented strain isolated from the deep-sea sediment, formed attached biofilm at the solid–liquid interface and pellicles at the liquid–air interface at a wide range of temperatures. Lower temperatures and lower nutrient levels promoted the formation of attached biofilm, while higher nutrient levels promoted pellicle formation of SM9913. Notably, after prolonged incubation at higher temperatures growing planktonically or at the later stage of the biofilm formation, we found that SM9913 released a brownish pigment. By comparing the protein profile at different temperatures followed by qRT-PCR, we found that the production of pigment at higher temperatures was due to the induction of melA gene which is responsible for the synthesis of homogentisic acid (HGA. The auto-oxidation of HGA can lead to the formation of pyomelanin, which has been shown in other bacteria. Fourier Transform Infrared Spectrometer analysis confirmed that the pigment produced in SM9913 was pyomelanin-like compound. Furthermore, we demonstrated that, during heat stress and during biofilm formation, the induction level of melA gene was significantly higher than that of the hmgA gene which is responsible for the degradation of HGA in the L-tyrosine catabolism pathway. Collectively, our results suggest that the production of pyomelanin of SM9913 at elevated temperatures or during biofilm formation might be one of the adaptive responses of marine bacteria to environmental cues.
Kumar, Manish; Gazara, Rajesh Kumar; Verma, Sandhya; Kumar, Madan; Verma, Praveen Kumar; Thakur, Indu Shekhar
2016-01-01
The Serratia sp. strain ISTD04 has been identified as a carbon dioxide (CO2)-sequestering bacterium isolated from marble mining rocks in the Umra area, Rajasthan, India. This strain grows chemolithotrophically on media that contain sodium bicarbonate (NaHCO3) as the sole carbon source. Here, we report the genome sequence of 5.07?Mb Serratia sp. ISTD04.
Kumar, Manish; Gazara, Rajesh Kumar; Verma, Sandhya; Kumar, Madan; Verma, Praveen Kumar; Thakur, Indu Shekhar
2016-10-20
The Serratia sp. strain ISTD04 has been identified as a carbon dioxide (CO 2 )-sequestering bacterium isolated from marble mining rocks in the Umra area, Rajasthan, India. This strain grows chemolithotrophically on media that contain sodium bicarbonate (NaHCO 3 ) as the sole carbon source. Here, we report the genome sequence of 5.07 Mb Serratia sp. ISTD04. Copyright © 2016 Kumar et al.
Czech Academy of Sciences Publication Activity Database
Leontovyč, Adrian; Ulrychová, Lenka; O'Donoghue, A.J.; Marešová, Lucie; Vondrášek, Jiří; Caffrey, C. R.; Mareš, Michael; Horn, Martin; Dvořák, Jan
2017-01-01
Roč. 15, č. 1 (2017), s. 18 ISSN 2336-7202. [Mezioborové setkání mladých biologů, biochemiků a chemiků /17./. 30.05.2017-01.06.2017, Milovy] R&D Projects: GA MŠk LD15101; GA MŠk LO1302 Institutional support: RVO:61388963 Keywords : Schistosoma mansoni * SmSP2 Subject RIV: CE - Biochemistry
Liaw, Chih-Chuang; Chen, Pei-Chin; Shih, Chao-Jen; Tseng, Sung-Pin; Lai, Ying-Mi; Hsu, Chi-Hsin; Dorrestein, Pieter C.; Yang, Yu-Liang
2015-08-01
A robust and convenient research strategy integrating state-of-the-art analytical techniques is needed to efficiently discover novel compounds from marine microbial resources. In this study, we identified a series of amino-polyketide derivatives, vitroprocines A-J, from the marine bacterium Vibrio sp. QWI-06 by an integrated approach using imaging mass spectroscopy and molecular networking, as well as conventional bioactivity-guided fractionation and isolation. The structure-activity relationship of vitroprocines against Acinetobacter baumannii is proposed. In addition, feeding experiments with 13C-labeled precursors indicated that a pyridoxal 5‧-phosphate-dependent mechanism is involved in the biosynthesis of vitroprocines. Elucidation of amino-polyketide derivatives from a species of marine bacteria for the first time demonstrates the potential of this integrated metabolomics approach to uncover marine bacterial biodiversity.
Schwenninger, Susanne Miescher; von Ah, Ueli; Niederer, Brigitte; Teuber, Michael; Meile, Leo
2005-01-01
Lactobacilli isolated from different food and feed samples such as raw milk, cheese, yoghurt, olives, sour dough, as well as corn and grass silage, were screened for their antifungal activities. Out of 1,424 isolates tested, 82 were shown to be inhibitory to different yeasts (Candida spp. and Zygosaccharomyces bailii) and a Penicillium sp., which were previously isolated from spoiled yoghurt and fruits. Carbohydrate fermentation patterns suggested that a substantial portion, 25%, belonged to the Lactobacillus casei group, including L. casei, L. paracasei, and L. rhamnosus. The isolates SM20 (DSM14514), SM29 (DSM14515), and SM63 (DSM14516) were classified by PCR using species-specific primers to target the corresponding type strains (L. casei, L. paracasei, and L. rhamnosus) as controls. Further molecular typing methods such as randomly amplified polymorphic DNA, pulsed-field gel electrophoresis, and sequencing analysis of the 16S rRNA gene allowed classifying strains SM20, SM29, and SM63 as L. paracasei subsp. paracasei in accordance with the new reclassification of the L. casei group proposed by Collins et al.
Fang, Qing; Fan, Zhengqiu; Xie, Yujing; Wang, Xiangrong; Li, Kun; Liu, Yafeng
2016-01-01
The quest for new, promising and indigenous plant growth-promoting rhizobacteria and a deeper understanding of their relationship with plants are important considerations in the improvement of phytoremediation. This study focuses on the screening of plant beneficial Cu/Zn-resistant strains and assessment of their bioremediation potential (metal solubilization/tolerance/biosorption and effects on growth of Brassica napus seedlings) to identify suitable rhizobacteria and examine their roles in microbes-assisted phytoremediation. Sixty Cu/Zn-resistant rhizobacteria were initially isolated from Sonchus oleraceus grown at a multi-metal-polluted site in Shanghai, China. From these strains, 19 isolates that were all resistant to 300 mg⋅L -1 Cu as well as 300 mg⋅L -1 Zn, and could simultaneously grow on Dworkin-Foster salt minimal medium containing 1-aminocyclopropane-1-carboxylic acid were preliminarily selected. Of those 19 isolates, 10 isolates with superior plant growth-promoting properties (indole-3-acetic acid production, siderophore production, and insoluble phosphate solubilization) were secondly chosen and further evaluated to identify those with the highest bioremediation potential and capacity for bioaugmentation. Strain S44, identified as Acinetobacter sp. FQ-44 based on 16S rDNA sequencing, was specifically chosen as the most favorable strain owing to its strong capabilities to (1) promote the growth of rape seedlings (significantly increased root length, shoot length, and fresh weight by 92.60%, 31.00%, and 41.96%, respectively) under gnotobiotic conditions; (2) tolerate up to 1000 mg⋅L -1 Cu and 800 mg⋅L -1 Zn; (3) mobilize the highest concentrations of water-soluble Cu, Zn, Pb, and Fe (16.99, 0.98, 0.08, and 3.03 mg⋅L -1 , respectively); and (4) adsorb the greatest quantities of Cu and Zn (7.53 and 6.61 mg⋅g -1 dry cell, respectively). Our findings suggest that Acinetobacter sp. FQ-44 could be exploited for bacteria-assisted phytoextraction
Enrichment of Acinetobacter spp. from food samples.
Carvalheira, Ana; Ferreira, Vânia; Silva, Joana; Teixeira, Paula
2016-05-01
Relatively little is known about the role of foods in the chain of transmission of acinetobacters and the occurrence of different Acinetobacter spp. in foods. Currently, there is no standard procedure to recover acinetobacters from food in order to gain insight into the food-related ecology and epidemiology of acinetobacters. This study aimed to assess whether enrichment in Dijkshoorn enrichment medium followed by plating in CHROMagar™ Acinetobacter medium is a useful method for the isolation of Acinetobacter spp. from foods. Recovery of six Acinetobacter species from food spiked with these organisms was compared for two selective enrichment media (Baumann's enrichment and Dijkshoorn's enrichment). Significantly (p enrichment. Next, the Dijkshoorn's enrichment followed by direct plating on CHROMagar™ Acinetobacter was applied to detect Acinetobacter spp. in different foods. Fourteen different presumptive acinetobacters were recovered and assumed to represent nine different strains on the basis of REP-PCR typing. Eight of these strains were identified by rpoB gene analysis as belonging to the species Acinetobacter johnsonii, Acinetobacter calcoaceticus, Acinetobacter guillouiae and Acinetobacter gandensis. It was not possible to identify the species level of one strain which may suggests that it represents a distinct species. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Qing Fang
2016-09-01
Full Text Available The quest for new, promising and indigenous plant growth-promoting rhizobacteria and a deeper understanding of their relationship with plants are important considerations in the improvement of phytoremediation. This study focuses on the screening of plant beneficial Cu/Zn-resistant strains and assessment of their bioremediation potential (metal solubilization/tolerance/biosorption and effects on growth of Brassica napus seedlings to identify suitable rhizobacteria and examine their roles in microbes-assisted phytoremediation. Sixty Cu/Zn-resistant rhizobacteria were initially isolated from Sonchus oleraceus grown at a multi-metal-polluted site in Shanghai, China. From these strains, 19 isolates that were all resistant to 300 mg·L-1 Cu as well as 300 mg·L-1 Zn, and could simultaneously grow on Dworkin-Foster salt minimal medium containing 1-aminocyclopropane-1-carboxylic acid were preliminarily selected. Of those 19 isolates, 10 isolates with superior plant growth-promoting properties (indole-3-acetic acid production, siderophore production and insoluble phosphate solubilization were secondly chosen and further evaluated to identify those with the highest bioremediation potential and capacity for bioaugmentation. Strain S44, identified as Acinetobacter sp. FQ-44 based on 16S rDNA sequencing, was specifically chosen as the most favorable strain owing to its strong capabilities to (1 promote the growth of rape seedlings (significantly increased root length, shoot length and fresh weight by 92.60%, 31.00% and 41.96%, respectively under gnotobiotic conditions; (2 tolerate up to 1000 mg·L-1 Cu and 800 mg·L-1 Zn; (3 mobilize the highest concentrations of water-soluble Cu, Zn, Pb and Fe (16.99, 0.98, 0.08 and 3.03 mg·L-1, respectively; and (4 adsorb the greatest quantities of Cu and Zn (7.53 and 6.61 mg·g-1 dry cell, respectively. Our findings suggest that Acinetobacter sp. FQ-44 could be exploited for bacteria-assisted phytoextraction. Moreover
Chen, Xiu-Lan; Peng, Ming; Li, Jing; Tang, Bai-Lu; Shao, Xuan; Zhao, Fang; Liu, Chang; Zhang, Xi-Ying; Li, Ping-Yi; Shi, Mei; Zhang, Yu-Zhong; Song, Xiao-Yan
2017-11-16
Although several serine collagenolytic proteases from bacteria were reported, none has been used to prepare bioactive collagen peptides. MCP-01 is the most abundant extracellular protease of deep-sea Pseudoalteromonas sp. SM9913 and is a serine collagenolytic protease with high efficiency on fish collagen hydrolysis. Here, we set up a pilot scale process to ferment SM9913 for extracellular protease production. With SM9913 extracellular protease as a tool, a process to prepare collagen oligopeptide-rich hydrolysate from codfish skin was set up, which was further scaled up to pilot (100 L) and plant (2000 L) levels with yields >66%. The hydrolysates from laboratory-, pilot- and plant-scales had quite similar quality, containing ~95% peptides with molecular weights lower than 3000 Da and approximately 60% lower than 1000 Da, in which collagen oilgopeptides account for approximately 95%. Bioactivity analyses showed that the hydrolysate had moisture-retention ability, antioxidant activity, and promoting effect on cell viability of human dermal fibroblasts. Safety evaluation showed that the hydrolysate was nontoxic and nonirritating to skin. Therefore, SM9913 extracellular protease is a good enzyme to prepare bioactive oligopeptides from fish skin. The results also suggest that the collagen oligopeptides-rich hydrolysate may have potentials in biomedical, functional food, pharmaceutical and cosmetic industries.
Directory of Open Access Journals (Sweden)
Vânia Waleska Sousa da Cunha
2015-01-01
Full Text Available A presença de infecções na corrente sanguínea representa uma grave complicação na situação de pacientes críticos, podendo aumentar os riscos de morbidade e mortalidade, sendo a hemocultura um importante recurso no diagnóstico do agente microbiano. Entre as bactérias causadoras de bacteriemia, encontramos, frequentemente, a Acinetobacter spp, sendo um patógeno de grande importância clínica devido ao aumento de sua frequência como causa de infecções hospitalares e, também, por, normalmente, apresentar multirresistência aos agentes antimicrobianos de prática clínica. O presente estudo teve como finalidade o levantamento epidemiológico de infecções em hemoculturas causadas pelo gênero Acinetobacter spp em pacientes internados, em hospitais de São José dos Campos-SP, demonstrando sua prevalência no munícipio. Os dados analisados foram fornecidos pelo sistema de um laboratório de análises microbiológicas e utilizados para o levantamento de infecções por Acinetobacter spp em hemoculturas, no período de agosto de 2012 a agosto de 2013. Foram avaliados 5.759 exames de hemocultura, com 1.019 resultados positivos, sendo que Acinetobacter baumannii foi identificada em 31 amostras, correspondendo ao sexto patógeno mais isolado (3,04% das hemoculturas positivas. A. baumannii se tornou um patógeno de grande preocupação hospitalar, devido à sua crescente colonização nas Unidades de Tratamento Intensivo e sua multirresistência aos antimicrobianos.
Raoultella sp. SM1, a novel iron-reducing and uranium-precipitating strain.
Sklodowska, Aleksandra; Mielnicki, Sebastian; Drewniak, Lukasz
2018-03-01
The main aim of this study was the characterisation of novel Raoutella isolate, an iron-reducing and uranium-precipitating strain, originating from microbial mats occurring in the sediments of a closed down uranium mine in Kowary (SW Poland). Characterisation was done in the context of its potential role in the functioning of these mats and the possibility to use them in uranium removal/recovery processes. In our experiment, we observed the biological precipitation of iron and uranium's secondary minerals containing oxygen, potassium, sodium and phosphor, which were identified as ningyoite-like minerals. The isolated strain, Raoultella sp. SM1, was also able to dissimilatory reduce iron (III) and uranium (VI) in the presence of citrate as an electron donor. Our studies allowed us to characterise a new strain which may be used as a model microorganism in the study of Fe and U respiratory processes and which may be useful in the bioremediation of uranium-contaminated waters and sediments. During this process, uranium may be immobilised in ningyoite-like minerals and can then be recovered in nano/micro-particle form, which may be easily transformed to uraninite. Copyright © 2017 Elsevier Ltd. All rights reserved.
Vetchinkina, E M; Komakhina, V V; Vysotskii, D A; Zaitsev, D V; Smirnov, A N; Babakov, A V; Komakhin, R A
2016-09-01
The chickweed (Stellaria media L.) pro-SmAMP2 gene encodes the hevein-like peptides that have in vitro antimicrobial activity against certain harmful microorganisms. These peptides play an important role in protecting the chickweed plants from infection, and the pro-SmAMP2 gene was previously used to protect transgenic tobacco and Arabidopsis plants from phytopathogens. In this study, the pro-SmAMP2 gene under control of viral CaMV35S promoter or under control of its own pro-SmAMP2 promoter was transformed into cultivated potato plants of two cultivars, differing in the resistance to Alternaria: Yubiley Zhukova (resistant) and Skoroplodny (susceptible). With the help of quantitative real-time PCR, it was demonstrated that transgenic potato plants expressed the pro-SmAMP2 gene under control of both promoters at the level comparable to or exceeding the level of the potato actin gene. Assessment of the immune status of the transformants demonstrated that expression of antimicrobial peptide pro-SmAMP2 gene was able to increase the resistance to a complex of Alternaria sp. and Fusarium sp. phytopathogens only in potato plants of the Yubiley Zhukova cultivar. The possible role of the pro-SmAMP2 products in protecting potatoes from Alternaria sp. and Fusarium sp. is discussed.
Kuzi, S; Blum, S E; Kahane, N; Adler, A; Hussein, O; Segev, G; Aroch, I
2016-11-01
Members of the Acinetobacter calcoaceticus-Acinetobacter baumannii complex cause severe outbreaks in humans, and are increasingly reported in animals. A retrospective study, describing a severe outbreak in dogs and cats caused by a multidrug resistant member of the Acinetobacter calcoaceticus-Acinetobacter baumannii complex in a veterinary hospital, between July 2010 and November 2012. The study included 19 dogs and 4 cats. Acinetobacter calcoaceticus-Acinetobacter baumannii complex bacteria were isolated from urine (9 animals), respiratory tract (11), tissues (3) and blood (1). The most common infection-associated findings included fever, purulent discharge from endotracheal tubes, hypotension, and neutropaenia. Infections led to pneumonia, urinary tract infection, cellulitis and sepsis. Infection was transmitted in the intensive care unit, where 22 of 23 animals were initially hospitalised. The mortality rate was 70% (16 of 23 animals), and was higher in cases of respiratory infection compared to other infections. Aggressive environmental cleaning and disinfection, with staff education for personal hygiene and antisepsis, sharply decreased the infection incidence. Health care-associated outbreaks with multidrug resistant Acinetobacter calcoaceticus-Acinetobacter baumannii complex in dogs and cats are potentially highly fatal and difficult to eradicate, warranting monitoring, antiseptic techniques and judicious antibiotic use. © 2016 British Small Animal Veterinary Association.
Longkumer, Toshisangba; Kamireddy, Swetha; Muthyala, Venkateswar Reddy; Akbarpasha, Shaikh; Pitchika, Gopi Krishna; Kodetham, Gopinath; Ayaluru, Murali; Siddavattam, Dayananda
2013-01-01
While analyzing plasmids of Acinetobacter sp. DS002 we have detected a circular DNA molecule pTS236, which upon further investigation is identified as the genome of a phage. The phage genome has shown sequence similarity to the recently discovered Sphinx 2.36 DNA sequence co-purified with the Transmissible Spongiform Encephalopathy (TSE) particles isolated from infected brain samples collected from diverse geographical regions. As in Sphinx 2.36, the phage genome also codes for three proteins. One of them codes for RepA and is shown to be involved in replication of pTS236 through rolling circle (RC) mode. The other two translationally coupled ORFs, orf106 and orf96, code for coat proteins of the phage. Although an orf96 homologue was not previously reported in Sphinx 2.36, a closer examination of DNA sequence of Sphinx 2.36 revealed its presence downstream of orf106 homologue. TEM images and infection assays revealed existence of phage AbDs1 in Acinetobacter sp. DS002.
Sardini, Rima Novia
2015-01-01
Acinetobacter sp. is one of the major pathogenic bacteria which are endemic throughout the world. Acinetobacter baumannii’s infections are often involved in a variety of nosocomial infections in the urinary tract, surgical wound infection, infection of the blood vessels, ventilator-associated pneumonia (VAP) and meningitis in particular patients with a low immune system that are in the intensive care unit (ICU). This study aimed to determine the relationship of the number of primary disease...
Characterization of Acinetobacter baumannii strain PS3 in degradation of food emulsifiers
Nguyen, Ngoc Tuan; Tran, Tuyet Nhung; Ha, Thi Bich Ngoc
2018-04-01
Strain SP3 revealed the abilty to utilizes emulsifier which is widely used in the preparation of drugs, vaccines, food, cosmetics and skin care products as its sole carbon and energy source. Generation time ranges from 1.4 to 2.1 h on the polysorbate family. Strain was identified as Acinetobacter baumannii based on 16S rRNA gene and it could dispose 27 % polysorbate 80 within a day. The proposed mechanism for polysorbate utilization belongs to the β-oxidation.
Reservoirs of Non-baumannii Acinetobacter Species
Al Atrouni, Ahmad; Joly-Guillou, Marie-Laure; Hamze, Monzer; Kempf, Marie
2016-01-01
Acinetobacter spp. are ubiquitous gram negative and non-fermenting coccobacilli that have the ability to occupy several ecological niches including environment, animals and human. Among the different species, Acinetobacter baumannii has evolved as global pathogen causing wide range of infection. Since the implementation of molecular techniques, the habitat and the role of non-baumannii Acinetobacter in human infection have been elucidated. In addition, several new species have been described. In the present review, we summarize the recent data about the natural reservoir of non-baumannii Acinetobacter including the novel species that have been described for the first time from environmental sources and reported during the last years. PMID:26870013
Multidrug‑resistant acinetobacter infection and their susceptibility ...
African Journals Online (AJOL)
Results: Major infections found in different medical wards, surgical wards and ICU were due to Acinetobacter baumannii (74.02%), A. lowfii (14.2%), A. haemolyticus (7.79%), A. junii (3.8%) among Acinetobacter spices. Acinetobacter showed increased resistant against majority of commercially available drugs imipenem ...
Bharti, Randhir K; Srivastava, Shaili; Thakur, Indu Shekhar
2014-08-01
A CO2 sequestering bacterial strain, Serratia sp. ISTD04, that produces a significant amount of extracellular lipids was isolated from marble mine rocks. (14)C labeling analysis revealed that the rate of assimilation of CO2 by the strain is 0.756×10(-9)μmolCO2fixedcell(-1)h(-1). It was found to produce 466mg/l of extracellular lipid which was characterized using (1)H NMR. After transesterification of lipids, the total saturated and unsaturated FAME was found to be 51% and 49% respectively. The major FAME contained in the biodiesel were palmitic acid methyl ester (C16:0), oleic acid methyl ester (C18:1) and 10-nonadecenoic acid methyl ester (C19:1). Biodiesel produced by Serratia sp. ISTD04 is balanced in terms of FAME composition of good quality. It also contained higher proportion of oleic acid (35%) which makes it suitable for utilization in existing engines. Thus, the strain can be harnessed commercially to sequester CO2 into biodiesel. Copyright © 2014 Elsevier Ltd. All rights reserved.
Li, Hong; Ai, Hainan; Kang, Li; Sun, Xingfu; He, Qiang
2016-11-01
Measures for removal of toxic harmful algal blooms often cause lysis of algal cells and release of microcystins (MCs). In this study, Acinetobacter sp. CMDB-2 that exhibits distinct algal lysing activity and MCs degradation capability was isolated. The physiological response and morphological characteristics of toxin-producing Microcystis aeruginosa, the dynamics of intra- and extracellular MC-LR concentration were studied in an algal/bacterial cocultured system. The results demonstrated that Acinetobacter sp. CMDB-2 caused thorough decomposition of algal cells and impairment of photosynthesis within 24 h. Enhanced algal lysis and MC-LR release appeared with increasing bacterial density from 1 × 10 3 to 1 × 10 7 cells/mL; however, the MC-LR was reduced by nearly 94% within 14 h irrespective of bacterial density. Measurement of extracellular and intracellular MC-LR revealed that the toxin was decreased by 92% in bacterial cell incubated systems relative to control and bacterial cell-free filtrate systems. The results confirmed that the bacterial metabolite caused 92% lysis of Microcystis aeruginosa cells, whereas the bacterial cells were responsible for approximately 91% reduction of MC-LR. The joint efforts of the bacterium and its metabolite accomplished the sustainable removal of algae and MC-LR. This is the first report of a single bacterial strain that achieves these dual actions.
Directory of Open Access Journals (Sweden)
Priyendu Asim
2016-01-01
Full Text Available Context: Acinetobacter infections are a major nosocomial infection causing epidemics of infection in the Intensive Care Units (ICU. Aims: This study estimates the clinical and economic outcomes of Acinetobacter infections and compares them with those of non-Acinetobacter bacterial infections. Settings and Design: Prospective cross-sectional observational study carried out for 6 months in the medicine ICU of a tertiary care hospital. Materials and Methods: Patients were divided in two groups, one group with Acinetobacter infections and the other with non-Acinetobacter infections. The data was collected for infection, length of stay (LOS, mortality and cost along with patient demographics from the hospital records for analysis. Statistical Analysis Used: The data was analyzed using Statistical Package for the Social Sciences Version 15.0. The LOS and cost of treatment (COT for the two groups were compared using the nonparametric Mann–Whitney U-test. Results: A total of 220 patients were studied out of which 91 had Acinetobacter infections. The median LOS was 20 days in Group-A and 12 days in Group-B (P < 0.0001. The median COT was INR 125,862 in Group-A and INR 68,228 in the Group-B (P < 0.0001. Mortality in Group-A and Group-B was 32.97 and 32.56 (P = 0.949 respectively. Conclusion: The burden of Acinetobacter infections in ICUs is increasing with the increase in LOS and COT for the patients. The infection control team has to play a major role in reducing the rate of nosocomial infections.
Structural and electrical properties of Sm{sup 3+} substituted PZT ceramics
Energy Technology Data Exchange (ETDEWEB)
Pandey, S.K. [Solid State Physics Laboratory, Timarpur, Delhi 110 054 (India)], E-mail: 628@ssplnet.org; Thakur, O.P.; Bhattacharya, D.K. [Solid State Physics Laboratory, Timarpur, Delhi 110 054 (India); Prakash, Chandra [DRDO Bhawan, DHQ, New Delhi 110 011 (India); Chatterjee, Ratnamala [Department of Physics, Indian Institute of Technology, New Delhi 110 016 (India)
2009-01-22
Samarium modified lead zirconate titanate (PSZT: Pb{sub 1-x}Sm{sub x}(Zr{sub 0.65}Ti{sub 0.35})O{sub 3}: x = 0, 0.02, 0.04, 0.06) ceramics were synthesized by solid state ceramic route. XRD shows single-phase formation with rhombohedral structure up to x = 0.04. With Sm-substitution, the grain size first increases up to x = 0.02 and then decreases. A metal/ferroelectric/metal (MFM) structure was made by depositing gold electrode on the flat surfaces for electrical measurements. All samples show normal ferroelectric behaviour, however, a squareness of P-E loop (polarization vs. electric field) was observed to increase with Sm content. Higher electromechanical coupling coefficients (K{sub p} and K{sub t}) have been achieved for the PZT with 6 mol% Sm substitution and having fine grain size.
Schleicher, X; Higgins, P G; Wisplinghoff, H; Körber-Irrgang, B; Kresken, M; Seifert, H
2013-08-01
To investigate the species distribution within the Acinetobacter calcoaceticus-Acinetobacter baumannii complex and the molecular epidemiology of A. baumannii and Acinetobacter nosocomialis, 376 Acinetobacter isolates were collected prospectively from hospitalized patients at 15 medical centres in Germany during three surveillance studies conducted over a 5-year period. Species identification was performed by molecular methods. Imipenem minimum inhibitory concentrations (MIC) were determined by broth microdilution. The prevalence of the most common carbapenemase-encoding genes was investigated by oxacillinase (OXA) -multiplex polymerase chain reaction (PCR). The molecular epidemiology was investigated by repetitive sequence-based PCR (rep-PCR; DiversiLab™). Acinetobacter pittii was the most prevalent Acinetobacter species (n = 193), followed by A. baumannii (n = 140), A. calcoaceticus (n = 10) and A. nosocomialis (n = 8). The majority of A. baumannii was represented by sporadic isolates (n = 70, 50%) that showed unique rep-PCR patterns, 25 isolates (18%) clustered with one or two other isolates, and only 45 isolates (32%) belonged to one of the previously described international clonal lineages. The most prevalent clonal lineage was international clone (IC) 2 (n = 34) and IC 1 (n = 6). According to CLSI, 25 A. baumannii isolates were non-susceptible to imipenem (MIC ≥ 8 mg/L), all of which produced an OXA-58-like or OXA-23-like carbapenemase. The rate of imipenem susceptibility among A. baumannii isolates decreased from 96% in 2005 to 76% in 2009. All other Acinetobacter isolates were susceptible to imipenem. The population structure of carbapenem-susceptible A. baumannii in Germany is highly diverse. Imipenem non-susceptibility was strongly associated with the clonal lineages IC 2 and IC 1. These data underscore the high clonality of carbapenem-resistant A. baumannii isolates. © 2012 The Authors. Clinical Microbiology and Infection © 2012 European Society of
Drug-resistant post-neurosurgical nosocomial Acinetobacter ...
African Journals Online (AJOL)
Drug-resistant post-neurosurgical nosocomial Acinetobacter baumannii meningitis in two Iranian hospitals. ... Vol 11, No 17 (2012) >. Log in or Register to get access to full text downloads. ... Acinetobacter baumannii may cause meningitis and ventriculitis, particularly after head trauma and/or neurosurgery. The rate of ...
Lee, Kibaek; Kim, Yea-Won; Lee, Seonki; Lee, Sang Hyun; Nahm, Chang Hyun; Kwon, Hyeokpil; Park, Pyung-Kyu; Choo, Kwang-Ho; Koyuncu, Ismail; Drews, Anja; Lee, Chung-Hak; Lee, Jung-Kee
2018-05-01
Bacterial quorum quenching (QQ) by means of degrading signaling molecules has been applied to anti-biofouling strategy in a membrane bioreactor (MBR) for wastewater treatment. However, the target signaling molecules have been limited to N-acyl homoserine lactones participating in intra-species quorum sensing. Here, an approach to disrupt autoinducer-2 (AI-2) signaling molecules participating in inter-species quorum sensing, was pursued as a next-generation anti-biofouling strategy in an MBR for wastewater treatment. We isolated an indigenous QQ bacterium ( Acinetobacter sp. DKY-1) that can attenuate the expression of quorum sensing (QS) response through inactivation of autoinducer-2 signaling molecule, 4,5-dihydroxy-2,3-pentanedione (DPD) among four kinds of autoinducer-2 QS bacteria. DKY-1 released AI-2 QQ compound(s), which was verified to be hydrophilic with a molecular weight biofouling. This new approach, combining molecular biology with wastewater engineering, could enlarge the range of QQ-MBR for anti-biofouling and energy savings in the field of wastewater treatment.
Acinetobacter spp. as nosocomial pathogens: Epidemiology and resistance features
Directory of Open Access Journals (Sweden)
Saad B. Almasaudi
2018-03-01
Full Text Available The genus Acinetobacter is a major cause of nosocomial infections; it is increasingly being associated with various epidemics and has become a widespread concern in a variety of hospitals worldwide. Multi-antibiotic resistant Acinetobacter baumannii, is now recognized to be of great clinical significance. Numerous reports relay to the spread of A. baumannii in the hospital settings which leads to enhanced nosocomial outbreaks associated with high death rates. However, many other Acinetobacter spp. also can cause nosocomial infections. This review focused on the role of Acinetobacter spp. as nosocomial pathogens in addition to their persistence, antimicrobial resistance patterns and epidemiology. Keywords: Acinetobacter, Nosocomial infections, Multi-drug resistance, Epidemiology, Characteristics
Teixeira, Aline B; Barin, Juliana; Hermes, Djuli M; Barth, Afonso L; Martins, Andreza F
2017-05-01
The genus Acinetobacter sp. comprises more than 50 species, and four are closely related and difficult to be distinguished by either phenotypic or genotypic methods: the Acinetobacter calcoaceticus-baumannii complex (ABC). The correct identification at species level is necessary mainly due to the epidemiological aspects. We evaluated a multiplex PCR for gyrB gene to identify the species of the ABC using the sequencing of the ITS 16S-23S fragment as a gold standard. Isolates identified as Acinetobacter calcoaceticus-baumannii from three hospitals at southern Brazil in 2011 were included in this study. A total of 117 isolates were obtained and 106 (90.6%) were confirmed as A. baumannii, 6 (5.1%) as A. nosocomialis and 4 (3.4%) as A. pittii by PCR for gyrB gene. Only one isolate did not present a product of the PCR for the gyrB gene; this isolate was identified as Acinetobacter genospecie 10 by sequencing of ITS. We also noted that the non-A. baumannii isolates were recovered from respiratory tract (8/72.7%), blood (2/18.2%) and urine (1/9.1%), suggesting that these species can cause serious infection. These findings evidenced that the multiplex PCR of the gyrB is a feasible and simple method to identify isolates of the ABC at the species level. © 2016 Wiley Periodicals, Inc.
Directory of Open Access Journals (Sweden)
Farkhondeh Amini
2017-03-01
microorganisms could have emerged as a result of the clear positive selection exerted on these associations. The current study is conducted in order to evaluate the effectiveness of cucumber root endophytic bacteria on increasing plant growth indexes. Materials and Methods: In this study, 45 strains were isolated from cucumber roots as mentioned in the literature. In the first step, all of them subjected to seed germination assay in lab conditions. Furthermore, they are evaluated for vigor index according to references. Seven strains (En 1 to En7 are selected for complementary research in greenhouse trials using randomized block design with 4 repetitions. Statistical analysis is done using SPSS v.22 by Duncan methods under 5% possibility levels. To detect preferred bacterial species, 16S rDNA-PCR product is sent for sequencing to Macrogen, Korea. The sequences are checked in BLAST program in NCBI database. Results and Discussion: Based on medians comparison, cucumber seed cultivar Negin, are treated by 45 endophytic bacteria separately. Among them, seven strains showed a significant difference at 1% possibility level in comparison to control. These strains presented high vigor index from 1954.6 to 572 compared to control. They also showed better seed germination percentage rather than control in the range of 95 to 45 %, and selected for greenhouse trials. The results of medians comparison in pot experiments demonstrated that En1 strains leads to 60% root and shoot length enhancement comparing to control. Furthermore, highest shoot (84.6% and root (55.8% wet weight are recorded for En6 in comparison to control. Molecular data revealed that strains En1 and En6 belonging to Acinetobacter sp. and Pseudomonas rhodesiae, respectively. It is known that variation in endophytic bacteria may reflect differences in agriculture management methods. The P. rhodesiae is categorized in Pseudomonas fluorescent group and is isolated from mineral water for the first time. The positive effect of
Schwer, Beate; Kruchten, Joshua; Shuman, Stewart
2016-01-01
A seven-subunit Sm protein ring forms a core scaffold of the U1, U2, U4, and U5 snRNPs that direct pre-mRNA splicing. Using human snRNP structures to guide mutagenesis in Saccharomyces cerevisiae, we gained new insights into structure–function relationships of the SmG, SmE, and SmF subunits. An alanine scan of 19 conserved amino acids of these three proteins, comprising the Sm RNA binding sites or inter-subunit interfaces, revealed that, with the exception of Arg74 in SmF, none are essential for yeast growth. Yet, for SmG, SmE, and SmF, as for many components of the yeast spliceosome, the effects of perturbing protein–RNA and protein–protein interactions are masked by built-in functional redundancies of the splicing machine. For example, tests for genetic interactions with non-Sm splicing factors showed that many benign mutations of SmG, SmE, and SmF (and of SmB and SmD3) were synthetically lethal with null alleles of U2 snRNP subunits Lea1 and Msl1. Tests of pairwise combinations of SmG, SmE, SmF, SmB, and SmD3 alleles highlighted the inherent redundancies within the Sm ring, whereby simultaneous mutations of the RNA binding sites of any two of the Sm subunits are lethal. Our results suggest that six intact RNA binding sites in the Sm ring suffice for function but five sites may not. PMID:27417296
Pathogenic Acinetobacter: from the Cell Surface to Infinity and Beyond
Weber, Brent S.; Harding, Christian M.
2015-01-01
The genus Acinetobacter encompasses multiple nosocomial opportunistic pathogens that are of increasing worldwide relevance because of their ability to survive exposure to various antimicrobial and sterilization agents. Among these, Acinetobacter baumannii, Acinetobacter nosocomialis, and Acinetobacter pittii are the most frequently isolated in hospitals around the world. Despite the growing incidence of multidrug-resistant Acinetobacter spp., little is known about the factors that contribute to pathogenesis. New strategies for treating and managing infections caused by multidrug-resistant Acinetobacter strains are urgently needed, and this requires a detailed understanding of the pathobiology of these organisms. In recent years, some virulence factors important for Acinetobacter colonization have started to emerge. In this review, we focus on several recently described virulence factors that act at the bacterial surface level, such as the capsule, O-linked protein glycosylation, and adhesins. Furthermore, we describe the current knowledge regarding the type II and type VI secretion systems present in these strains. PMID:26712938
Schwer, Beate; Kruchten, Joshua; Shuman, Stewart
2016-09-01
A seven-subunit Sm protein ring forms a core scaffold of the U1, U2, U4, and U5 snRNPs that direct pre-mRNA splicing. Using human snRNP structures to guide mutagenesis in Saccharomyces cerevisiae, we gained new insights into structure-function relationships of the SmG, SmE, and SmF subunits. An alanine scan of 19 conserved amino acids of these three proteins, comprising the Sm RNA binding sites or inter-subunit interfaces, revealed that, with the exception of Arg74 in SmF, none are essential for yeast growth. Yet, for SmG, SmE, and SmF, as for many components of the yeast spliceosome, the effects of perturbing protein-RNA and protein-protein interactions are masked by built-in functional redundancies of the splicing machine. For example, tests for genetic interactions with non-Sm splicing factors showed that many benign mutations of SmG, SmE, and SmF (and of SmB and SmD3) were synthetically lethal with null alleles of U2 snRNP subunits Lea1 and Msl1. Tests of pairwise combinations of SmG, SmE, SmF, SmB, and SmD3 alleles highlighted the inherent redundancies within the Sm ring, whereby simultaneous mutations of the RNA binding sites of any two of the Sm subunits are lethal. Our results suggest that six intact RNA binding sites in the Sm ring suffice for function but five sites may not. © 2016 Schwer et al.; Published by Cold Spring Harbor Laboratory Press for the RNA Society.
Comparative Analysis of 37 Acinetobacter Bacteriophages
Directory of Open Access Journals (Sweden)
Dann Turner
2017-12-01
Full Text Available Members of the genus Acinetobacter are ubiquitous in the environment and the multiple-drug resistant species A. baumannii is of significant clinical concern. This clinical relevance is currently driving research on bacterial viruses infecting A. baumannii, in an effort to implement phage therapy and phage-derived antimicrobials. Initially, a total of 42 Acinetobacter phage genome sequences were available in the international nucleotide sequence databases, corresponding to a total of 2.87 Mbp of sequence information and representing all three families of the order Caudovirales and a single member of the Leviviridae. A comparative bioinformatics analysis of 37 Acinetobacter phages revealed that they form six discrete clusters and two singletons based on genomic organisation and nucleotide sequence identity. The assignment of these phages to clusters was further supported by proteomic relationships established using OrthoMCL. The 4067 proteins encoded by the 37 phage genomes formed 737 groups and 974 orphans. Notably, over half of the proteins encoded by the Acinetobacter phages are of unknown function. The comparative analysis and clustering presented enables an updated taxonomic framing of these clades.
Directory of Open Access Journals (Sweden)
Liuhong Zhang
2017-02-01
Full Text Available Two new sesquiterpenes, microsphaeropsisin B (1 and C (2, and two new de-O-methyllasiodiplodins, (3R, 7R-7-hydroxy-de-O-methyllasiodiplodin (4 and (3R-5-oxo-de-O-methyllasiodiplodin (5, together with one new natural product (6 and twelve known compounds (3, 7–17, were isolated from the co-cultivation of mangrove endophytic fungus Trichoderma sp. 307 and aquatic pathogenic bacterium Acinetobacter johnsonii B2. Their structures, including absolute configurations, were elucidated by extensive analysis of spectroscopic data, electronic circular dichroism, Mo2(AcO4-induced circular dichroism, and comparison with reported data. All of the isolated compounds were tested for their α-glucosidase inhibitory activity and cytotoxicity. New compounds 4 and 5 exhibited potent α-glucosidase inhibitory activity with IC50 values of 25.8 and 54.6 µM, respectively, which were more potent than the positive control (acarbose, IC50 = 703.8 µM. The good results of the tested bioactivity allowed us to explore α-glucosidase inhibitors in lasiodiplodins.
Nosocomial infections due to Acinetobacter calcoaceticus.
Directory of Open Access Journals (Sweden)
Zaer F
1989-01-01
Full Text Available Fifty four isolates of Acinetobacter calcoaceticus were studied in a period of 6 months. Maximum isolates were from burns cases and environmental sampling from burns ward also grew the same organism, indicating their role as nosocomial pathogen. Acinetobacter may initially be mistaken for Neisseria species. As the organisms show multidrug resistance to commonly used antibiotics their correct identification is important.
Nosocomial infections due to Acinetobacter calcoaceticus.
Zaer, F; Deodhar, L
1989-01-01
Fifty four isolates of Acinetobacter calcoaceticus were studied in a period of 6 months. Maximum isolates were from burns cases and environmental sampling from burns ward also grew the same organism, indicating their role as nosocomial pathogen. Acinetobacter may initially be mistaken for Neisseria species. As the organisms show multidrug resistance to commonly used antibiotics their correct identification is important.
Nanoparticles for Control of Biofilms of Acinetobacter Species
Directory of Open Access Journals (Sweden)
Richa Singh
2016-05-01
Full Text Available Biofilms are the cause of 80% of microbial infections. Acinetobacter species have emerged as multi- and pan-drug-resistant bacteria and pose a great threat to human health. These act as nosocomial pathogens and form excellent biofilms, both on biotic and abiotic surfaces, leading to severe infections and diseases. Various methods have been developed for treatment and control of Acinetobacter biofilm including photodynamic therapy, radioimmunotherapy, prophylactic vaccines and antimicrobial peptides. Nanotechnology, in the present scenario, offers a promising alternative. Nanomaterials possess unique properties, and multiple bactericidal mechanisms render them more effective than conventional drugs. This review intends to provide an overview of Acinetobacter biofilm and the significant role of various nanoparticles as anti-biofouling agents, surface-coating materials and drug-delivery vehicles for biofilm control and treatment of Acinetobacter infections.
LOGICAL AND EXPERIMENTAL DESIGN FOR PHENOL DEGRADATION USING IMMOBILIZED ACINETOBACTER SP. CULTURE
Directory of Open Access Journals (Sweden)
Amro Abd Al Fattah Amara
2010-05-01
Full Text Available Phenol degradation processes were conducted through a series of enzymatic reactions effects and is affect by different components of the microbial metabolic flux. Using different optimization strategies like mutagenesis could lead to a successful optimization but also lead to lost of some important microbial features or to release a new virulence or unexpected characters. Plackett-Burman closes much gab between optimization, safety, time, cost, Man/hr, the complexity of the metabolic flux etc. Using Plackett-Burman experimental design lead to map the points affect in the optimization process by well understanding their request from nutrient and the best environmental condition required. In this study nine variables include pH (X1, oC (X2, glucose (X3, yeast extract (X4, meat extract (X5, NH4NO3 (X6, K-salt (X7, Mg-salt (X8 and trace element (X9 are optimized during phenol degradation by Acinetobacter sp., using Plackett-Burman design method. Plackett-Burman included 16 experiments, each was used in two levels, [-1] low and high [+1]. According to Blackett-Burman design experiments the maximum degradation rate was 31.25 mg/l/h. Logical and statistical analysis of the data lead to select pH, Temperature and Meat extract as three factors affecting on phenol degradation rate. These three variables have been used in Box-Behnken experimental design for further optimization. Meat extract, which is not statistically recommended for optimization has been used while it can substitute trace element, which is statistically significant. Glucose, which is statistically significant, did not included while it has a negative effect and gave the best result at 0 g/l amount. Glucose has been completely omitted from the media. pH, temperature and meat extract were used in fifteen experiments each was used in three levels, –1, 0, and +1 according to Box-Behnken design. Microsoft Excel 2002 solver tool was used to optimize the model created from Box-Behnken. The
Precipitation sequence and kinetics in a Mg-4Sm-1Zn-0.4Zr (wt%) alloy
Energy Technology Data Exchange (ETDEWEB)
Xia, Xiangyu, E-mail: xxia5@wisc.edu [Materials Science Program, University of Wisconsin – Madison, 1509 University Ave., Madison, WI 53706 (United States); Department of Materials Science and Engineering, University of Wisconsin – Madison, 1509 University Ave, Madison, WI 53706 (United States); Luo, Alan A. [Department of Materials Science and Engineering, University of Wisconsin – Madison, 1509 University Ave, Madison, WI 53706 (United States); Department of Materials Science and Engineering, The Ohio State University, 116 W. 19th Ave, Columbus, OH 43210 (United States); Stone, Donald S. [Materials Science Program, University of Wisconsin – Madison, 1509 University Ave., Madison, WI 53706 (United States); Department of Materials Science and Engineering, University of Wisconsin – Madison, 1509 University Ave, Madison, WI 53706 (United States)
2015-11-15
The present research presents a series of investigations into phase identification and precipitation sequence in Mg-4Sm-1Zn-0.4Zr alloy, using differential scanning calorimetry (DSC), transmission electron microscopy (TEM) and high angle annular dark field scanning transmission electron microscopy (HAADF-STEM). The precipitation sequence is: super saturated solid solution (S.S.S.S) → solute atom clusters → γ″ → γ′ (→stacking faults) → γ. Structure of γ″ has been determined as an ordered hexagonal GP zone, a = 0.556 nm, c = 0.414 nm γ′ is composed of several γ″ layers. Kinetic studies show that quenched-in vacancies play an important role in the formation of solute clusters, while the growth of both precipitates are diffusion controlled. Analysis of microstructure evolution suggests that nucleation of γ′ happens near existing γ″ precipitates. - Highlights: • Precipitation sequence in a high-zinc magnesium-samarium-zinc-zirconium alloy has been identified. • Structures of metastable precipitates are modified directly with HAADF-STEM. • Kinetic calculations were performed to understand nucleation/growth mechanisms of these precipitates.
CARBAPENEM-RESISTANT ACINETOBACTER BAUMANII POSTOPERATIVE MENINGITIS
Laura Ghibu; Egidia Miftode; Olivia Dorneanu; Carmen Dorobat
2011-01-01
Acinetobacter baumannii is an opportunistic pathogen of increasing relevance in hospital infections during the last 15 years.This organism causes a wide range of infection .Extensive use of antibiotics within hospitals has contribute to the emergence of multidrug-resistent A.baumannii strains that exhibit resistance to a wide range of antibiotics ,including carbapenems.We report the case of an 37 years old man diagnosed with Acinetobacter multidrug-resistant post-neurosurgical meningitis with...
Metabolomic Profiling and Genomic Study of a Marine Sponge-Associated Streptomyces sp
Viegelmann, Christina; Margassery, Lekha Menon; Kennedy, Jonathan; Zhang, Tong; O’Brien, Ciarán; O’Gara, Fergal; Morrissey, John P.; Dobson, Alan D. W.; Edrada-Ebel, RuAngelie
2014-01-01
Metabolomics and genomics are two complementary platforms for analyzing an organism as they provide information on the phenotype and genotype, respectively. These two techniques were applied in the dereplication and identification of bioactive compounds from a Streptomyces sp. (SM8) isolated from the sponge Haliclona simulans from Irish waters. Streptomyces strain SM8 extracts showed antibacterial and antifungal activity. NMR analysis of the active fractions proved that hydroxylated saturated fatty acids were the major components present in the antibacterial fractions. Antimycin compounds were initially putatively identified in the antifungal fractions using LC-Orbitrap. Their presence was later confirmed by comparison to a standard. Genomic analysis of Streptomyces sp. SM8 revealed the presence of multiple secondary metabolism gene clusters, including a gene cluster for the biosynthesis of the antifungal antimycin family of compounds. The antimycin gene cluster of Streptomyces sp. SM8 was inactivated by disruption of the antimycin biosynthesis gene antC. Extracts from this mutant strain showed loss of antimycin production and significantly less antifungal activity than the wild-type strain. Three butenolides, 4,10-dihydroxy-10-methyl-dodec-2-en-1,4-olide (1), 4,11-dihydroxy-10-methyl-dodec-2-en-1,4-olide (2), and 4-hydroxy-10-methyl-11-oxo-dodec-2-en-1,4-olide (3) that had previously been reported from marine Streptomyces species were also isolated from SM8. Comparison of the extracts of Streptomyces strain SM8 and its host sponge, H. simulans, using LC-Orbitrap revealed the presence of metabolites common to both extracts, providing direct evidence linking sponge metabolites to a specific microbial symbiont. PMID:24893324
Metabolomic Profiling and Genomic Study of a Marine Sponge-Associated Streptomyces sp.
Directory of Open Access Journals (Sweden)
Christina Viegelmann
2014-06-01
Full Text Available Metabolomics and genomics are two complementary platforms for analyzing an organism as they provide information on the phenotype and genotype, respectively. These two techniques were applied in the dereplication and identification of bioactive compounds from a Streptomyces sp. (SM8 isolated from the sponge Haliclona simulans from Irish waters. Streptomyces strain SM8 extracts showed antibacterial and antifungal activity. NMR analysis of the active fractions proved that hydroxylated saturated fatty acids were the major components present in the antibacterial fractions. Antimycin compounds were initially putatively identified in the antifungal fractions using LC-Orbitrap. Their presence was later confirmed by comparison to a standard. Genomic analysis of Streptomyces sp. SM8 revealed the presence of multiple secondary metabolism gene clusters, including a gene cluster for the biosynthesis of the antifungal antimycin family of compounds. The antimycin gene cluster of Streptomyces sp. SM8 was inactivated by disruption of the antimycin biosynthesis gene antC. Extracts from this mutant strain showed loss of antimycin production and significantly less antifungal activity than the wild-type strain. Three butenolides, 4,10-dihydroxy-10-methyl-dodec-2-en-1,4-olide (1, 4,11-dihydroxy-10-methyl-dodec-2-en-1,4-olide (2, and 4-hydroxy-10-methyl-11-oxo-dodec-2-en-1,4-olide (3 that had previously been reported from marine Streptomyces species were also isolated from SM8. Comparison of the extracts of Streptomyces strain SM8 and its host sponge, H. simulans, using LC-Orbitrap revealed the presence of metabolites common to both extracts, providing direct evidence linking sponge metabolites to a specific microbial symbiont.
Evans, Scott R; Hujer, Andrea M; Jiang, Hongyu; Hill, Carol B; Hujer, Kristine M; Mediavilla, Jose R; Manca, Claudia; Tran, Thuy Tien T; Domitrovic, T Nicholas; Higgins, Paul G; Seifert, Harald; Kreiswirth, Barry N; Patel, Robin; Jacobs, Michael R; Chen, Liang; Sampath, Rangarajan; Hall, Thomas; Marzan, Christine; Fowler, Vance G; Chambers, Henry F; Bonomo, Robert A
2017-01-01
The widespread dissemination of carbapenem-resistant Acinetobacter spp. has created significant therapeutic challenges. At present, rapid molecular diagnostics (RMDs) that can identify this phenotype are not commercially available. Two RMD platforms, PCR combined with electrospray ionization mass spectrometry (PCR/ESI-MS) and molecular beacons (MB), for detecting genes conferring resistance/susceptibility to carbapenems in Acinetobacter spp. were evaluated. An archived collection of 200 clinical Acinetobacter sp. isolates was tested. Predictive values for susceptibility and resistance were estimated as a function of susceptibility prevalence and were based on the absence or presence of beta-lactamase (bla) NDM, VIM, IMP, KPC, and OXA carbapenemase genes (e.g., bla OXA-23 , bla OXA-24/40 , and bla OXA-58 found in this study) against the reference standard of MIC determinations. According to the interpretation of MICs, 49% (n = 98) of the isolates were carbapenem resistant (as defined by either resistance or intermediate resistance to imipenem). The susceptibility sensitivities (95% confidence interval [CI]) for imipenem were 82% (74%, 89%) and 92% (85%, 97%) for PCR/ESI-MS and MB, respectively. Resistance sensitivities (95% CI) for imipenem were 95% (88%, 98%) and 88% (80%, 94%) for PCR/ESI-MS and MB, respectively. PRIMERS III establishes that RMDs can discriminate between carbapenem resistance and susceptibility in Acinetobacter spp. In the context of a known prevalence of resistance, SPVs and RPVs can inform clinicians regarding the best choice for empiric antimicrobial therapy against this multidrug-resistant pathogen. Copyright © 2016 American Society for Microbiology.
Analysis of urine samples from metastatic bone cancer patients administered 153Sm-EDTMP
International Nuclear Information System (INIS)
Goeckeler, W.F.; Stoneburner, L.K.; Price, D.R.; Fordyce, W.A.
1993-01-01
153 Sm-EDTMP is currently undergoing clinical evaluation as a radiotherapeutic agent for the relief of pain associated with cancer metastatic to bone. These clinical studies have demonstrated biodistributions similar to those seen earlier in animals, namely, rapid clearance from blood, selective uptake in bone and in particular metastatic bone lesions. The radioactivity not deposited in bone is cleared through the kidneys into the urine. In this study, urine samples collected from 9 patients injected with 153 Sm-EDTMP underwent complexation analysis via Pharmacia SP-Sephadex C25 cation exchange chromatography. The results showed 96.9 ± 1.7% of the radioactivity in the urine to be present as a complex of 153 Sm. An HPLC method was developed and it was demonstrated that different complexes of 153 Sm could be separated. A non-radioactive analytical standard of the Sm-EDTMP chelate was synthesized, characterized and shown to have the same HPLC retention profile as the 153 -EDTMP drug product. HPLC analysis was performed on six urine samples and in each case a single radioactivity peak with an elution profile the same as that of a 153 Sm-EDTMP standard was observed. These results indicate that the 153 Sm-EDTMP chelate is excreted intact in the urine of patients. (Author)
[Community-acquired Acinetobacter pneumonia].
Bernasconi, E; Wüst, J; Speich, R; Flury, G; Krause, M
1993-08-21
We report the history of a 38-year-old male native of Sri Lanka admitted to the emergency ward because of chest pain and shortness of breath. On physical and radiographic examination a bilateral predominantly right-sided pneumonia was found. The patient was admitted to the medical ICU and an antibiotic regimen with amoxicillin/clavulanic acid and erythromycin was initiated. Shortly afterwards septic shock developed. The patient was intubated and received high doses of catecholamines. He died 30 hours after admission to the hospital. Cultures from sputum, tracheal aspirate and blood grew Acinetobacter baumanni. Acinetobacter is an ubiquitous gram-negative rod with coccobacillary appearance in clinical specimens, that may appear gram-positive due to poor discoloration on Gram-stain. It is a well known causative agent of nosocomial infections, particularly in intensive care units. Community-acquired pneumonias, however, are quite rare. Sporadic cases have been reported from the US, Papua-New Guinea and Australia. Interestingly, these pneumonias are fulminant and have a high mortality. Chronic obstructive lung disease, diabetes, and tobacco and alcohol consumption appear to be predisposing factors. Due to the rapid course and poor prognosis, prompt diagnosis and adequate antibiotic treatment are indicated. Antibiotics use for community-acquired pneumonias, such as amoxicillin/clavulanic acid or macrolides, are not sufficient. Appropriate antibiotics for the initial treatment of suspected Acinetobacter infections include imipenem and carboxy- and ureidopenicillins combined with an aminoglycoside.
Emerging Trend of Acinetobacter Nosocomial Infection in Northeast of Iran
Directory of Open Access Journals (Sweden)
Samaneh Saed
2015-10-01
Full Text Available Background: Acinetobacter spp. emerged as an opportunistic pathogen for hospital-acquired infections. Recently, increasing antibiotic resistance among Acinetobacter spp. has worsened the problem. The aim of this study was to investigate the emerging trend of infection due to Acinetobacter in Ghaem University Hospital, Mashhad during 2006-2012.Methods: The demographic data and information about redisposing factors was collected. Appropriate bacteriological samples were collected and Acinetobacter spp. was isolated. Antibiotics susceptibility pattern of these isolates againstdifferent antimicrobials agents was determined.Results: Results confirmed that Acinetobacter spp. cause 20.9% of nosocomial infection during this period. The trend of Acinetobacter nosocomial infection was increasing and patients with risk factors such as COPD, bronchectasia, diabetes mellitus were more prone to infection. There was significant association between these infections and invasive procedures such as catheterization, mechanical ventilation and broad-spectrum antibiotics usage. Conclusion: Understanding trends in causative organisms of nosocomial infection can help us to better define our infection control policy.
Infections caused by Acinetobacter species and their susceptibility to ...
African Journals Online (AJOL)
Thirty-seven (63%) and 17 (30%) of the Acinetobacter isolates were from wound infections and UTI respectively. All the infections were nosocomially acquired and were associated with compromised host immunity, defective body defence, surgery or urinary catheterization; with Acinetobacter baumannii being the ...
Acinetobacter Peritoneal Dialysis Peritonitis: A Changing Landscape over Time
Chao, Chia-Ter; Lee, Szu-Ying; Yang, Wei-Shun; Chen, Huei-Wen; Fang, Cheng-Chung; Yen, Chung-Jen; Chiang, Chih-Kang; Hung, Kuan-Yu; Huang, Jenq-Wen
2014-01-01
Background Acinetobacter species are assuming an increasingly important role in modern medicine, with their persistent presence in health-care settings and antibiotic resistance. However, clinical reports addressing this issue in patients with peritoneal dialysis (PD) peritonitis are rare. Methods All PD peritonitis episodes caused by Acinetobacter that occurred between 1985 and 2012 at a single centre were retrospectively reviewed. Clinical features, microbiological data, and outcomes were analysed, with stratifications based upon temporal periods (before and after 2000). Results Acinetobacter species were responsible for 26 PD peritonitis episodes (3.5% of all episodes) in 25 patients. A. baumannii was the most common pathogen (54%), followed by A. iwoffii (35%), with the former being predominant after 2000. Significantly more episodes resulted from breaks in exchange sterility after 2000, while those from exit site infections decreased (P = 0.01). The interval between the last and current peritonitis episodes lengthened significantly after 2000 (5 vs. 13.6 months; P = 0.05). All the isolates were susceptible to cefepime, fluoroquinolone, and aminoglycosides, with a low ceftazidime resistance rate (16%). Nearly half of the patients (46%) required hospitalisation for their Acinetobacter PD-associated peritonitis, and 27% required an antibiotic switch. The overall outcome was fair, with no mortality and a 12% technique failure rate, without obvious interval differences. Conclusions The temporal change in the microbiology and origin of Acinetobacter PD-associated peritonitis in our cohort suggested an important evolutional trend. Appropriate measures, including technique re-education and sterility maintenance, should be taken to decrease the Acinetobacter peritonitis incidence in PD patients. PMID:25314341
Acinetobacter peritoneal dialysis peritonitis: a changing landscape over time.
Directory of Open Access Journals (Sweden)
Chia-Ter Chao
Full Text Available Acinetobacter species are assuming an increasingly important role in modern medicine, with their persistent presence in health-care settings and antibiotic resistance. However, clinical reports addressing this issue in patients with peritoneal dialysis (PD peritonitis are rare.All PD peritonitis episodes caused by Acinetobacter that occurred between 1985 and 2012 at a single centre were retrospectively reviewed. Clinical features, microbiological data, and outcomes were analysed, with stratifications based upon temporal periods (before and after 2000.Acinetobacter species were responsible for 26 PD peritonitis episodes (3.5% of all episodes in 25 patients. A. baumannii was the most common pathogen (54%, followed by A. iwoffii (35%, with the former being predominant after 2000. Significantly more episodes resulted from breaks in exchange sterility after 2000, while those from exit site infections decreased (P = 0.01. The interval between the last and current peritonitis episodes lengthened significantly after 2000 (5 vs. 13.6 months; P = 0.05. All the isolates were susceptible to cefepime, fluoroquinolone, and aminoglycosides, with a low ceftazidime resistance rate (16%. Nearly half of the patients (46% required hospitalisation for their Acinetobacter PD-associated peritonitis, and 27% required an antibiotic switch. The overall outcome was fair, with no mortality and a 12% technique failure rate, without obvious interval differences.The temporal change in the microbiology and origin of Acinetobacter PD-associated peritonitis in our cohort suggested an important evolutional trend. Appropriate measures, including technique re-education and sterility maintenance, should be taken to decrease the Acinetobacter peritonitis incidence in PD patients.
Radiation damage in SmS, SmSsub(1-x)Psub(x) and SmB6
International Nuclear Information System (INIS)
Morillo, J.; Bordier, G.; de Novion, C.H.; Senateur, J.P.; Jun, J.
1984-08-01
Large conductivity increases under 21 K electron or neutron irradiations are observed in SmS and SmSsub(1-x)Psub(x). It is shown that they are related to Sm defects. A possible mechanism is 4f electron delocalization around radiation defects. In SmB 6 , the low temperature resistivity increase desappears under 21 K irradiation. The thermal stability of the defects is also investigated up to room temperature
Acinetobacter infections as an emerging threat in intensive care units
International Nuclear Information System (INIS)
Tahseen, U.; Talib, M.T.
2015-01-01
Nosocomial infections caused by Acinetobacter species (Spp.) is an emerging threat in health care setups especially intensive care units (ICU). The objective of this observational study was to determine the pattern of Acinetobacter infections and its association with length of stay in patients admitted to our medical ICU from January to August 2011. Methods: All patients above 16 years of age with stay of more than 48 hours were checked for any development of new infections not present or incubating at the time of admission. Nosocomial infections were documented in the light of clinical findings and lab results. Data was analysed using statistical software SPSS 15.0. Results: A total of 146 patients had a stay of at least 48 hours; frequency of nosocomial infection was 30.8% out of which 57.8% were Acinetobacter infections. Respiratory system was most commonly involved. Acinetobacter Spp showed high resistance (96.2%) to penicillins, cephalosporins and even extended spectrum antibiotics including carbepenems, quinolones and piperacillin plus tazobactam. Extended drug resistance was seen in 92.3% isolates; while we found high susceptibility to tigecycline (88.5%) and polymyxins (100%). Acinetobacter Spp. infected patients had mean length of stay (LOS) of 12.92 days when compared to patients with other nosocomial infections and no infection with mean LOS of 7.05 days (p=0.05) and 4.86 days (p=0.00) respectively. Conclusions: Acinetobacter Spp infections increase with longer duration of stay in ICU. Emergence of multi-drug and extended-drug resistant Acinetobacter Spp is alarming and overwhelming at this rate for already stretched out health system with its economic and health implications. (author)
Improved Triacylglycerol Production in Acinetobacter baylyi ADP1 by Metabolic Engineering
Directory of Open Access Journals (Sweden)
Karp Matti
2011-05-01
Full Text Available Abstract Background Triacylglycerols are used in various purposes including food applications, cosmetics, oleochemicals and biofuels. Currently the main sources for triacylglycerol are vegetable oils, and microbial triacylglycerol has been suggested as an alternative for these. Due to the low production rates and yields of microbial processes, the role of metabolic engineering has become more significant. As a robust model organism for genetic and metabolic studies, and for the natural capability to produce triacylglycerol, Acinetobacter baylyi ADP1 serves as an excellent organism for modelling the effects of metabolic engineering for energy molecule biosynthesis. Results Beneficial gene deletions regarding triacylglycerol production were screened by computational means exploiting the metabolic model of ADP1. Four deletions, acr1, poxB, dgkA, and a triacylglycerol lipase were chosen to be studied experimentally both separately and concurrently by constructing a knock-out strain (MT with three of the deletions. Improvements in triacylglycerol production were observed: the strain MT produced 5.6 fold more triacylglycerol (mg/g cell dry weight compared to the wild type strain, and the proportion of triacylglycerol in total lipids was increased by 8-fold. Conclusions In silico predictions of beneficial gene deletions were verified experimentally. The chosen single and multiple gene deletions affected beneficially the natural triacylglycerol metabolism of A. baylyi ADP1. This study demonstrates the importance of single gene deletions in triacylglycerol metabolism, and proposes Acinetobacter sp. ADP1 as a model system for bioenergetic studies regarding metabolic engineering.
Directory of Open Access Journals (Sweden)
P. Gururaj
Full Text Available ABSTRACT The purpose of this study was to isolate, purify and optimize the production conditions of an organic solvent tolerant and thermostable lipase from Acinetobacter sp. AU07 isolated from distillery waste. The lipase production was optimized by response surface methodology, and a maximum production of 14.5 U/mL was observed at 30 ºC and pH 7, using a 0.5% (v/v inoculum, 2% (v/v castor oil (inducer, and agitation 150 rpm. The optimized conditions from the shake flask experiments were validated in a 3 L lab scale bioreactor, and the lipase production increased to 48 U/mL. The enzyme was purified by ammonium sulfate precipitation and ion exchange chromatography and the overall yield was 36%. SDS-PAGE indicated a molecular weight of 45 kDa for the purified protein, and Matrix assisted laser desorption/ionization time of flight analysis of the purified lipase showed sequence similarity with GDSL family of lipases. The optimum temperature and pH for activity of the enzyme was found to be 50 ºC and 8.0, respectively. The lipase was completely inhibited by phenylmethylsulfonyl fluoride but minimal inhibition was observed when incubated with ethylenediaminetetraacetic acid and dithiothreitol. The enzyme was stable in the presence of non-polar hydrophobic solvents. Detergents like SDS inhibited enzyme activity; however, there was minimal loss of enzyme activity when incubated with hydrogen peroxide, Tween 80 and Triton X-100. The kinetic constants (Km and Vmax revealed that the hydrolytic activity of the lipase was specific to moderate chain fatty acid esters. The Vmax, Km and Vmax/Km ratio of the enzyme were 16.98 U/mg, 0.51 mM, and 33.29, respectively when 4-nitrophenyl palmitate was used as a substrate.
Acinetobacter pneumonia: Is the outcome different from the pneumonias caused by other agents
Directory of Open Access Journals (Sweden)
Edis Ebru
2010-01-01
Full Text Available Background : The principal aim of the present study was to determine whether Acinetobacter spp. pneumonia differs from hospital-acquired pneumonias (HAPs caused by other agents with respect to therapeutic success and survival rate. METHODS : This study includes 140 adult patients diagnosed with HAPs caused by identified etiologic agents between March 2005 and February 2006. These patients were divided into two groups according to the agent responsible for their infection (Acinetobacter spp. [n = 63] or non-Acinetobacter spp. [n = 77]. The groups were compared in terms of risk factors, therapeutic success and six-week survival rates. Results : Previous antibiotic use and the risk of aspiration were independent factors responsible for the development of Acinetobacter spp. pneumonia. Hypoalbuminemia, steroid use and the use of a mechanical ventilator were determined to be mortality-associated independent risk factors for Acinetobacter spp. pneumonia. The clinical success rate at the end of therapy was 41.6% and, at the sixth week, the survival rate was 35% among patients in whom Acinetobacter spp. was the causative agent. Conversely, in the control group, these values were 43 and 32%, respectively ( P > 0.05. We found that the use of the appropriate antibiotics for the treatment of Acinetobacter spp. pneumonia was an important factor in survival ( P < 0.001. Conclusion : The outcomes of Acinetobacter spp. pneumonia do not differ from HAPs associated with non-Acinetobacter spp. in terms of therapeutic success and survival rates.
International Nuclear Information System (INIS)
Javed, A.; Zafar, A.; Ejaz, H.; Zubair, M.
2012-01-01
Objective: Acinetobacter species is a major nosocomial pathogen causing serious infections in immuno-compromised and hospitalized patients. The aim of this study was to determine the frequency and antimicrobial susceptibility pattern of Acinetobacter species in blood samples of paediatric patients. Methodology: This cross sectional observational study was conducted during January to October, 2011 at The Children's Hospital and Institute of Child Health, Lahore. A total number of 12,032 blood samples were analysed during the study period. Acinetobacter species were Bauer disc diffusion method. Results: The blood cultures showed growth in 1,141 cultures out of which 46 (4.0%) were Acinetobacter species. The gender distribution of Acinetobacter species was 29 (63.0%) in males and 17 (37.0%) in females. A good antimicrobial susceptibility pattern of Acinetobacter species was seen with sulbactam-cefoperazone (93.0%), imepenem and meropenem (82.6% (30.4%) was poor. Conclusion: The results of the present study shows high rate of resistance of Acinetobacter species with cephalosporins in nosocomial infections. The sulbactam-cefoperazone, carbapenems and piperacillin-tazobactam showed effective antimicrobial susceptibility against Acinetobacter species. (author)
Isolation of biosurfactant-producing marine bacteria and characteristics of selected biosurfactant
Directory of Open Access Journals (Sweden)
Kulnaree Phetrong
2007-05-01
Full Text Available Biosurfactant-producing marine bacteria were isolated from oil-spilled seawater collected from harbors and docks in Songkhla Province, Thailand. Haemolytic activity, emulsification activity toward nhexadecane,emulsion of weathered crude oil, drop collapsing test as well as oil displacement test were used to determine biosurfactant producing activity of marine bacteria. Among two-hundred different strains, 40strains exhibited clear zone on blood agar plates. Only eight strains had haemolytic activity and were able to emulsify weathered crude oil in marine broth during cultivation. Eight strains named SM1-SM8 wereidentified by 16S rRNA as Myroides sp. (SM1; Vibrio paraheamolyticus (SM2; Bacillus subtilis (SM3; Micrococcus luteus (SM4; Acinetobacter anitratus (SM6; Vibrio paraheamolyticus (SM7 and Bacilluspumilus (SM8. However, SM5 could not be identified. Strain SM1 showed the highest emulsification activity against weathered crude oil, by which the oil was emulsified within 24 h of cultivation. In addition, strainSM1 exhibited the highest activity for oil displacement test and emulsification test toward n-hexadecane. The emulsification activity against n-hexadecane of crude extract of strain SM1 was stable over a broadrange of temperature (30-121oC, pH (5-12 and salt concentration (0-9% NaCl, whereas CaCl2 showed an adverse effect on emulsifying activity.
Bansal, Narottam P.; Wise, Brent
2011-01-01
Nanopowders of La(0.6)Sr(0.4)CoO(3-x) (LSC) and Sm(0.5)Sr(0.5)CoO(3-x) (SSC) compositions, which are being investigated as cathode materials for intermediate temperature solid oxide fuel cells (IT-SOFC) with La(Sr)Ga(Mg)O(3-x) (LSGM) as the electrolyte, were synthesized by low-temperature sol-gel method using metal nitrates and citric acid. Thermal decomposition of the citrate gels was followed by simultaneous DSC/TGA methods. Development of phases in the gels, on heat treatments at various temperatures, was monitored by x-ray diffraction. Solgel powders calcined at 550 to 1000 C consisted of a number of phases. Single perovskite phase La(0.6)Sr(0.4)CoO(3-x) or Sm(0.5)Sr(0.5)CoO(3-x) powders were obtained at 1200 and 1300 C, respectively. Morphological analysis of the powders calcined at various temperatures was done by scanning electron microscopy. The average particle size of the powders was approx.15 nm after 700 C calcinations and slowly increased to 70 to 100 nm after heat treatments at 1300 to 1400 C.
Directory of Open Access Journals (Sweden)
Amit Ghati
2013-10-01
Full Text Available A thermophilic bacteria, Geobacillus sp. AGP-04, isolated from Surya Kund hot spring, Bakreshwar, West Bengal, India was studied in terms of capability of tributyrin hydrolysis and characterization of its thermostable esterase activity using p-nitrophenyl butyrate (PNPB as substrate. The extracellular crude preparation was characterized in terms of pH and temperature optima and stability, organic solvent tolerance capacity and stability, substrate specificity, surfactant tolerance capacity, kinetic parameters and activation/inhibition behavior towards some metal ions and chemicals. Tributyrin agar assay exhibited that Geobacillus sp. AGP-04 secretes an extracellular esterase. The Vmax and Km values of the esterase were found to be 5099 U/Land 103.5µM, respectively in the presence of PNPB as substrate. The optimum temperature and pH, for Geobacillus sp. AGP-04 esterase was 60oC and 8.0, respectively. Although the enzyme activity was not significantly altered by incubating crude extract solution at 20-70oC for 1 hour, the enzyme activity was fully lost at 90oC for same incubation period. The pH stability profile showed that original crude esterase activity is stable at a broad range (pH 5.0-10.0. Moreover, the enzyme was highly organic solvent and surfactant tolerant. The effect of some chemical on crude esterase activity indicated that Geobacillus sp. AGP-04 produce an esterase which contains a serine residue in active site and for its activity -SH groups are essential. Besides, enzyme production was highly induced if fermentation medium contain polysaccharides and oil as carbon source.
Energy Technology Data Exchange (ETDEWEB)
Gabay, A.M., E-mail: gabay@udel.edu; Hadjipanayis, G.C.
2017-01-15
Alloy synthesis consisting of mechanical activation followed by annealing was explored as a method of manufacturing medium-grade permanent magnet materials with a reduced content of the critical rare earth elements. Four R{sub x}Fe{sub 10}Si{sub 2} alloys with R=Sm, Sm{sub 0.7}Zr{sub 0.3}, Sm{sub 0.3}Ce{sub 0.3}Zr{sub 0.4} and Ce{sub 0.6}Zr{sub 0.4} (nominal compositions) were prepared from mixtures of Sm{sub 2}O{sub 3}, CeO{sub 2}, ZrO{sub 2}, Fe{sub 2}O{sub 3} and Si powders in the presence of a reducing agent Ca and a CaO dispersant. The collected alloy particles typically consisted of few joined submicron crystals. For R=Sm, X-ray diffraction analysis reveals a significant amount of the unwanted Th{sub 2}Zn{sub 17}-type compound forming alongside the desired ThMn{sub 12}-type 1:12 compound. A more pure 1:12 phase could be obtained for R=Ce{sub 0.6}Zr{sub 0.4}, but it exhibited a room-temperature coercivity of less than 1 kOe. The most pure 1:12 phase and the highest values of the coercivity (10.8 kOe) and calculated maximum energy product (13.8 MGOe) were obtained for R=Sm{sub 0.7}Zr{sub 0.3} processed at 1150 °C. The calculated maximum energy products of the Sm{sub 0.3}Ce{sub 0.3}Zr{sub 0.4}Fe{sub 10}Si{sub 2} particles, with half of their rare earths constituents represented by the relatively abundant Ce, was 10.1 MGOe. - Highlights: • 30% Zr substitution for Sm improves prospects of the alloys as permanent magnets. • Pure ThMn{sub 12}-type structure could only be obtained in the Zr-substituted alloys. • Obtained powders exhibit better properties than nanocrystalline Sm(Fe,M){sub 12} alloys. • If fully dense, alloy containing only 2.3 at% Sm would energy product of 10 MGOe.
Talaga, Katarzyna; Krzyściak, Paweł; Bulanda, Małgorzata
2016-01-01
Infections caused by Acinetobacter baumannii are difficult to cure due to the acquisition of resistance by these bacteria and lead to an increase in the general costs of hospitalization. The aim of this study was to determine tigecycline susceptibility of Acinetobacter baumannii strains isolated from intensive care unit and non-intensive care unit patients with skin and soft tissue infections. MICs were tested by Etest among 70 Acinetobacter baumannii isolates. The MIC range was from 0.5 to 8.0 mg L⁻¹. For ESBL-producing Acinetobacter baumannii, as well as for strains without carbapenemases, the highest MIC to tigecycline value was 8.0 mg L⁻¹. For AmpC-producing Acinetobacter baumannii, the highest MIC to tigecycline value was 6.0 mg L⁻¹ and, for MBL-producing strains, 2.0 mg L⁻¹. The majority of Acinetobacter baumannii strains isolated from ICU and non-ICU patients demonstrated high values of MIC range, MIC50 and MIC90 to tigecycline.
Clinical and antimicrobial profile of Acinetobacter spp.: An emerging nosocomial superbug
Directory of Open Access Journals (Sweden)
Purti C Tripathi
2014-01-01
Conclusion: Acinetobacter nosocomial infections resistant to most antimicrobials have emerged, especially in ICU. Early identification and continued surveillance of prevalent organism will help prevent the spread of Acinetobacter in hospital environment.
Analysis of drug resistance in 1,861 strains of Acinetobacter baumannii.
Jin, Hao; Qiu, Fan; Ji, Hong Jian; Lu, Qiang
2016-04-01
Acinetobacter baumannii is an emerging human pathogen that causes hospital-acquired infections. The trend in increased antimicrobial resistance limits the choice of effective antimicrobial agents. The present study reports the resistance to Acinetobacter baumannii and analyzes the associations between antibiotic use and resistance rates at a general hospital between 2010 and 2014. A total of 1,861 isolates were obtained from clinical cultures, accounting for 10.33% of all detected bacteria (1,861/18,016). The strains were mainly from respiratory samples (1,628 isolates, 87.5%) and the intensive care unit (696 isolates, 37.4%). The resistance rates of Acinetobacter baumannii to the majority of antibiotics were >50%, particularly the resistance rate to cefoperazone/sulbactam increased from 47.37 in 2011 to 89.25% in 2014. However, the rates of imipenem and cilastatin sodium decreased from 81.03 to 69.44% due to the antibiotic policy. There were Pearson significant associations between the use of three antibiotics and resistance in Acinetobacter baumannii to this drug, piperacillin/tazobactam (r=0.976, Ppolicies are essential to control the emergence of multidrug-resistance Acinetobacter baumannii .
Directory of Open Access Journals (Sweden)
Rosić Ivana
2013-01-01
Full Text Available Bacteria of the genus Acinetobacter, especially species Acinetobacter baumanii, is one of the most important causes of infection in immunocompromised patients in hospital. The aim of this study was to determine susceptibility of Acinetobacter species isolated from swabs of inflamed wounds to antibiotics. The study was conducted in several departments of the Clinical Centre 'Kragujevac' through retrospective analysis of 220 Acinetobacter species isolates from surgical wounds in 2011. The isolates of Acinetobaster species were mostly sensitive to ampicillin-sulbactam, colistin and tigecycline in all hospital departments that were surveyed. Only minority of the isolated Acinetobacter species were susceptible to cotrimoxazole, amikacin, imipenem and/or meropenem. Antibiotics with the highest in vitro efficacy against Acinetobacter species were ampicillinsulbactam, colistin and tigecycline. Highly resistant Acinetobacter species were more frequently isolated from patients in Intensive Care Unit.
NCBI nr-aa BLAST: CBRC-MDOM-08-0245 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-08-0245 ref|YP_045158.1| putative fimbrial usher protein [Acinetobacter s...p. ADP1] gb|AAS90700.1| AcuC [Acinetobacter sp. BD413] emb|CAG67336.1| protein AcuC; putative fimbrial usher protein [Acinetobacter sp. ADP1] YP_045158.1 0.47 32% ...
White-emission in single-phase Ba2Gd2Si4O13:Ce3 +,Eu2 +,Sm3 + phosphor for white-LEDs
Jiang, Xiumin; Zhang, Yuqian; Zhang, Jia
2018-03-01
To develop new white-light-emitting phosphor, a series of Ce3 +-Eu2 +-Sm3 + doped Ba2Gd2Si4O13 (BGS) phosphors were prepared by the solid-state reaction method, and their photoluminescence properties were studied. The Ce3 + and Eu2 + single-doped BGS show broad emission bands around in the region of 350-550 and 420-650 nm, respectively. By co-doping Ce3 +-Eu2 + into BGS, the energy transfer (ET) from Ce3 + to Eu2 + is inefficient, which could be due to the competitive absorption between the two activator ions. The Sm3 +-activated BGS exhibits an orangey-red emission in the region of 550-750 nm. To achieve white emission, the BGS:0.06Ce3 +,0.04Eu2 +,ySm3 + (0 ≤ y ≤ 0.18) phosphors were designed, in which the ET from Ce3 +/Eu2 + to Sm3 + was observed. The emission color can be tuned by controlling the Sm3 + concentration, and white emission was obtained in the BGS:0.06Ce3 +,0.04Eu2 +,0.06Sm3 + sample. The investigation of thermal luminescence stability for the typical BGS:0.06Ce3 +,0.04Eu2 +,0.06Sm3 + sample reveals that the emission intensities of both Eu2 + and Sm3 + demonstrate continuous decrease but the Ce3 + emission is enhanced gradually with increasing temperature. The corresponding reason has been discussed.
International Nuclear Information System (INIS)
Qureshi, Z.A.; Abbasi, S.A.; Mirza, I.A.; Malik, N.; Sattar, A.
2012-01-01
Objective: To find out antimicrobial susceptibility pattern of Acinetobacter species isolated from 1 January 2009 through 31 December 2009 at Department of Microbiology, Armed Forces Institute of Pathology Rawalpindi. Materials and Methods: A total of 276 isolates of Acinetobacter spp yielded from various clinical specimens during the study period were included Routine conventional methods were used to identify various species of Acinetobacter and modified Kirby-Bauer disk diffusion method was used for susceptibility testing. Out of total 276 isolates, 176 (63.8%) turned out to be Acinetobacter baumannii and 100 (36.2%) were Acinetobacter johnsonii. Overall sensitivity of Acinetobacter spp against piperacillin/sulbactam, tigecycline, sulbactam/cefoperazone, piperacillin/tazobactam, imipenem, doxycycline, ceftazidime, ciprofloxacin, chloramphenicol, trimethoprim /sulfamethoxazole, ampicillin, gentamycin, ceftriaxone, amoxicillin/clavulanic acid and ampicillin were 64%,63%, 48%, 47%, 41%,39%,35%, 34%, 32%, 31 %, 29%, 19%, 18% and 5% respectively. Out of 276 isolates, 181 (66 %) were multidrug resistant while 33 (18 %) isolates were pan-drug resistant. (author)
Phenotypic and genetic relationship of Acinetobacter Baumannii isolates.
Trajkovska-Dokic, E; Kotevska, V; Kaftandzieva, A; Jankoska, G; Mircevska, G; Petrovska, M; Panovski, N
2011-01-01
The interest in Acinetobacter continues to rise. One of the main reasons is the emergence of multi-resistant strains, which cause outbreaks of infection involving several patients in a ward, in the intensive care unit and in different areas of the hospital. Many outbreaks of its infection or colonization in surgical, neonatal and burn intensive care units have been reported, but the epidemiology of these infections remains unclear. To investigate the relationship among the isolates of Acinetobacter baumannii, comparing some of their phenotypic and genetic features. A total of 20 Acinetobacter baumanni isolates were included in the study. 12 strains of Acinetobacter baumannii were obtained within a week in July 2010, from neonates hospitalized at the paediatric intensive care unit and on the neonatal ward. Three strains were isolated from neonates at the paediatric intensive care unit three months ago. All the Acinetobacter baumannii strains were isolated from tracheal aspirates obtained from neonates with infection of the lower respiratory tract. Five additional Acinetobacter baumannii strains were included in the study as controls. They were isolated from wound swabs taken from adult patients with wound infection, hospitalized at the University Traumatology Clinic. Susceptibility of the bacterial strains to 13 different antimicrobial agents was determined by the disk diffusion method (Kirby-Bauer). Additional testing of the susceptibility was performed by the VITEK 2 system. RAPD-PCR fingerprinting was carried out using the following primer (5' GAAACAGCTATGACCATG -3'). All A. baumannii isolates were multi-drug resistant. Antibiotic susceptibility-testing by the disk-diffusion method and automated VITEK 2 system showed 3 and 2 antimicrobial susceptibility patterns, respectively. RAPD-PCR assay of A. baumannii strains revealed two different RAPD-fingerprints. All the strains of A. baumannii isolated within a week in July 2010 from tracheal aspirates taken from
Evaluation of Radioisotope Production Process of 153Sm and 153Sm-EDTMP Radiopharmaceuticals
International Nuclear Information System (INIS)
Kadarisman; Sri Hastini; Yayan Tahyan; Abidin; Dadang Hafid; Enny Lestari
2007-01-01
Experiments on the process of 153 Sm radioisotope and labeling of 153 Sm-EDTMP radiopharmaceuticals were carried out. This experiments included preparation of Sm 2 O 3 target, dissolution of post irradiation, determination of radioactivity concentration of 153 Sm radioisotope, radionuclide purity, EDTMP labeling, determination of radiochemical purity and pH. In these experiments the total radioactivity 153 Sm product is round about 2845.83 mCi to 36963.31 mCi, or with the radioactivity concentration between 474 mCi/ml to 6160.55 mCi/ml in the SmCl 3 solution form, each its volume is 6.0 ml, and the samarium content is 5.76 mg/ml, and the radionuclide purity of 153 Sm is 100 %. All of the 153 Sm- EDTMP radiopharmaceuticals product are fulfilled requirements the radioactivity concentration, Sm content, radiochemical purity and pH. The radioactivity concentration of 153 Sm-EDTMP radiopharmaceuticals is 37.50 mCi/ml (minimum) to 283.50 mCi/ml (highest). The pH 7.5 were 8 products, and the rest are pH 8.5. Radiochemical purity of 153 Sm-EDTMP are round about 90.00 % to 99.44 %. (author)
Commensal Staphylococcus spp., Acinetobacter spp. and ...
African Journals Online (AJOL)
ANTHONY
2012-07-31
Jul 31, 2012 ... Intermittent assessment of resistance genes in the ecosystem should be ..... among resistant Acinetobacter spp. isolated from integrated fish .... independent studies on the emerging phylogenetic view of bacterial .... Functional.
Clinical and Pathophysiological Overview of Acinetobacter Infections: a Century of Challenges
Nielsen, Travis B.; Bonomo, Robert A.; Pantapalangkoor, Paul; Luna, Brian; Spellberg, Brad
2016-01-01
SUMMARY Acinetobacter is a complex genus, and historically, there has been confusion about the existence of multiple species. The species commonly cause nosocomial infections, predominantly aspiration pneumonia and catheter-associated bacteremia, but can also cause soft tissue and urinary tract infections. Community-acquired infections by Acinetobacter spp. are increasingly reported. Transmission of Acinetobacter and subsequent disease is facilitated by the organism's environmental tenacity, resistance to desiccation, and evasion of host immunity. The virulence properties demonstrated by Acinetobacter spp. primarily stem from evasion of rapid clearance by the innate immune system, effectively enabling high bacterial density that triggers lipopolysaccharide (LPS)–Toll-like receptor 4 (TLR4)-mediated sepsis. Capsular polysaccharide is a critical virulence factor that enables immune evasion, while LPS triggers septic shock. However, the primary driver of clinical outcome is antibiotic resistance. Administration of initially effective therapy is key to improving survival, reducing 30-day mortality threefold. Regrettably, due to the high frequency of this organism having an extreme drug resistance (XDR) phenotype, early initiation of effective therapy is a major clinical challenge. Given its high rate of antibiotic resistance and abysmal outcomes (up to 70% mortality rate from infections caused by XDR strains in some case series), new preventative and therapeutic options for Acinetobacter spp. are desperately needed. PMID:27974412
Second opinion on Sejerøbugten and Smålandsfarvandet EIA’s and Appropriate Assessments
DEFF Research Database (Denmark)
Petersen, Ib Krag; Frederiksen, Morten
2015-01-01
VVM-er og Appropriate Assessments for havvindmølleparker i Sejerøbugten og Smålandsfarvandet blev offentliggjort tidligere i 2015. Rapporterne er revideret i november 2015. Energistyrelsen bad AU om at vurdere rapporternes kvalitet, hvilket er gennemført ved besvarelse af en række konkrete spørgs...
Directory of Open Access Journals (Sweden)
Inés Martín-Martín
2013-01-01
Full Text Available Sand fly salivary proteins are on the spotlight to become vaccine candidates against leishmaniasis and to markers of exposure to sand fly bites due to the host immune responses they elicit. Working with the whole salivary homogenate entails serious drawbacks such as the need for maintaining sand fly colonies and the laborious task of glands dissection. In order to overcome these difficulties, producing recombinant proteins of different vectors has become a major task. In this study, a cDNA library was constructed with the salivary glands of Phlebotomus perniciosus from Madrid, Spain, the most widespread vector of Leishmania infantum in the Mediterranean basin. Analysis of the cDNA sequences showed several polymorphisms among the previously described salivary transcripts. The apyrase SP01B and the D7-related protein SP04 were successfully cloned, expressed in Escherichia coli, and purified. Besides, recombinant proteins were recognized by sera of hamsters and mice previously immunized with saliva through the exposure to uninfected sand fly bites. These results suggest that these two recombinant proteins conserved their immunogenic properties after expression in a prokaryote system. Therefore, this work contributes to expand the knowledge of P. perniciosus saliva that would be eventually used for the development of tools for vector control programs.
The Antibacterial Activity Evaluation of the Nanoparticles of Silver on Acinetobacter Baumannii
Directory of Open Access Journals (Sweden)
Seyedeh Nasim Karimipour
2016-09-01
Full Text Available Background & Objective: Due to the high drug resistance in Acinetobacter baumannii, in this research, antibacterial properties of nano silver was evaluated for Acinetobacter baumannii. Materials & Methods: The nano silver with approximate diameter of 20 nanometer from Pishtazan Inc. Mashad, Iran and 5 nanometer from the Department of Chemistry in Maragheh University were prepared. Its concentration was determined by spectroscopy method in Tabriz Chemistry University. Antimicrobial effects were determined by Mean Inhibitory Concentration (MIC and Minimal Bacterial Concentration (MBC by micro-broth-dilution method, disc diffusion and well diffusion methods. Anti-bacterial activity of nano-silver was tested for Acinetobacter baumannii NCTC12516 on 20 clinical strains (collected from Imam Reza Hospital in Tabriz. Results: The results showed the MIC and MBC of 20nm nanoparticles were 1250 ppm and 2500 ppm, respectively. On the other hand, the MIC and MBC of 5 nm nanoparticles were 156 ppm and 312 ppm, respectively. According to these findings, the MIC and MBC identified for clinical Acinetobacter baumannii strains under study along with the NCTC12516 strain did not show a significant difference. Yet the amount of inhibition for the 20nm nanoparticles in the density of 20000 ppm of clinical Acinetobacter baumannii and NCTC12516 strains was 11 millimeter with the disc diffusion method and 9.5 millimeter for the well diffusion method with the same concentration. The amount of inhibition of 5nm nanoparticles in the 250-ppm concentration with both disc diffusion and well diffusion methods was 9.5 millimeter. Conclusions: Acinetobacter baumannii is susceptible to nano-silver. Also the same MIC and MBC in multiple clinical strains suggests that there is not resistance to silver nanoparticles in Acinetobacter baumannii
Acinetobacter: environmental and biotechnological applications ...
African Journals Online (AJOL)
Among microbial communities involved in different ecosystems such as soil, freshwater, wastewater and solid wastes, several strains belonging to the genus of Acinetobacter have been attracting growing interest from medical, environmental and a biotechnological point of view. Bacteria of this genus are known to be ...
Jung, Jaejoon; Park, Woojun
2015-03-01
Acinetobacter occupies an important position in nature because of its ubiquitous presence in diverse environments such as soils, fresh water, oceans, sediments, and contaminated sites. Versatile metabolic characteristics allow species of this genus to catabolize a wide range of natural compounds, implying active participation in the nutrient cycle in the ecosystem. On the other hand, multi-drug-resistant Acinetobacter baumannii causing nosocomial infections with high mortality has been raising serious concerns in medicine. Due to the ecological and clinical importance of the genus, Acinetobacter was proposed as a model microorganism for environmental microbiological studies, pathogenicity tests, and industrial production of chemicals. For these reasons, Acinetobacter has attracted significant attention in scientific and biotechnological fields, but only limited research areas such as natural transformation and aromatic compound degradation have been intensively investigated, while important physiological characteristics including quorum sensing, motility, and stress response have been neglected. The aim of this review is to summarize the recent achievements in Acinetobacter research with a special focus on strain DR1 and to compare the similarities and differences between species or other genera. Research areas that require more attention in future research are also suggested.
Directory of Open Access Journals (Sweden)
Rapenne L.
2012-06-01
Full Text Available Different multifunctional (PbTiO3, Sm0.6Nd0.4NiO3, NdMnO3 thin films were grown by metalorganic chemical vapor deposition (MOCVD technique on SrTiO3 and LaAlO3 substrates. TEM and X-ray diffraction measurements reveal that almost single crystalline thin films can be epitaxially grown on the top of substrates. The relationship between the crystallographic orientation of the films and those of the substrates were determined by reciprocal space mapping and TEM analyses. PbTi03 thin films appear to be under tensile or compressive strain according to the different mismatch of their cell parameter with those of the substrate. Relaxation mechanism as a function of the film thickness arises from coexistence of different type of domains and size and strain effect are analyzed. SmNiO3 thin films present diffuse scattering strikes and are less well organized when compared to PbTi03 thin films. Different domains are observed as well as an additional parasitic phase close to NiO. Its regular distribution can be associated to reduced transport properties. Preliminary observations on NdMnO3 thin films show that an amorphous phase is obtained during MOCVD that can be transformed in a single crystalline film by annealing. The films are under tensile or compressive strain according to the different mismatch of their cell parameter with those of the substrate. Magnetic properties are investigated.
Energy Technology Data Exchange (ETDEWEB)
Krichene, A., E-mail: akramkri@hotmail.fr [Laboratoire de Physique des Matériaux, Faculté des Sciences de Sfax, Université de Sfax, B. P. 1171, 3000 Sfax (Tunisia); Solanki, P.S. [Department of Physics, Saurashtra University, Rajkot 360005 (India); Venkateshwarlu, D. [UGC-DAE Consortium for Scientific Research, University Campus, Khandwa Road, Indore 452017 (India); Rayaprol, S. [UGC-DAE Consortium for Scientific Research, Mumbai Centre, B.A.R.C. Campus, Mumbai 400085 (India); Ganesan, V. [UGC-DAE Consortium for Scientific Research, University Campus, Khandwa Road, Indore 452017 (India); Boujelben, W. [Laboratoire de Physique des Matériaux, Faculté des Sciences de Sfax, Université de Sfax, B. P. 1171, 3000 Sfax (Tunisia); Kuberkar, D.G. [Department of Physics, Saurashtra University, Rajkot 360005 (India)
2015-05-01
We have reported in this work the effect of the partial substitution of lanthanum by samarium on the structural, electrical and magnetic properties of La{sub 0.5}Ca{sub 0.5}MnO{sub 3}. The magnetic study indicated that substitution promotes charge ordering and weakens ferromagnetism. Below T{sub C}=123 K, the compound La{sub 0.4}Sm{sub 0.1}Ca{sub 0.5}MnO{sub 3} is a mixture of ferromagnetic and charge ordered antiferromagnetic domains. Between T{sub C} and T{sub CO}=215 K, the structure is paramagnetic with the presence of antiferromagnetic domains. The fractions of the coexisting magnetic phases are highly dependent on the applied magnetic field value. Resistivity measurements reveal the presence of an insulating-metal transition at T{sub ρ}=123 K. The equality between T{sub C} and T{sub ρ} indicates the presence of a correlation between magnetization and resistivity. For only 1 T applied field, we have reported a colossal value of magnetoresistance reaching 73% around T{sub C}. The origin of this high value is attributed to phase separation phenomenon. - Highlights: • Sm doping enhances charge ordering and weakens ferromagnetism in La{sub 0.5}Ca{sub 0.5}MnO{sub 3.} • Colossal magnetoresistance (73%) is recorded at 123 K for only 1 T applied field. • Phase separation is responsible for the magnetic and the magnetoresistive behavior.
Directory of Open Access Journals (Sweden)
Geraldine Asencio
2014-01-01
Conclusions: The ethanolic extract of Janthinobacterium sp. SMN 33.6 possesses antibacterial activity against a chromosomal AmpC beta-lactamase-producing strain of Serratia marcescens, an extended-spectrum beta-lactamase-producing Escherichia coli and also against carbapenemase-producing strains of Acinetobacter baumannii and Pseudomonas aeruginosa. This becomes a potential and interesting biotechnological tool for the control of bacteria with multi-resistance to commonly used antibiotics.
Fujikura, Yuji; Yuki, Atsushi; Hamamoto, Takaaki; Kawana, Akihiko; Ohkusu, Kiyofumi; Matsumoto, Tetsuya
2016-06-01
Acinetobacter calcoaceticus-Acinetobacter baumannii complex, especially A. baumannii, Acinetobacter pittii and Acinetobacter nosocomialis, constitutes an important group of nosocomial pathogens; however, epidemiological or clinical characteristics and prognosis is limited in Japan. From 2009 to 2013, 47 blood stream infection cases resulting from A. baumannii group were reviewed at the National Defense Medical College, an 800-bed tertiary hospital. To determine the genospecies, further comparative nucleotide sequence analyses of the RNA polymerase b-subunit (rpoB) gene were performed. Sequence analysis of rpoB gene showed that 25 (49.0%), 17 (33.3%) and 5 (9.8%) cases were caused by A. baumannii, A. pittii and A. nosocomialis, respectively. The 30-day and in-hospital mortality rates of A. baumannii were 8.5% and 25.5%, respectively, and there were no significant differences between Acinetobacter species. Clinical characteristics were statistically insignificant. Multidrug-resistant Acinetobacter species were detected in 3 cases (5.9%) with same pulsed-field gel electrophoresis (PFGE) pattern and A. baumannii was less susceptible to amikacin and levofloxacin. In this study, the mortality and clinical characteristics were similar among A. baumannii group isolate cases despite some showing drug resistance. However, identification of Acinetobacter species helps to initiate appropriate antibiotic therapy in earlier treatment phase, because A. baumannii shows some drug resistance. Copyright © 2016 Japanese Society of Chemotherapy and The Japanese Association for Infectious Diseases. Published by Elsevier Ltd. All rights reserved.
NCBI nr-aa BLAST: CBRC-DSIM-04-0090 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-04-0090 ref|YP_922866.1| putative ABC antibiotics transporter [Nocardioid...es sp. JS614] gb|ABL81179.1| putative ABC antibiotics transporter [Nocardioides sp. JS614] YP_922866.1 0.003 31% ...
NCBI nr-aa BLAST: CBRC-DDIS-04-0000 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DDIS-04-0000 ref|ZP_01914927.1| ABC transporter-related protein [Limnobacter s...p. MED105] gb|EDM83812.1| ABC transporter-related protein [Limnobacter sp. MED105] ZP_01914927.1 5e-69 37% ...
NCBI nr-aa BLAST: CBRC-GGAL-04-0030 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-04-0030 ref|ZP_01752079.1| hypothetical protein RCCS2_01059 [Roseobacter ...sp. CCS2] gb|EBA11027.1| hypothetical protein RCCS2_01059 [Roseobacter sp. CCS2] ZP_01752079.1 3.9 32% ...
NCBI nr-aa BLAST: CBRC-DYAK-04-0055 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DYAK-04-0055 ref|YP_001278453.1| hypothetical protein RoseRS_4159 [Roseiflexus... sp. RS-1] gb|ABQ92503.1| hypothetical protein RoseRS_4159 [Roseiflexus sp. RS-1] YP_001278453.1 2.8 45% ...
NCBI nr-aa BLAST: CBRC-DYAK-04-0016 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DYAK-04-0016 ref|ZP_01444684.1| hypothetical protein R2601_22801 [Roseovarius ...sp. HTCC2601] gb|EAU45065.1| hypothetical protein R2601_22801 [Roseovarius sp. HTCC2601] ZP_01444684.1 0.010 30% ...
Šedo, Ondrej; Nemec, Alexandr; Křížová, Lenka; Kačalová, Magdaléna; Zdráhal, Zbyněk
2013-12-01
MALDI-TOF MS is currently becoming the method of choice for rapid identification of bacterial species in routine diagnostics. Yet, this method suffers from the inability to differentiate reliably between some closely related bacterial species including those of the Acinetobacter calcoaceticus-Acinetobacter baumannii (ACB) complex, namely A. baumannii and Acinetobacter nosocomialis. In the present study, we evaluated a protocol which was different from that used in the Bruker Daltonics identification system (MALDI BioTyper) to improve species identification using a taxonomically precisely defined set of 105 strains representing the four validly named species of the ACB complex. The novel protocol is based on the change in matrix composition from alpha-cyano-4-hydroxycinnamic acid (saturated solution in water:acetonitrile:trifluoroacetic acid, 47.5:50:2.5, v/v) to ferulic acid (12.5mgml(-1) solution in water:acetonitrile:formic acid 50:33:17, v/v), while the other steps of sample processing remain unchanged. Compared to the standard protocol, the novel one extended the range of detected compounds towards higher molecular weight, produced signals with better mass resolution, and allowed the detection of species-specific signals. As a result, differentiation of A. nosocomialis and A. baumannii strains by cluster analysis was improved and 13 A. nosocomialis strains, assigned erroneously or ambiguously by using the standard protocol, were correctly identified. Copyright © 2013 Elsevier GmbH. All rights reserved.
Distinguishing a SM-like MSSM Higgs boson from SM Higgs boson ...
Indian Academy of Sciences (India)
We explore the possibility of distinguishing the SM-like MSSM Higgs boson from the SM Higgs boson via Higgs boson pair production at future muon collider. We study the behavior of the production cross-section in SM and MSSM with Higgs boson mass for various MSSM parameters tan and A. We observe that at fixed ...
Energy Technology Data Exchange (ETDEWEB)
Kinoshita, N. [Tandem Accelerator Complex, Research Facility Center for Science and Technology, University of Tsukuba (Japan); Paul, M., E-mail: paul@vms.huji.ac.il [Racah Institute of Physics, Hebrew University, Jerusalem 91904 (Israel); Alcorta, M. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Bowers, M.; Collon, P. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556-5670 (United States); Deibel, C.M. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Joint Institute for Nuclear Astrophysics, Michigan State University, East Lansing, MI 46624 (United States); DiGiovine, B. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Goriely, S. [Universite Libre de Bruxelles, CP-226, Brussels 1050 (Belgium); Greene, J.P.; Henderson, D.J.; Jiang, C.L. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Kashiv, Y. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556-5670 (United States); Kay, B.P.; Lee, H.Y.; Marley, S.T. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Nakanishi, T. [Faculty of Chemistry, Institute of Science and Engineering, Kanazawa University (Japan); Pardo, R.C.; Patel, N.; Rehm, K.E. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Robertson, D. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556-5670 (United States); and others
2013-01-15
The extinct p-process nuclide {sup 146}Sm (t{sub 1/2} = 103 {+-} 5 Myr) is known to have been present in the Early-Solar System and has been proposed as an astrophysical chronometer. {sup 146}Sm is also intensely used to date meteorite and planetary differentiation processes, enhancing the importance of an accurate knowledge of the {sup 146}Sm half-life. We are engaged in a new determination of the {sup 146}Sm half-life in which the {sup 146}Sm/{sup 147}Sm atom ratio is determined by accelerator mass spectrometry at the ATLAS facility of Argonne National Laboratory. In order to reduce systematic errors in the AMS determination of the {sup 146}Sm/{sup 147}Sm ratios (in the range of 10{sup -7}-10{sup -9}), {sup 146}Sm and {sup 147}Sm ions were alternately counted in the same detector in the focal plane of a gas-filled magnet, respectively in continuous-wave and attenuated mode. Quantitative attenuation is obtained with the 12 MHz pulsed and ns-bunched ATLAS beam by chopping beam pulses with an RF sweeper in a ratio (digitally determined) down to 1:10{sup 6}. The experiments and preliminary results are discussed.
Li, Xiuyuan; Tang, Yanyan; Lu, Xinxin
2018-04-01
Currently, the capability of identification for Acinetobacter species using MALDI-TOF MS still remains unclear in clinical laboratories due to certain elusory phenomena. Thus, we conducted this research to evaluate this technique and reveal the causes of misidentification. Briefly, a total of 788 Acinetobacter strains were collected and confirmed at the species level by 16S rDNA and rpoB sequencing, and subsequently compared to the identification by MALDI-TOF MS using direct smear and bacterial extraction pretreatments. Cluster analysis was performed based on the mass spectra and 16S rDNA to reflect the diversity among different species. Eventually, 19 Acinetobacter species were confirmed, including 6 species unavailable in Biotyper 3.0 database. Another novel species was observed, temporarily named A. corallinus. The accuracy of identification for Acinetobacter species using MALDI-TOF MS was 97.08% (765/788), regardless of which pretreatment was applied. The misidentification only occurred on 3 A. parvus strains and 20 strains of species unavailable in the database. The proportions of strains with identification score ≥ 2.000 using direct smear and bacterial extraction pretreatments were 86.04% (678/788) and 95.43% (752/788), χ 2 = 41.336, P clinical samples was deemed reliable. Misidentification occurred occasionally due to the insufficiency of the database rather than sample extraction failure. We suggest gene sequencing should be performed when the identification score is under 2.000 even when using bacterial extraction pretreatment. [Figure not available: see fulltext.
Effect of multipurpose solutions against Acinetobacter carrying QAC genes.
Boost, Maureen V; Chan, Jessica; Shi, Guang-sen; Cho, Pauline
2014-03-01
Acinetobacter has low virulence but causes infections in subjects with reduced immunity. It has been reported in ocular infections including those of patients using contact lenses. Treatment is difficult because Acinetobacter is frequently multidrug resistant. Antibiotic-resistant strains frequently also harbor genes for antiseptic resistance (quaternary ammonium compound [QAC]) genes. Because Acinetobacter is part of the normal flora, it may contaminate contact lens and accessories. This study aims to investigate carriage rates of QAC genes in household and clinical isolates of Acinetobacter and to determine the effectiveness of two multipurpose solutions (MPSs) for soft lenses against organisms carrying QAC genes. DNA was extracted from 11 bathroom isolates and 15 clinical isolates and amplified by polymerase chain reaction to determine the presence of qacEΔ1. Gene-positive and gene-negative control strains were used to challenge the two MPSs, and minimum inhibitory concentrations (MICs) of these organisms to benzalkonium chloride and chlorhexidine gluconate were determined. More than 90% of isolates carried qacEΔ1. The MICs of clinical isolates were higher than those of isolates of bathrooms. Both MPSs were able to produce a 3-log reduction in the numbers of all isolates. Although most isolates carried qacEΔ1 and elevated MICs to benzalkonium chloride and chlorhexidine gluconate were observed, all were susceptible to both MPSs tested. However, if there were to be poor compliance with care procedures, it is probable that such organisms could survive in the presence of diluted or expired solutions.
Variation in the complex carbohydrate biosynthesis loci of Acinetobacter baumannii genomes.
Directory of Open Access Journals (Sweden)
Johanna J Kenyon
Full Text Available Extracellular polysaccharides are major immunogenic components of the bacterial cell envelope. However, little is known about their biosynthesis in the genus Acinetobacter, which includes A. baumannii, an important nosocomial pathogen. Whether Acinetobacter sp. produce a capsule or a lipopolysaccharide carrying an O antigen or both is not resolved. To explore these issues, genes involved in the synthesis of complex polysaccharides were located in 10 complete A. baumannii genome sequences, and the function of each of their products was predicted via comparison to enzymes with a known function. The absence of a gene encoding a WaaL ligase, required to link the carbohydrate polymer to the lipid A-core oligosaccharide (lipooligosaccharide forming lipopolysaccharide, suggests that only a capsule is produced. Nine distinct arrangements of a large capsule biosynthesis locus, designated KL1 to KL9, were found in the genomes. Three forms of a second, smaller variable locus, likely to be required for synthesis of the outer core of the lipid A-core moiety, were designated OCL1 to OCL3 and also annotated. Each K locus includes genes for capsule export as well as genes for synthesis of activated sugar precursors, and for glycosyltransfer, glycan modification and oligosaccharide repeat-unit processing. The K loci all include the export genes at one end and genes for synthesis of common sugar precursors at the other, with a highly variable region that includes the remaining genes in between. Five different capsule loci, KL2, KL6, KL7, KL8 and KL9 were detected in multiply antibiotic resistant isolates belonging to global clone 2, and two other loci, KL1 and KL4, in global clone 1. This indicates that this region is being substituted repeatedly in multiply antibiotic resistant isolates from these clones.
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
An interesting finding of our study was recovery of large number of Acinetobacter sp. consisting of Acinetobacter pittii (former Acinetobacter genomic species 3), Acinetobacter junii and Acinetobacter baumannii in the VB infants clone library. Among these, Acinetobacter baumannii is a known nosocomial pathogen and ...
Dancer, Peter L; Kleinplatz, Peggy J; Moser, Charles
2006-01-01
This study describes the nature of 24/7 SM slavery as practiced within the SM (sadomasochistic) community. These SM participants, who attempt to live full-time in owner-slave roles, represent a small proportion of those with SM interests. SM slaves have not been studied systematically to determine if and how they differ from other SM practitioners. An online questionnaire was used to obtain responses from individuals who self-identified as slaves. A total of 146 respondents participated, 53% female and 47% male, ranging in age from 18 to 72. We explored the depth of their relationships, how well they approximated "slavery," and how their relationships were structured to maintain distinct roles. Data showed that in long-term SM slave relationships, a power differential exists which extends beyond time-limited SM or sexual interactions. Owners and slaves often use common, daily life experiences or situations, such as the completion of household chores, money management, and morning or evening routines, to distinguish and maintain their respective roles. In addition, contrary to the perception of total submission, results revealed that slaves exercise free will when it is in their best interests to do so. These relationships were long-lasting and satisfying to the respondents.
Kulkarni, Sughosh S; Madalgi, Radhika; Ajantha, Ganavalli S; Kulkarni, Raghavendra D
2017-01-01
Acinetobacter is grouped under nonfermenting Gram-negative bacilli. It is increasingly isolated from pathological samples. The ability of this genus to acquire drug resistance and spread in the hospital settings is posing a grave problem in healthcare. Specific treatment protocols are advocated for Acinetobacter infections. Hence, rapid identification and drug susceptibility profiling are critical in the management of these infections. To standardize an in-house polymerase chain reaction (PCR) for identification of genus Acinetobacter and to compare PCR with two protocols for its phenotypic identification. A total of 96 clinical isolates of Acinetobacter were included in the study. An in-house PCR for genus level identification of Acinetobacter was standardized. All the isolates were phenotypically identified by two protocols. The results of PCR and phenotypic identification protocols were compared. The in-house PCR standardized was highly sensitive and specific for the genus Acinetobacter . There was 100% agreement between the phenotypic and molecular identification of the genus. The preliminary identification tests routinely used in clinical laboratories were also in complete agreement with phenotypic and molecular identification. The in-house PCR for genus level identification is specific and sensitive. However, it may not be essential for routine identification as the preliminary phenotypic identification tests used in the clinical laboratory reliably identify the genus Acinetobacter .
Directory of Open Access Journals (Sweden)
Azizun Nahar
2012-01-01
Full Text Available Acinetobacter species are aerobic Gram variable coccobacilli that are now emerging as an important nosocomial pathogen. Infections caused by them are difficult to control due to multidrug resistance. The purpose of this study was to detect virulence factors namely gelatinase production, biofilm formation and antibiotic susceptibility of Acinetobacter species. Two hundred fifty six clinical samples collected from Bangabandhu Sheikh Mujib medical University (BSMMU and from burn unit of Dhaka Medical College Hospital were included in the study. Gelatinase production was seen on Luria Bertani agar media containing gelatin (30 gm/l and biofilm formation was detected in microtiter plate assay. Out of 256 clinical samples, 52 (20.3% were Acinetobacter species. Out of 52 Acinetobacter isolates, none were gelatinase producer but 39 (75% were found biofilm producers. Acinetobacter isolates were 100% resistant to ceftazidime, cefotaxime cefuroxime and ceftriaxone. High level of resistance was also recorded for amoxicillin (98.1%, aztreonam (98.1%, gentamicin (90.4%, ciprofloxacin (73.1%, amikacin (57.6%, netilmicin (53.8% and imipenem (44.2%. Susceptibility to colistin was maximum (96.2%. The present study demonstrated a high propensity of biofilm formation by the clinical isolates of Acinetobacter species and most of the Acinetobacter were multidrug resistant. Ibrahim Med. Coll. J. 2012; 6(1: 27-30
Directory of Open Access Journals (Sweden)
Esam Bakeir
2008-01-01
Full Text Available The photochromism of [7′-hydroxy-8′-formyl-3-methyl-4-oxospiro[1,3-benzoxazin-2,2′-[2H-1]benzopyran],SP(I,[7′-hydroxy-8′-formyl-3-benzyl-4-oxospiro[1,3-benzoxazin-2,2′-[2H-1]benzopyran] SP(II and their coordination with Tb3+and Sm3+ ions have been studied in DMF. UV/vis induced-color development due to heterolytic bond cleavage of SP(I and SP(II is greatly influenced by complexation with the lanthanide ions. The irradiation-induced color enhancement due to ring opening and thermal decoloration of the open forms of SP(I, SP(II follows first-order kinetics. Physical characteristics of the studied systems such as colorability and relaxation time of thermal bleaching parameters were determined. Moreover, light-energy transfer-induced luminescence of lanthanide ions via coordination with the two spirobenzoxazines was monitored.
Sahl, Jason W.; Gillece, John D.; Schupp, James M.; Waddell, Victor G.; Driebe, Elizabeth M.; Engelthaler, David M.; Keim, Paul
2013-01-01
Acinetobacter baumannii is an emergent and global nosocomial pathogen. In addition to A. baumannii, other Acinetobacter species, especially those in the Acinetobacter calcoaceticus-baumannii (Acb) complex, have also been associated with serious human infection. Although mechanisms of attachment, persistence on abiotic surfaces, and pathogenesis in A. baumannii have been identified, the genetic mechanisms that explain the emergence of A. baumannii as the most widespread and virulent Acinetobacter species are not fully understood. Recent whole genome sequencing has provided insight into the phylogenetic structure of the genus Acinetobacter. However, a global comparison of genomic features between Acinetobacter spp. has not been described in the literature. In this study, 136 Acinetobacter genomes, including 67 sequenced in this study, were compared to identify the acquisition and loss of genes in the expansion of the Acinetobacter genus. A whole genome phylogeny confirmed that A. baumannii is a monophyletic clade and that the larger Acb complex is also a well-supported monophyletic group. The whole genome phylogeny provided the framework for a global genomic comparison based on a blast score ratio (BSR) analysis. The BSR analysis demonstrated that specific genes have been both lost and acquired in the evolution of A. baumannii. In addition, several genes associated with A. baumannii pathogenesis were found to be more conserved in the Acb complex, and especially in A. baumannii, than in other Acinetobacter genomes; until recently, a global analysis of the distribution and conservation of virulence factors across the genus was not possible. The results demonstrate that the acquisition of specific virulence factors has likely contributed to the widespread persistence and virulence of A. baumannii. The identification of novel features associated with transcriptional regulation and acquired by clades in the Acb complex presents targets for better understanding the
Distinguishing a SM-like MSSM Higgs boson from SM Higgs boson at muon collider
International Nuclear Information System (INIS)
Singhal, Jai Kumar; Singh, Sardar; Nagawat, Ashok K.
2007-01-01
We explore the possibility of distinguishing the SM-like MSSM Higgs boson from the SM Higgs boson via Higgs boson pair production at future muon collider. We study the behavior of the production cross-section in SM and MSSM with Higgs boson mass for various MSSM parameters tanβ and m A . We observe that at fixed CM energy, in the SM, the total cross-section increases with the increase in Higgs boson mass whereas this trend is reversed for the MSSM. The changes that occur for the MSSM in comparison to the SM predictions are quantified in terms of the relative percentage deviation in cross-section. The observed deviations in cross-section for different choices of Higgs boson masses suggest that the measurements of the cross-section could possibly distinguish the SM-like MSSM Higgs boson from the SM Higgs boson. (author)
Genome sequencing and annotation of Acinetobacter gerneri strain MTCC 9824T
Directory of Open Access Journals (Sweden)
Nitin Kumar Singh
2014-12-01
Full Text Available The genus Acinetobacter consists of 31 validly published species ubiquitously distributed in nature and primarily associated with nosocomial infection. We report the 4.4 Mb genome of Acinetobacter gerneri strain MTCC 9824T. The genome has a G + C content of 38.0% and includes 3 rRNA genes (5S, 23S16S and 64 aminoacyl-tRNA synthetase genes.
A dosimetric survey of the DC1500/25/04 electron beam plant installed at IPEN-CNEN/SP
International Nuclear Information System (INIS)
Kuntz, Florent; Somessari, Elizabeth S.R.; Silveira, Carlos G.da; Bueno, Carmen C.; Calvo, Wilson A.P.; Napolitano, Celia M.; Goncalves, Josemary A.C.; Somessari, Samir L.
2015-01-01
In this work we describe a dosimetric survey of the DC1500/25/04 electron beam accelerator installed in the Intense Sources of Radiation Laboratory at IPEN/CNEN-SP. As this accelerator has been used for innumerable applications in radiation processing, product surface and internal doses must be targeted and controlled via operational qualification such as beam energy, beam current, scan width and conveyor speed. The qualification of the accelerator was carried out in order to observe the current performances of the irradiation plant using Alanine (ESR) and CTA (UV Spectrophotometry) dosimeters. Energy (Electron penetration in material) calculations, scanning width/length, homogeneity and irradiation uniformity were evaluated according to ISO/ASTM 51649 and ISO11137-3, as well as process uncertainty establishment. (author)
NCBI nr-aa BLAST: CBRC-DYAK-04-0049 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DYAK-04-0049 ref|ZP_01904250.1| hypothetical protein RAZWK3B_11106 [Roseobacte...r sp. AzwK-3b] gb|EDM70152.1| hypothetical protein RAZWK3B_11106 [Roseobacter sp. AzwK-3b] ZP_01904250.1 0.048 40% ...
Molecular characterization of carbapenem-resistant Acinetobacter ...
African Journals Online (AJOL)
Purpose: To survey the molecular characteristics of imipenem-resistant Acinetobacter baumannii obtained from pediatric burns patients in a teaching hospital in Tehran, Iran. Methods: Over a 10-month period, 73 non-duplicate A. baumannii strains were collected from pediatric burns patients admitted to Motahari Burn and ...
Nosocomial imipenem-resistant Acinetobacter baumannii infections ...
African Journals Online (AJOL)
Imipenem-resistant Acinetobacter baumannii (A. baumannii) (IRAB) has emerged as a challenging nosocomial pathogen particularly in intensive care units (ICUs). Studying the risk factors associated with IRAB infection is of paramount importance for appropriate control of IRAB spread. The aim of this study was to assess ...
Sukmawati, D.; Puspitaningrum, R.; Muzajjanah
2017-07-01
The number of garbage generated by the industry or society is a usual problem encountered by almost all urban centers, especially large cities such as Jakarta. Waste prevention strategy required quickly and accurately. One strategy for tackling the Junk was getting lactic acid-producing bacteria. It has been shown that lactic acid can increase the acceleration of organic matter such as an overhaul of lignin and cellulose as well as out causing toxic compounds arising from decay. This research will be conducted on the determination and characterization of the enzyme-producing compost bacteria LDH lactate dehydrogenase LDH - which in isolation from the garbage Landfill Rawasari. Methodology: Research carried out consists: isolation of lactic acid-producing bacteria; identification of microscopic, macroscopic and staining Gram; cellulose assay, and optimization of PCR conditions LDH enzymes producing bacteria. Isolation is performed by dilution method and the direct method. As many as 5-point sampling. Each stage is conducted from 10 grams of soil from the top surface of the compost. Isolation results obtained 100 isolate the bacteria. Base on the characteristic of macroscopic and microscopic observations retrieved 14 isolates of bacteria have shaped rods and brought forth a negative kind of Gram positive staining. Bacterial isolates with codes (BK1; BK3; BK4; BK5; BK6; BK7; BK8; BK9; BK10; BK11: BK12; BK 13). The potential bacteria with ability produce lactate dehydrogenase was BK1 and BK3. Base for analysis phylogenetic there was identification bacteria bak1 and bak3 where Acinetobacter sp.
Ebringer, Alan; Rashid, Taha; Wilson, Clyde
2012-06-01
Multiple sclerosis (MS) is an autoimmune neurological disorder. The role of 'Acinetobacter' has been examined using the method of Karl Popper and involves nine "Popper sequences". (1) The frequency of MS increases with latitudes in the Northern Hemisphere, and the reverse is found in the Southern Hemisphere. (2) Sinusitis is found frequently at colder latitudes. (3) Sinusitis occurs frequently in patients with MS. (4) Specific sequences of bovine myelin when injected into experimental animals will produce a neurological disorder resembling MS which is called "experimental allergic encephalomyelitis". (5) Computer analysis of myelin shows molecular mimicry with sequences found in Acinetobacter. (6) Antibodies to Acinetobacter bacteria are found in MS patients. (7) Acinetobacter bacteria are located on human skin and in the nasal sinuses. (8) IgA antibodies are preferentially elevated in the sera of MS patients, thereby suggesting the trigger microbe is acting across a mucosal surface probably located in the nasal sinuses. (9) Only Acinetobacter bacteria and no other microbes evoke statistically significant titres of antibodies in MS patients. These nine Popper sequences suggest that MS is most probably caused by infections with Acinetobacter bacteria in the nasal sinuses, and this could have therapeutic implications. Copyright © 2012 Elsevier Ltd. All rights reserved.
PREVALENCE OF ACINETOBACTER BAUMANNII ISOLATED FROM CLINICAL SPECIMENS IN ADAM MALIK HOSPITAL
Evita Mayasari; Cherry Siregar
2014-01-01
AbstrakAcinetobacter baumannii merupakan spesies Acinetobacter spp. tersering diisolasi darimanusia, dan lebih sering dijumpai pada infeksi nosokomial dibandingkan dengan infeksi dikomunitas. Eksistensi bakteri ini di lingkungan terkait dengan keragaman reservoir, kemampuanmemperoleh gen pembawa sifat resisten antimikroba, dan sifat resisten terhadap pengeringan.Infeksi disebabkan strain A.baumannii yang resisten terhadap banyak antibiotik tidak mudahdikendalikan dan menjadi permasalahan di b...
Genome sequencing and annotation of Acinetobacter gyllenbergii strain MTCC 11365T
Directory of Open Access Journals (Sweden)
Nitin Kumar Singh
2014-12-01
Full Text Available The genus Acinetobacter consists of 31 validly published species ubiquitously distributed in nature and primarily associated with nosocomial infection. We report 4.3 Mb genome of the Acinetobacter gyllenbergii strain MTCC 11365T. The draft genome of A. gyllenbergii has a G + C content of 41.0% and includes 3 rRNA genes (5S, 23S, 16S and 67 aminoacyl-tRNA synthetase genes.
Lázaro-Díez, María; Navascués-Lejarza, Teresa; Remuzgo-Martínez, Sara; Navas, Jesús; Icardo, José Manuel; Acosta, Felix; Martínez-Martínez, Luis; Ramos-Vivas, José
2016-09-01
The molecular and genetic basis of Acinetobacter baumannii and Acinetobacter pittii virulence remains poorly understood, and there is still lack of knowledge in host cell response to these bacteria. In this study, we have used eleven clinical Acinetobacter strains (A. baumannii n = 5; A. pittii n = 6) to unravel bacterial adherence, invasion and cytotoxicity to human lung epithelial cells. Our results showed that adherence to epithelial cells by Acinetobacter strains is scarce and cellular invasion was not truly detected. In addition, all Acinetobacter strains failed to induce any cytotoxic effect on A549 cells. Copyright © 2016 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.
Calorimetric investigation on the Pb-Sm and Sn-Sm alloys
International Nuclear Information System (INIS)
Berrada, A.-E.-A.; Claire, Y.; Chafik el Idrissi, M.; Castanet, R.
1997-01-01
The integral enthalpy of formation of the Sm-Pb and Sm-Sn melts at 1203 K, h f , was determined by direct reaction calorimetry (drop method) in the Pb and Sn rich sides with the help of a high-temperature Tian-Calvet calorimeter. The results can be fitted respectively with reference to the mole fraction of samarium, x, as follows: f /kJmol -1 =x(1-x)(-109.8 -372.0.7x) with 0 Sm f /kJmol -1 =x(1- x)(-277.0+105.4x) with 0 Sm -1 respectively. Such negative values suggest the existence of a strong short-range order in the liquid state. The stoichiometry and the thermal stability of these associations needs additional thermodynamic determinations concerning mainly the free enthalpy of formation. It will be determined by Knudsen-effusion combined with mass spetrometry in a further work. (orig.)
Zhao, Lei; Li, Hongru; Zhu, Ziwen; Wakefield, Mark R; Fang, Yujiang; Ye, Ying
2017-06-01
Acinetobacter baumannii has been becoming a great challenge to clinicians due to their resistance to almost all available antibiotics. In this study, we sequenced the genome from a multiple antibiotics resistant Acinetobacter baumannii stain which was named A. baumannii-1isolated from China by SMRT sequencing technology to explore its potential mechanisms to antibiotic resistance. We found that several mechanisms might contribute to the antibiotic resistance of Acinetobacter baumannii. Specifically, we found that SNP in genes associated with nucleotide excision repair and ABC transporter might contribute to its resistance to multiple antibiotics; we also found that specific genes associated with bacterial DNA integration and recombination, DNA-mediated transposition and response to antibiotics might contribute to its resistance to multiple antibiotics; Furthermore, specific genes associated with penicillin and cephalosporin biosynthetic pathway and specific genes associated with CHDL and MBL β-lactamase genes might contribute to its resistance to multiple antibiotics. Thus, the detailed mechanisms by which Acinetobacter baumannii show extensive resistance to multiple antibiotics are very complicated. Such a study might be helpful to develop new strategies to control Acinetobacter baumannii infection. Copyright © 2017 Elsevier B.V. All rights reserved.
Evaluation of the exothermicity of the chemi-ionization reaction Sm + O → SmO+ + e−
International Nuclear Information System (INIS)
Cox, Richard M; Kim, JungSoo; Armentrout, P. B.; Bartlett, Joshua; VanGundy, Robert A.; Heaven, Michael C.; Ard, Shaun G.; Shuman, Nicholas S.; Viggiano, Albert A.; Melko, Joshua J.
2015-01-01
The exothermicity of the chemi-ionization reaction Sm + O → SmO + + e − has been re-evaluated through the combination of several experimental methods. The thermal reactivity (300–650 K) of Sm + and SmO + with a range of species measured using a selected ion flow tube-mass spectrometer apparatus is reported and provides limits for the bond strength of SmO + , 5.661 eV ≤ D 0 (Sm + -O) ≤ 6.500 eV. A more precise value is measured to be 5.72 5 ± 0.07 eV, bracketed by the observed reactivity of Sm + and SmO + with several species using a guided ion beam tandem mass spectrometer (GIBMS). Combined with the established Sm ionization energy (IE), this value indicates an exothermicity of the title reaction of 0.08 ± 0.07 eV, ∼0.2 eV smaller than previous determinations. In addition, the ionization energy of SmO has been measured by resonantly enhanced two-photon ionization and pulsed-field ionization zero kinetic energy photoelectron spectroscopy to be 5.7427 ± 0.0006 eV, significantly higher than the literature value. Combined with literature bond energies of SmO, this value indicates an exothermicity of the title reaction of 0.14 ± 0.17 eV, independent from and in agreement with the GIBMS result presented here. The evaluated thermochemistry also suggests that D 0 (SmO) = 5.83 ± 0.07 eV, consistent with but more precise than the literature values. Implications of these results for interpretation of chemical release experiments in the thermosphere are discussed
Nagel, A.P.; Vercouteren, W.J.J.C.; Hoek, van der N.; Lohman, T.A.M.; Vermeulen, N.
1996-01-01
Kernbegrippen die bij de discussie van strategisch management (SM) aan de orde komen, zijn productinnovatie op ondernemingsniveau (oftewel strategische productinnovatie, SPI) en technologiestrategie. In dit artikel wordt een raamwerk van SM geintroduceerd. Daartoe worden de verschillende fasen van
DAN IDENTIFIKASI PATOGEN POTENSIAL YANG MENGINFEKSI IKAN RAINBOW (Melanotaenia sp.
Directory of Open Access Journals (Sweden)
Lili Sholichah
2014-03-01
Full Text Available Pemeliharaan ikan rainbow (Melanotaenia sp. di Balai Penelitian dan Pengembangan Budidaya Ikan Hias selalu terjadi kematian secara bertahap mulai calon induk hingga proses pemijahan. Hal ini terjadi berulang kali sehingga ketersediaan induk Melanotaenia sp. sangat terancam. Ikan ini berasal dari Papua yang diperoleh mengandalkan penangkapan di alam. Tujuan dari penelitian ini adalah untuk menginventarisir dan mengidentifikasi berbagai patogen (parasit, jamur, bakteri potensial yang menginfeksi ikan rainbow yang dipelihara di dalam akuarium berukuran 50 cm x 50 cm x 50 cm dengan sistem aliran air stagnan. Tiga jenis rainbow yang dipelihara yaitu: rainbow Sungai Salawati, asal Sungai Sawiat, dan asal Danau Kurumoi. Setiap ikan masing-masing berjumlah 100 ekor dipelihara di akuarium dengan penambahan batu karang dan tanpa penambahan karang (kontrol ke dalam akuarium. Ikan diberi pakan sekenyangnya berupa jentik nyamuk dan cacing rambut beku setiap pagi dan sore hari. Sampling dilakukan secara random sebulan sekali dan secara unrandom setiap ada kejadian ikan sakit. Gejala klinis ikan yang sakit sebagai berikut: ikan berenang di permukaan dan menggosok-gosokkan badan di dinding akuarium, nafsu makan berkurang, gerakan berputar-putar, warna memudar menjadi putih, penekanan warna hitam pada sirip punggung dan perut meningkat, pendarahan pada perut, lendir berlebihan dan sangat berbau, serta sisik berdiri/terbuka. Diagnosa dan deteksi penyakit awal berupa pengamatan parasit baik ektoparasit maupun endoparasit, pengamatan dan isolasi jamur pada media selektif jamur, dan isolasi bakteri dilakukan untuk mengetahui jenis-jenis patogen yang menginfeksi ketiga jenis ikan rainbow. Selanjutnya dilakukan uji histologi dan analisa DNA beberapa patogen. Hasil pengamatan diperoleh patogen berupa parasit (Ichthyophthirius sp., Dactylogyrus sp., Gyrodactylus sp., dan Trichodina sp. dan bakteri (Aeromonas hydrophila, Acinetobacter sp
International Nuclear Information System (INIS)
Fayyaz, M.; Akbar, N.; Khan, I. U.; Hussain, A.; Ali, S.; Mirza, I. A.
2015-01-01
Objective: To evaluate the frequency and antimicrobial susceptibility pattern of Acinetobacter species isolated from pus and pus swab specimens at a tertiary care setting. Study Design: Cross-sectional observational study. Place and Duration of Study: Department of Microbiology, Armed Forces Institute of Pathology, Rawalpindi, from July 2008 to July 2012. Methodology: Data regarding positive culture and antimicrobial sensitivity pattern was retrieved from the pus and pus swab culture records of the Microbiology Department, AFIP, Rawalpindi. Only those pus and pus swab specimens which yielded the growth of Acinetobacter species were included in the study. Results:Out of 2781, 1848 were of pure pus while 933 were pus swab specimens. Out of 2538 culture positive isolates, 276 (10.9 percentage) were identified as Acinetobacterspecies. Among 276 Acinetobacter species, 245 (88.8 percentage) were Acinetobacter baumannii and 31 (11.2 percentage) were Acinetobacter johnsonii. Male/female ratio of the affected patients was 5.6:1. Doxycycline was the most sensitive antibiotic to which 45 percentage of the tested isolates were sensitive. Sensitivity to all other antimicrobials was 15 percentage or less. Conclusion: About 11 percentage of soft tissue and wound infections are caused by Acinetobacter species in our set up particularly in male. Doxycycline was the most sensitive antibiotic. Sensitivity to all other antimicrobials was 15 percentage or less. In vitro sensitivity to carbapenems is very low. (author)
Directory of Open Access Journals (Sweden)
Shu-Chen eKuo
2015-03-01
Full Text Available The sulbactam resistance rate in Acinetobacter baumannii has increased worldwide. Previous reports have shown that the β-lactamase blaTEM-1 confers resistance to sulbactam in A. baumannii. The purpose of this study was to examine whether other β-lactamases including, the Acinetobacter-derived cephalosporinase (ADC, OXA-23, OXA-24/72, and OXA-58 families, also contribute to sulbactam resistance in A. baumannii. The correlation between these β-lactamases and the sulbactam minimal inhibitory concentration (MIC was determined using A. baumannii clinical isolates from diverse clonality, which were collected in a nationwide surveillance program from 2002 to 2010 in Taiwan. A possible association between the genetic structure of ISAba1-blaADC-30 and sulbactam resistance was observed because this genetic structure was detected in 97% of sulbactam-resistant strains compared with 10% of sulbactam-susceptible strains. Transformation of ISAba1-blaADC-30 into susceptible strains increased the sulbactam MIC from 2 to 32 μg/ml, which required blaADC-30 overexpression using an upstream promoter in ISAba1. Flow cytometry showed that ADC-30 production increased in response to sulbactam, ticarcillin, and ceftazidime treatment. This effect was regulated at the RNA level but not by an increase in the blaADC-30 gene copy number as indicated by quantitative PCR. Purified ADC-30 decreased the inhibitory zone created by sulbactam or ceftazidime, similarly to TEM-1. In conclusion, ADC-30 overexpression conferred resistance to sulbactam in diverse clinical A. baumannii isolates.
Directory of Open Access Journals (Sweden)
S. Montaña
2018-01-01
Full Text Available Clinically significant NDM-1-producing Acinetobacter schindleri has not yet been described in the literature. We report the first case of bacteraemia due to an A. schindleri strain harbouring blaNDM-1 recovered from an immunocompromised patient. Our report reinforces the fact that NDM-1 can easily be acquired by Acinetobacter species. Keywords: Acinetobacter schindleri, bacteraemia, blaNDM-1, clinically significant isolate, immunocompromised patient
Mohd Rani, Farahiyah; A Rahman, Nor Iza; Ismail, Salwani; Alattraqchi, Ahmed Ghazi; Cleary, David W; Clarke, Stuart C; Yeo, Chew Chieng
2017-01-01
Acinetobacter spp. are important nosocomial pathogens, in particular the Acinetobacter baumannii - calcoaceticus complex, which have become a global public health threat due to increasing resistance to carbapenems and almost all other antimicrobial compounds. High rates of resistance have been reported among countries in Southeast Asia, including Malaysia. In this review, we examine the antimicrobial resistance profiles of Acinetobacter spp. hospital isolates from Malaysia over a period of nearly three decades (1987-2016) with data obtained from various peer-reviewed publications as well as the Malaysian National Surveillance on Antibiotic Resistance (NSAR). NSAR data indicated that for most antimicrobial compounds, including carbapenems, the peak resistance rates were reached around 2008-2009 and thereafter, rates have remained fairly constant (e.g., 50-60% for carbapenems). Individual reports from various hospitals in Peninsular Malaysia do not always reflect the nationwide resistance rates and often showed higher rates of resistance. We also reviewed the epidemiology and mechanisms of resistance that have been investigated in Malaysian Acinetobacter spp. isolates, particularly carbapenem resistance and found that bla OXA-23 is the most prevalent acquired carbapenemase-encoding gene. From the very few published reports and whole genome sequences that are available, most of the Acinetobacter spp. isolates from Malaysia belonged to the Global Clone 2 (GC2) CC92 group with ST195 being the predominant sequence type. The quality of data and analysis in the national surveillance reports could be improved and more molecular epidemiology and genomics studies need to be carried out for further in-depth understanding of Malaysian Acinetobacter spp. isolates.
Contamination of Ambient Air with Acinetobacter baumannii on Consecutive Inpatient Days.
Shimose, Luis A; Doi, Yohei; Bonomo, Robert A; De Pascale, Dennise; Viau, Roberto A; Cleary, Timothy; Namias, Nicholas; Kett, Daniel H; Munoz-Price, L Silvia
2015-07-01
Acinetobacter-positive patients had their ambient air tested for up to 10 consecutive days. The air was Acinetobacter positive for an average of 21% of the days; the rate of contamination was higher among patients colonized in the rectum than in the airways (relative risk [RR], 2.35; P = 0.006). Of the 6 air/clinical isolate pairs available, 4 pairs were closely related according to rep-PCR results. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
Host-microbe interactions that shape the pathogenesis of Acinetobacter baumannii infection
Mortensen, Brittany L.; Skaar, Eric P.
2013-01-01
Summary Acinetobacter baumannii is an opportunistic pathogen that has emerged as a prevalent source of nosocomial infections, most frequently causing ventilator-associated pneumonia. The emergence of pan-drug resistant strains magnifies the problem by reducing viable treatment options and effectively increasing the mortality rate associated with Acinetobacter infections. In light of this rising threat, research on A. baumannii epidemiology, antibiotic resistance, and pathogenesis is accelerating. The recent development of both in vitro and in vivo models has enabled studies probing the host-Acinetobacter interface. Bacterial genetic screens and comparative genomic studies have led to the identification of several A. baumannii virulence factors. Additionally, investigations into host defense mechanisms using animal models or cell culture have provided insight into the innate immune response to infection. This review highlights some of the key attributes of A. baumannii virulence with an emphasis on bacterial interactions with the innate immune system. PMID:22640368
Coercivity Recovery Effect of Sm-Fe-Cu-Al Alloy on Sm2Fe17N3 Magnet
Otogawa, Kohei; Asahi, Toru; Jinno, Miho; Yamaguchi, Wataru; Takagi, Kenta; Kwon, Hansang
2018-03-01
The potential of a Sm-Fe-Cu-Al binder for improvement of the magnetic properties of Sm2Fe17N3 was examined. Transmission electron microscope (TEM) observation of a Sm-Fe-Cu-Al alloy-bonded Sm2Fe17N3 magnet which showed high coercivity revealed that the Sm-Fe-Cu-Al alloy had an effect of removing the surface oxide layer of the Sm2 Fe17N3 grains. However, the Sm-Fe-Cu-Al binder was contaminated by carbon and nitrogen, which originated from the organic solvent used as the milling medium during pulverization. To prevent carbon and nitrogen contamination, the Sm-Fe- Cu-Al alloy was added directly on the surface of the Sm2Fe17N3 grains by sputtering. Comparing the recovered coercivity per unit amount of the added binder the uncontaminated binder-coated sample had a higher coercivity recovery effect than the milled binder-added sample. These results suggested that sufficient addition of the contamination-free Sm-Fe-Cu-Al binder has the possibility to reduce the amount of binder necessary to produce a high coercive Sm2Fe17N3 magnet.
Multidrug Resistant Acinetobacter Infection and Their Antimicrobial ...
African Journals Online (AJOL)
Background: Acinetobacter baumannii, a non-glucose fermenting Gram negative bacillus, has emerged in the last three decades as a major etiological agent of hospital-associated infections giving rise to significant morbidity and mortality particularly in immunocompromised patients. Multidrug resistant A. baumannii ...
Directory of Open Access Journals (Sweden)
İsa Yıldız
2016-09-01
Full Text Available INTRODUCTION: Determination of suitable antibiotics in treatment of Acinetobacter infections is through the hospital ascertaining the resistance state to bacteria causing the problem. In this study, the evaluation of antibiotics sensitivity of Acinetobacter strains isolated as infection factor in patients hospitalized in intensive care units is aimed. METHODS: Acinetobacter strains isolated from the samples of patients hospitalized in the 2nd and 3rd Stage adult intensive care units of a province in in northwestern Anatolia have been studied. RESULTS: A total of 165 patients were included in the study. The most isolated samples were respiratory tract samples, blood and urine. The antibiotics which the factors were most sensitive were cholistin (66,1% gentamicin (22,4% and trimethoprim sulfamethoxazole (18,2%. DISCUSSION AND CONCLUSION: We face increasing resistance ratios in Acinetobacter strains. Necessary precautions should be taken for this.
Bharti, Randhir K; Srivastava, Shaili; Thakur, Indu Shekhar
2014-02-01
A chemolithotrophic bacterium, Serratia sp. ISTD04, enriched in the chemostat in presence of sodium bicarbonate as sole carbon source was evaluated for potential of carbon dioxide (CO2) sequestration and biofuel production. CO2 sequestration efficiency of the bacterium was determined by enzymatic activity of carbonic anhydrase and ribulose-1,5-bisphosphate carboxylase/oxygenase (RuBisCO). Further, Western blot analysis confirmed presence of RuBisCO. The bacterium produced 0.487 and 0.647mgmg(-1) per unit cell dry weight of hydrocarbons and lipids respectively. The hydrocarbons were within the range of C13-C24 making it equivalent to light oil. GC-MS analysis of lipids produced by the bacterium indicated presence of C15-C20 organic compounds that made it potential source of biodiesel after transesterification. GC-MS, FTIR and NMR spectroscopic characterization of the fatty acid methyl esters revealed the presence of 55% and 45% of unsaturated and saturated organic compounds respectively, thus making it a balanced biodiesel composition. Copyright © 2013 Elsevier Ltd. All rights reserved.
Kumar, Manish; Morya, Raj; Gnansounou, Edgard; Larroche, Christian; Thakur, Indu Shekhar
2017-11-01
Proteomics and metabolomics analysis has become a powerful tool for characterization of microbial ability for fixation of Carbon dioxide. Bacterial community of palaeoproterozoic metasediments was enriched in the shake flask culture in the presence of NaHCO 3 . One of the isolate showed resistance to NaHCO 3 (100mM) and was identified as Serratia sp. ISTD04 by 16S rRNA sequence analysis. Carbon dioxide fixing ability of the bacterium was established by carbonic anhydrase enzyme assay along with proteomic analysis by LC-MS/MS. In proteomic analysis 96 proteins were identified out of these 6 protein involved in carbon dioxide fixation, 11 in fatty acid metabolism, indicating the carbon dioxide fixing potency of bacterium along with production of biofuel. GC-MS analysis revealed that hydrocarbons and FAMEs produced by bacteria within the range of C 13 -C 24 and C 11 -C 19 respectively. Presence of 59% saturated and 41% unsaturated organic compounds, make it a better fuel composition. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Yesim Cekin
2014-03-01
Full Text Available Aim: Acinetobacter species are amoung the most common two cause of infections isolated from patients of intensive care unit in our hospital. Doripenem which acts by inhibiting cell wall synthesis is resently introduced for use in our country is broad spectrum antibiotic belonging to carbapenems. There are many studies investigating the susceptibility of doripenem of Acinetobacter baumannii which is isolated as a cause of ventilatory associated pneumonia in the literature. We aimed to compare e-test and disc diffusion methods for doripenem susceptibility of acinetobacter baumannii strains as nosocomial infections Acinetobacter baumanni isolates detected as nosocomial infection. Material and Method:. Between January to December, 2009 a total of 94 Acinetobacter baumanni strains isolated from different clinical specimens from intensive care units have been studied for doripenem susceptibility by disc diffusion and E-test methods. Minimal inhibitory consantrations (MIC were accepted as; sensitive %u22641 %u03BCg/ml, intermadiate 2-4 %u03BCg/ml, resistant >4 %u03BCg/ml and diameters of inhibition zone with 10 µg disc; sensitive
Diversity Within the O-linked Protein Glycosylation Systems of Acinetobacter Species
DEFF Research Database (Denmark)
Scott, N. E.; Kinsella, R. L.; Edwards, A. V. G.
2014-01-01
nature of glycan biogenesis we investigated the composition, diversity, and properties of the Acinetobacter glycoproteome. Utilizing global and targeted mass spectrometry methods, we examined 15 strains and found extensive glycan diversity in the O-linked glycoproteome of Acinetobacter. Comparison......-linked glycosylation favors short (three to five residue) glycans with limited branching containing negatively charged sugars such as GlcNAc3NAcA4OAc or legionaminic/pseudaminic acid derivatives. These observations suggest that although highly diverse, the capsule/O-linked glycan biosynthetic pathways generate glycans...
In vitro efficacy of doripenem against pseudomonas aeruginosa and acinetobacter baumannii by e-test
International Nuclear Information System (INIS)
Gilani, M.; Munir, T.; Latif, M.; Rehman, S.
2015-01-01
To assess the in vitro efficacy of doripenem against Pseudomonas aeruginosa and Acinetobacter baumannii using Epsilometer strips. Study Design: Cross-sectional study. Place and Duration of Study: Department of Microbiology, Army Medical College, Rawalpindi and National University of Sciences and Technology, Islamabad, from May 2014 to September 2014. Methodology: A total of 60 isolates of Acinetobacter baumannii and Pseudomonas aeruginosa collected from various clinical samples received from Military Hospital were included in the study. The specimens were inoculated onto blood, MacConkey and chocolate agars. The isolates were identified using Gram staining, motility, catalase test, oxidase test and API 20NE (Biomeriux, France). Organisms identified as Acinetobacter baumannii and Pseudomonas aeruginosa were included in the study. Bacterial suspensions equivalent to 0.5 McFarland turbidity standard of the isolates were prepared and applied on Mueller Hinton agar. Epsilometer strip was placed in the center of the plate and incubated for 18-24 hours. Minimum Inhibitory Concentration (MIC) was taken to be the point where the epsilon intersected the E-strip. MIC of all the isolates was noted. Results: For Pseudomonas aeruginosa isolates, MIC50 was 12 micro g/mL and MIC90 was 32 micro g/mL. For Acinetobacter baumannii MIC 50 and MIC90 was 32 micro g/mL. Conclusion: Doripenem is no more effective against Pseudomonas aeruginosa and Acinetobacter baumannii in our setting. (author)
Genome Sequence of Jumbo Phage vB_AbaM_ME3 of Acinetobacter baumanni
Buttimer, Colin; O?Sullivan, Lisa; Elbreki, Mohamed; Neve, Horst; McAuliffe, Olivia; Ross, R. Paul; Hill, Colin; O?Mahony, Jim; Coffey, Aidan
2016-01-01
Bacteriophage (phage) vB_AbaM_ME3 was previously isolated from wastewater effluent using the propagating host Acinetobacter baumannii DSM 30007. The full genome was sequenced, revealing it to be the largest Acinetobacter bacteriophage sequenced to date with a size of 234,900 bp and containing 326 open reading frames (ORFs).
Temperature dependence of spin and orbital magnetic moments of Sm 4f electrons in (Sm, Gd)Al2
International Nuclear Information System (INIS)
Qiao, S.; Kimura, A.; Adachi, H.; Iori, K.; Miyamoto, K.; Xie, T.; Namatame, H.; Taniguchi, M.; Tanaka, A.; Muro, T.; Imada, S.; Suga, S.
2005-01-01
X-ray magnetic circular dichroism studies were carried out on (Sm, Gd)Al 2 , a ferromagnet without net magnetization at a certain compensation temperature. For Sm 4f electrons, the following understandings were obtained: the magnitude of expectation value of orbital magnetic moment (m L Sm ) is always larger than that of spin one (m S Sm ), so the cancellation of total spin and orbital magnetic moments cannot be achieved only by Sm 4f electrons and the contributions from Gd ions and conduction electrons are important; when the temperature decreases, the magnitude of both m L Sm and m S Sm increases and the gross magnetic moment due to the Sm 4f electrons monotonically deviates from zero. These results tell us that the temperature dependence of magnetic moments related with the electrons other than Sm 4f ones may play important roles in the subtle adjustment of the total spin and orbital magnetic moments to the zero magnetization at the compensation temperature
Directory of Open Access Journals (Sweden)
Dann Turner
Full Text Available Acinetobacter baumannii has emerged as an important nosocomial pathogen in healthcare and community settings. While over 100 of Acinetobacter phages have been described in the literature, relatively few have been sequenced. This work describes the characterisation and genome annotation of a new lytic Acinetobacter siphovirus, vB_AbaS_Loki, isolated from activated sewage sludge. Sequencing revealed that Loki encapsulates a 41,308 bp genome, encoding 51 predicted open reading frames. Loki is most closely related to Acinetobacter phage IME_AB3 and more distantly related to Burkholderia phage KL1, Paracoccus phage vB_PmaS_IMEP1 and Pseudomonas phages vB_Pae_Kakheti25, vB_PaeS_SCH_Ab26 and PA73. Loki is characterised by a narrow host range, among the 40 Acinetobacter isolates tested, productive infection was only observed for the propagating host, A. baumannii ATCC 17978. Plaque formation was found to be dependent upon the presence of Ca2+ ions and adsorption to host cells was abolished upon incubation with a mutant of ATCC 17978 encoding a premature stop codon in lpxA. The complete genome sequence of vB_AbaS_Loki was deposited in the European Nucleotide Archive (ENA under the accession number LN890663.
Genome sequencing and annotation of Acinetobacter guillouiae strain MSP 4-18
Directory of Open Access Journals (Sweden)
Nitin Kumar Singh
2014-12-01
Full Text Available The genus Acinetobacter consists of 31 validly published species ubiquitously distributed in nature and primarily associated with nosocomial infection. We report the 4.8 Mb genome of Acinetobacter guillouiae MSP 4-18, isolated from a mangrove soil sample from Parangipettai (11°30′N, 79°47′E, Tamil Nadu, India. The draft genome of A. guillouiae MSP 4-18 has a G + C content of 38.0% and includes 3 rRNA genes (5S, 23S, 16S and 69 aminoacyl-tRNA synthetase genes.
Staring at the cold sun: blue light regulation is distributed within the genus Acinetobacter.
Directory of Open Access Journals (Sweden)
Adrián Golic
Full Text Available We previously showed that the opportunistic nosocomial pathogen Acinetobacter baumannii is able to sense and respond to light via BlsA, a BLUF (Blue-Light-sensing Using FAD-domain photoreceptor protein. Here, we extend our previous studies showing that light regulation is not restricted to A. baumannii, but rather widespread within the genus Acinetobacter. First, we found that blue light modulates motility and biofilm formation in many species of the genus, including members of the Acinetobacter calcoaceticus-A. baumannii complex. In many of these species blue light acts as a key factor guiding the decision between motility or sessility at 24°C, whereas in A. baumannii, light inhibits both motility and biofilm formation. We also show that light regulation of motility occurred not only at 24°C but also at 37°C in non-A. baumannii species, contrasting the situation of A. baumannii which only shows photoregulation at 24°C. Second, we show that Acinetobacter baylyi (strain ADP1 BLUF-photoreceptors can functionally replace in vivo the A. baumannii 17978 BlsA protein and that the pathways leading to biofilm formation are inversely regulated at 24°C between these two microorganisms. Finally, we found the presence of predicted genes coding BLUF-containing proteins in all Acinetobacter sequenced genomes, even though the copy number is variable among them. Phylogenetic analysis suggests a common origin for all BLUF domains present in members of this genus, and could distinguish well-differentiated clusters that group together BLUF homologs from different species, a situation particularly clear for members of the ACB complex. Despite a role played by these BLUF domain-containing proteins in the photoregulation observed in the members of the genus Acinetobacter is a likely scenario given our findings in A. baumannii and A. baylyi, further research will contribute to confirm this possibility.
Staring at the Cold Sun: Blue Light Regulation Is Distributed within the Genus Acinetobacter
Golic, Adrián; Vaneechoutte, Mario; Nemec, Alexandr; Viale, Alejandro M.; Actis, Luis A.; Mussi, María Alejandra
2013-01-01
We previously showed that the opportunistic nosocomial pathogen Acinetobacter baumannii is able to sense and respond to light via BlsA, a BLUF (Blue-Light-sensing Using FAD)-domain photoreceptor protein. Here, we extend our previous studies showing that light regulation is not restricted to A. baumannii, but rather widespread within the genus Acinetobacter. First, we found that blue light modulates motility and biofilm formation in many species of the genus, including members of the Acinetobacter calcoaceticus-A. baumannii complex. In many of these species blue light acts as a key factor guiding the decision between motility or sessility at 24°C, whereas in A. baumannii, light inhibits both motility and biofilm formation. We also show that light regulation of motility occurred not only at 24°C but also at 37°C in non-A. baumannii species, contrasting the situation of A. baumannii which only shows photoregulation at 24°C. Second, we show that Acinetobacter baylyi (strain ADP1) BLUF-photoreceptors can functionally replace in vivo the A. baumannii 17978 BlsA protein and that the pathways leading to biofilm formation are inversely regulated at 24°C between these two microorganisms. Finally, we found the presence of predicted genes coding BLUF-containing proteins in all Acinetobacter sequenced genomes, even though the copy number is variable among them. Phylogenetic analysis suggests a common origin for all BLUF domains present in members of this genus, and could distinguish well-differentiated clusters that group together BLUF homologs from different species, a situation particularly clear for members of the ACB complex. Despite a role played by these BLUF domain-containing proteins in the photoregulation observed in the members of the genus Acinetobacter is a likely scenario given our findings in A. baumannii and A. baylyi, further research will contribute to confirm this possibility. PMID:23358859
Dielectric spectroscopy of the SmQ* phase
Perkowski, P.; Bubnov, A.; Piecek, W.; Ogrodnik, K.; Hamplová, V.; Kašpar, M.
2011-11-01
Liquid crystal possessing two biphenyl moieties in the molecular core and lateral chlorine substitution far from the chiral chain has been studied by dielectric spectroscopy. On cooling from the isotropic phase, the material possesses the frustrated smectic Q* (SmQ*) and SmCA* phases. It has been confirmed by dielectric spectroscopy that the SmQ* phase can be related to the SmCA* anti-ferroelectric phase. However, only one relaxation process has been observed in the SmQ* phase, while in the SmCA*, two relaxations are clearly detectable. It seems that the mode found in the SmQ* can be connected with high-frequency anti-phase mode observed in the SmCA* phase. Its relaxation frequency is similar to PH relaxation frequency, but is weaker. The same relaxation has been observed even a few degrees above the SmQ*-Iso phase transition. Another explanation for the mode detected in SmQ* and isotropic phases can be molecular motions around short molecular axis.
Antimicrobial resistance and clonality in Acinetobacter baumannii
Nemec, Alexandr
2009-01-01
The aim of this thesis was to obtain insight into the epidemiology and molecular basis of multidrug resistance of Acinetobacter baumannii at the population level. To this aim a number of studies were performed on strains mainly from the Czech Republic (CR) which have shown in particular that (i) the
Selective Mutism: The Fraternal Twin of Childhood Social Phobia.
Gensthaler, Angelika; Maichrowitz, Verena; Kaess, Michael; Ligges, Marc; Freitag, Christine M; Schwenck, Christina
Selective mutism (SM) is an anxiety disorder with a close link to childhood social phobia (SP). Our studies compare behavioral problem profiles in children and adolescents with SM and SP and control groups and assess the comorbidity patterns of SM and SP. Participants aged 3-18 years with SM (n = 95), SP (n = 74) and internalizing disorders (INT, n = 46) and a typically developing control group (CG, n = 119) were assessed with the Child Behavior Checklist (CBCL); adolescents were additionally assessed with the Youth Self-Report (YSR). Comorbidity was assessed in SM and SP participants with a diagnostic interview. SP was detected in 94% of children with SM. SM participants showed different behavioral and psychiatric symptoms than SP: they were more frequently affected by lifetime separation anxiety disorder (SM: 45%, SP: 26%) and oppositional defiant disorder (SM: 22%, SP: 5%), and less by generalized anxiety disorder (SM: 6%, SP: 20%) and major depression (SM: 12%, SP: 26%). Adolescents with SM showed high rates of agoraphobia (SM 27%; SP 10%) and more social problems (YSR), and were more withdrawn (CBCL, YSR) than those with SP alone. Specific behavioral problems of SM and SP compared to INT and CG were observed. SM and SP represent separate but closely related disorders, distinct from other INT and CG, with specific patterns of lifetime comorbidities. © 2016 S. Karger AG, Basel.
Optical isotype shifts of 146Sm and 151Sm
International Nuclear Information System (INIS)
Eastham, D.A.; Walker, P.M.; Griffith, J.A.R.; Evans, D.E.; England, J.G.; Grant, I.S.
1984-01-01
We have measured the optical isotope shifts of 146 Sm and 151 Sm by laser resonance fluorescence. From these measurements the changes in the mean square nuclear radii are: delta 2 > (A=144 to 146)=0.266(10) fm 2 , and delta 2 > (A=151 to 152)=0.262(10) fm 2 . These results, together with those of the stable isotopes, show that the average nuclear expansion of samarium can be accounted for by the liquid drop model with deformations. (orig.)
Genome Sequence of Jumbo Phage vB_AbaM_ME3 of Acinetobacter baumanni.
Buttimer, Colin; O'Sullivan, Lisa; Elbreki, Mohamed; Neve, Horst; McAuliffe, Olivia; Ross, R Paul; Hill, Colin; O'Mahony, Jim; Coffey, Aidan
2016-08-25
Bacteriophage (phage) vB_AbaM_ME3 was previously isolated from wastewater effluent using the propagating host Acinetobacter baumannii DSM 30007. The full genome was sequenced, revealing it to be the largest Acinetobacter bacteriophage sequenced to date with a size of 234,900 bp and containing 326 open reading frames (ORFs). Copyright © 2016 Buttimer et al.
2012-01-01
VISITS The rules and conditions to be followed for visits in the SM18 Hall are laid out in the EDMS 1205328 document. No visit is allowed without prior reservation. ACCESS Special access right is needed ONLY from 7 p.m. to 7 a.m. and during week-ends. From 1 December, the current SM18 access database will be closed and a new one “SM18-OWH outside normal hours” started from scratch. Requests, via EDH SM18-OWH, will have to be duly justified. For further information, please contact Evelyne Delucinge.
Chen, Peng; Hu, Wenyuan; Yang, Dingming; Zhu, Jiayi; Zhang, Jing; Wu, Yadong
2018-02-01
Novel orange-red emitting phosphors, Ba2Zn1-xWO6:xSm3+ (x = 0.03, 0.04, 0.05, 0.06 and 0.07) (BZW:Sm3+), were prepared using a high-temperature solid-state reaction method. Their crystal structure and photoluminescence properties were characterized and the mechanism of energy transfers between Ba2ZnWO6 and Sm3+ elucidated in detail. It was found that the phosphors had a cubic structure with space group Fm 3 bar m . They can be excited by near-ultraviolet light, and the characteristic emissions of Sm3+ ions are observed at 564 nm, 598 nm and 645 nm, corresponding to 4G5/2 → 6H5/2, 4G5/2 → 6H7/2 and 4G5/2 → 6H9/2 transitions, respectively. The 4G5/2 → 6H9/2 transitions shows the greatest intensity, which indicates that Sm3+ ions occupy the noncentrosymmetric sites. The optimal doping concentration of Sm3+ ions in Ba2ZnWO6 is about 5 mol% and the phenomenon of concentration quenching occurs when the content of Sm3+ ions exceeds 5 mol%. All results show that the Ba2ZnWO6:Sm3+ phosphor holds great promise for use in high-quality white light-emitting diodes.
NCBI nr-aa BLAST: CBRC-CREM-01-1328 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CREM-01-1328 ref|YP_045146.1| pH adaptation potassium efflux system transmembr...ane protein [Acinetobacter sp. ADP1] emb|CAG67324.1| pH adaptation potassium efflux system transmembrane protein [Acinetobacter sp. ADP1] YP_045146.1 1e-133 85% ...
Heavy metal and antibiotic resistance of Acinetobacter spp. isolated from diesel fuel polluted
Directory of Open Access Journals (Sweden)
Kais Kassim Ghaima
2018-04-01
Full Text Available Heavy metals pollution of soil and wastewater is a global problem that threatens the environment as they are not degraded or removed and the potential threat to human health comes from the multiple resistances to heavy metals and antibiotics among bacterial populations. The present study was aimed to isolate and identify multiple metal/antibiotic resistant Acinetobacter spp. from diesel fuel polluted soil of Al-Dora, Baghdad, Iraq. Initially, a total of 24 bacterial cultures (coded KNZ–1 to KNZ–24 were isolated and identified up to genus level as Acinetobacter by morphological, physiological and biochemical characteristics. Screening of heavy metals resistant Acinetobacter were conducted by streaking the isolates on nutrient agar plates supplemented with different concentrations: 10, 25, 50 and 100mg/L of the three heavy metals; Hg2+, Cd2+ and Pb2+. Out of 24 isolates, 6 (25% isolates (KNZ–3, KNZ–5, KNZ–8, KNZ–12, KNZ–16 and KNZ–21 were selected as a multiple heavy metal resistant (MHMR Acinetobacter with maximum tolerable concentrations (MTCs; 100–200mg/L for Hg2+, 300-600mg/L for Cd2+ and 100–300mg/L for Pb2+. Antibiotic resistance pattern of the selected MHMR isolates was determined by Kirby-Bauer disc diffusion method against 12 different antibiotics belonging to 7 classes. Out of 6 isolates, 4 isolates were multidrug resistance (MDR with varying degrees. Among them isolate, KNZ–16 showed a wide range of resistance to all tested antibiotics except Levofloxacin and Imipenem. It was concluded that dual resistant Acinetobacter is useful in the bioremediation of environments polluted with heavy metals especially the biodegradation of organic pollutants.
HDDR in Sm-Co alloys - a new method for magnetic hardening of Sm-Co permanent magnets
Energy Technology Data Exchange (ETDEWEB)
Kubis, M.; Handstein, A.; Gebel, B.; Mueller, K.-H.; Schultz, L. [Institut fuer Festkoerper- und Werkstofforschung Dresden e.V. (Germany). Inst. fuer Metallische Werkstoffe; Gutfleisch, O. [Institut fuer Festkoerper- und Werkstofforschung Dresden e.V. (Germany). Inst. fuer Metallische Werkstoffe]|[Birmingham Univ. (United Kingdom). School of Metallurgy and Materials
1998-07-01
Investigations on the hydrogen absorption behavior of different Sm-Co alloys with 1:5 and 2:17 structure by differential scanning calorimetry (DSC) at enhanced hydrogen pressures between 1 MPa and 7 MPa indicated different hydrogen absorption events. X-ray diffraction (XRD) studies and microstructural investigations showed clearly the disproportionation of the Sm-Co phases into Sm hydride and Co or Co-rich phases for hydrogen pressures above 0.5 MPa. The favourable effect of high hydrogen pressures can be explained in terms of a decrease of the free enthalpy of the samarium hydride for increasing hydrogen pressures. Additionally, Sm-Co alloys of both types were reactively milled under hydrogen at enhanced temperatures. The reactively milled powders showed again the products of the disproportionation reaction. A recombination of Sm-Co phases by removing the hydrogen in a second heat treatment was successful for both methods. Investigations of the magnetic properties showed coercivities {mu}{sub OJ}H{sub C} of up to 2.1 T for high pressure HDDR powders of SmCo{sub 5} material, demonstrating clearly the positive effect of the hydrogen treatment on the coercivity. The reactively milled powders showed for recombination temperatures {<=}700 C a remanence enhancement which could be attributed to the exchange coupling of the nanoscaled grains. A maximum coercivity {mu}{sub OJ}H{sub C} of 3.7 T was achieved for SmCo{sub 5} and a maximum energy product (BH){sub max} of 82 kJ/m{sup 3} was measured for an Sm-rich Sm{sub 2}Co{sub 17} sample. (orig.)
HDDR in Sm-Co alloys - a new method for magnetic hardening of Sm-Co permanent magnets
International Nuclear Information System (INIS)
Kubis, M.; Handstein, A.; Gebel, B.; Mueller, K.-H.; Schultz, L.; Gutfleisch, O.; Birmingham Univ.
1998-01-01
Investigations on the hydrogen absorption behavior of different Sm-Co alloys with 1:5 and 2:17 structure by differential scanning calorimetry (DSC) at enhanced hydrogen pressures between 1 MPa and 7 MPa indicated different hydrogen absorption events. X-ray diffraction (XRD) studies and microstructural investigations showed clearly the disproportionation of the Sm-Co phases into Sm hydride and Co or Co-rich phases for hydrogen pressures above 0.5 MPa. The favourable effect of high hydrogen pressures can be explained in terms of a decrease of the free enthalpy of the samarium hydride for increasing hydrogen pressures. Additionally, Sm-Co alloys of both types were reactively milled under hydrogen at enhanced temperatures. The reactively milled powders showed again the products of the disproportionation reaction. A recombination of Sm-Co phases by removing the hydrogen in a second heat treatment was successful for both methods. Investigations of the magnetic properties showed coercivities μ OJ H C of up to 2.1 T for high pressure HDDR powders of SmCo 5 material, demonstrating clearly the positive effect of the hydrogen treatment on the coercivity. The reactively milled powders showed for recombination temperatures ≤700 C a remanence enhancement which could be attributed to the exchange coupling of the nanoscaled grains. A maximum coercivity μ OJ H C of 3.7 T was achieved for SmCo 5 and a maximum energy product (BH) max of 82 kJ/m 3 was measured for an Sm-rich Sm 2 Co 17 sample. (orig.)
Directory of Open Access Journals (Sweden)
E. Dahdouh
2014-01-01
Full Text Available The aim of this study was to determine the usefulness of the MPC of carbapenems against clinical isolates of Pseudomonas spp. and Acinetobacter spp. and to assess its possible relationship with mechanisms of resistance. Detection of the mechanisms of resistance was performed using Antibiotic Susceptibility Testing, Double Disk Synergy, disk antagonism, addition of NaCl to the medium, addition of PBA or EDTA to Carbapenem disks, addition of PBA to Cefoxitin disks, and CCCP test for 10 Pseudomonas spp. and Acinetobacter baumannii strains. The MIC and MPC were determined using the broth macrodilution and plate dilution methods, respectively. Four Acinetobacter baumannii strains produced MBL. Two of them produced Oxacillinase and one produced ESBL. Two Pseudomonas spp. isolates produced both KPC and MBL. The resistant Acinetobacter spp. and Pseudomonas spp. strains had higher MPC values than susceptible ones. However, the Mutant Selection Window was found to be dependent on the degree of resistance but not on a particular mechanism of resistance. The usefulness of the MPC was found to be dependent on its value. Based on our data, we recommend determining the MPC for each isolate before using it during treatment. Furthermore, the use of T>MSW instead of T>MIC is suggested.
Jia, Yanyan; Bai, Zhenqing; Pei, Tianlin; Ding, Kai; Liang, Zongsuo; Gong, Yuehua
2017-01-01
Subclass III members of the sucrose non-fermenting-1-related protein kinase 2 (SnRK2) play essential roles in both the abscisic acid signaling and abiotic stress responses of plants by phosphorylating the downstream ABA-responsive element (ABRE)-binding proteins (AREB/ABFs). This comprehensive study investigated the function of new candidate genes, namely SmSnRK2.3 , SmSnRK2.6 , and SmAREB1 , with a view to breeding novel varieties of Salvia miltiorrhiza with improved stress tolerance stresses and more content of bioactive ingredients. Exogenous ABA strongly induced the expression of these genes. PlantCARE predicted several hormones and stress response cis -elements in their promoters. SmSnRK2.6 and SmAREB1 showed the highest expression levels in the leaves of S. miltiorrhiza seedlings, while SmSnRK2.3 exhibited a steady expression in their roots, stems, and leaves. A subcellular localization assay revealed that both SmSnRK2.3 and SmSnRK2.6 were located in the cell membrane, cytoplasm, and nucleus, whereas SmAREB1 was exclusive to the nucleus. Overexpressing SmSnRK2.3 did not significantly promote the accumulation of rosmarinic acid (RA) and salvianolic acid B (Sal B) in the transgenic S. miltiorrhiza hairy roots. However, overexpressing SmSnRK2.6 and SmAREB1 increased the contents of RA and Sal B, and regulated the expression levels of structural genes participating in the phenolic acid-branched and side-branched pathways, including SmPAL1 , SmC4H , Sm4CL1 , SmTAT , SmHPPR , SmRAS , SmCHS , SmCCR , SmCOMT , and SmHPPD . Furthermore, SmSnRK2.3 and SmSnRK2.6 interacted physically with SmAREB1. In summary, our results indicate that SmSnRK2.6 is involved in stress responses and can regulate structural gene transcripts to promote greater metabolic flux to the phenolic acid-branched pathway, via its interaction with SmAREB1 , a transcription factor. In this way, SmSnRK2.6 contributes to the positive regulation of phenolic acids in S. miltiorrhiza hairy roots.
Directory of Open Access Journals (Sweden)
Yanyan Jia
2017-08-01
Full Text Available Subclass III members of the sucrose non-fermenting-1-related protein kinase 2 (SnRK2 play essential roles in both the abscisic acid signaling and abiotic stress responses of plants by phosphorylating the downstream ABA-responsive element (ABRE-binding proteins (AREB/ABFs. This comprehensive study investigated the function of new candidate genes, namely SmSnRK2.3, SmSnRK2.6, and SmAREB1, with a view to breeding novel varieties of Salvia miltiorrhiza with improved stress tolerance stresses and more content of bioactive ingredients. Exogenous ABA strongly induced the expression of these genes. PlantCARE predicted several hormones and stress response cis-elements in their promoters. SmSnRK2.6 and SmAREB1 showed the highest expression levels in the leaves of S. miltiorrhiza seedlings, while SmSnRK2.3 exhibited a steady expression in their roots, stems, and leaves. A subcellular localization assay revealed that both SmSnRK2.3 and SmSnRK2.6 were located in the cell membrane, cytoplasm, and nucleus, whereas SmAREB1 was exclusive to the nucleus. Overexpressing SmSnRK2.3 did not significantly promote the accumulation of rosmarinic acid (RA and salvianolic acid B (Sal B in the transgenic S. miltiorrhiza hairy roots. However, overexpressing SmSnRK2.6 and SmAREB1 increased the contents of RA and Sal B, and regulated the expression levels of structural genes participating in the phenolic acid-branched and side-branched pathways, including SmPAL1, SmC4H, Sm4CL1, SmTAT, SmHPPR, SmRAS, SmCHS, SmCCR, SmCOMT, and SmHPPD. Furthermore, SmSnRK2.3 and SmSnRK2.6 interacted physically with SmAREB1. In summary, our results indicate that SmSnRK2.6 is involved in stress responses and can regulate structural gene transcripts to promote greater metabolic flux to the phenolic acid-branched pathway, via its interaction with SmAREB1, a transcription factor. In this way, SmSnRK2.6 contributes to the positive regulation of phenolic acids in S. miltiorrhiza hairy roots.
Afshar, Fatemeh Farid; Saffarian, Parvaneh; Hosseini, Hamideh Mahmoodzadeh; Sattarian, Fereshteh; Amin, Mohsen; Fooladi, Abbas Ali Imani
2016-08-01
Acinetobacter spp. are important causes of nosocomial infections. They possess various antibiotic resistance mechanisms including extended spectrum beta lactamases (ESBLs). The aim of this study was to determine antibiotic resistance profile of Acinetobacter clinical isolates especially among ESBL-producing strains and to investigate the antimicrobial effects of oleo-gum-resin extract and essential oil of Ferula gummosa Boiss. 120 Acinetobacter strains were isolated from various clinical samples of hospitalized patients in Baqiyatallah hospital, Tehran during 2011-2012. Antibiotic susceptibility test was performed on the isolates using disk diffusion method. To detect and confirm the ESBL-positive isolates, phenotypic and genotypic tests were performed. Three types of F. gummosa oleo-gum-resin extracts and essential oils were prepared and the bioactive components of F. gummosa Boiss extracts were determined by GC-Mass chromatography. F. gummosa antimicrobial activity was evaluated against standard strain of Acinetobacter baumannii (ATCC19606) as well as Acinetobacter clinical isolates using well and disk diffusion methods. Minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC) were determined by broth microdilution method. 46 isolates were resistant to all tested antibiotics. All clinical isolates were resistant to cefotaxime. 12.94% of the isolates were phenotypically ESBL-producing among which 94.2% carried ESBL genes ( bla PER-1 , bla OXA-4 and bla CTX-M ) detected by PCR. Oleo-gum-resin of F. gummosa had significant antibacterial activity and alcoholic essential oil had higher inhibitory effect on Acinetobacter strains (MIC of 18.75 mg/ml). Ferula gummosa extract contained components with well-known antimicrobial effects.
Suljagić, Vesna; Jevtić, Miodrag; Djordjević, Boban; Romić, Predrag; Ilić, Radoje; Stanković, Nebojsa; Milović, Novak; Novaković, Marijan; Kozarski, Jefta; Roganović, Zoran; Popović, Zoran; Jovelić, Aleksandra
2011-08-01
Acinetobacter spp. has emerged as nosocomial pathogen during the past few decades in hospitals all over the world, but it has increasingly been implicated as a serious nosocomial pathogen in military hospitals. The aim of this study was to analyse and compare the surveillance data on Acinetobacter nosocomial colonization/infection (NCI) collected during the wartime with the data collected in peacetime. We conducted a prospective study of incidence of Acinetobacter spp. colonization/infection. Also, the two nested case-control studies were conducted. The patients with nosocomial infection (cases) were compared with those with nosocomial colonization (controls) during the two different periods, wartime and peacetime. The patients with NCI by Acinetobacter spp. were identified by the case-based surveillance. The surveillance covered all the patients in 6 surgical clinics. During the study periods a total of 166 patients had cultures that grew Acinetobacter spp. and the pooled rates of Acinetobacter spp. colonization and infection were significantly higher in wartime. When patients with NCI in wartime were compared with those with NCI in peacetime significant differences were observed. In the war year, the patients were more significantly males (p war and peace period.
Mohanty, Srujana; Maurya, Vijeta; Gaind, Rajni; Deb, Monorama
2013-11-15
Pseudomonas aeruginosa and Acinetobcter spp. are important nosocomial pathogens and carbapenem resistance is an emerging threat. Therapeutic options for infections with these isolates include colistin. This study was conducted to determine the prevalence of carbapenem resistance in P. aeruginosa and Acinetobacter spp. bloodstream isolates, phenotypically characterize the resistance mechanisms and evaluate the in vitro activity of colistin. Consecutive 145 (95 P.aeruginosa and 50 Acinetobacter spp.) non-repeat isolates were included. Antibiotic susceptibility testing was performed per CLSI guidelines. MIC for carbapenems and colistin was performed using Etest. Isolates showing reduced susceptibility or resistance to the carbapenems were tested for metallo-β-lactamase (MBL) production using imipenem-EDTA combined disk and MBL Etest. Carbapenem resistance was observed in 40% P. aeruginosa and 66.0% Acinetobacter spp. Carbapenem-resistant (CA-R) isolates were significantly (p carbapenem-susceptible isolates. Approximately half of the CA-R strains were multidrug-resistant, and 3.1-5.5% were resistant to all antibiotics tested. MBL was found in 76.3% and 69.7% of the P. aeruginosa and Acinetobacter spp., respectively. Colistin resistance was observed in three (6.0%) Acinetobacter isolates and eight (8.4%) P. aeruginosa. MIC50 for carbapenems were two to four times higher for MBL-positive compared to MBL-negative isolates, but no difference was seen in MIC for colistin. Carbapenem resistance was observed to be mediated by MBL in a considerable number of isolates. Colistin is an alternative for infections caused by CA-R isolates; however, MIC testing should be performed whenever clinical use of colistin is considered.
A novel orange emissive phosphor SrWO4:Sm3+ for white light-emitting diodes
International Nuclear Information System (INIS)
Ju Zhenghua; Wei Ruiping; Ma Jingxin; Pang Chaoran; Liu Weisheng
2010-01-01
Research highlights: → A novel orange emissive phosphor SrWO 4 :Sm 3+ was firstly reported. → The optics properties of Sm 3+ -doped SrWO 4 phosphor were successfully discussed. → The temperature-dependent luminescence indicates the phosphor exhibits a small thermal-quenching property. → The phosphor is a potential candidate as orange-emitting component for white LED. - Abstract: A novel orange emissive phosphor, Sm 3+ -doped SrWO 4 , was synthesized by high temperature solid-state reaction in air atmosphere. The excitation spectra show that the phosphors can be efficiently excited by ultraviolet and near-ultraviolet light, the optimized concentration is 4 mol%. Three emission peaks locate at 562, 596 and 642 nm, corresponding to CIE chromaticity coordinates of (x = 0.54, y = 0.46), which indicates the orange light emitting. The decay curves are well fitted with triple-exponential decay models. The quantum yield of the Sr 0.96 Sm 0.04 WO 4 phosphor is about 70.65% under excitation of 377 nm. Furthermore, the temperature-dependent luminescence indicates the phosphor exhibits a small thermal-quenching property. So the phosphor is able to be applied to UV-LED chip-based white light-emitting diodes.
Directory of Open Access Journals (Sweden)
Bindu Subhadra
2016-02-01
Full Text Available Acinetobacter is an important nosocomial, opportunistic human pathogen that is gradually gaining more attention as a major health threat worldwide. Quorum sensing (QS is a cell-cell communication system in which specific signaling molecules called autoinducers accumulate in the medium as the population density grows and control various physiological processes including production of virulence factors, biofilm and development of antibiotic resistance. The complex QS machinery in Acinetobacter is mediated by a two-component system which is homologous to the typical LuxI/LuxR system found in Gram-negative bacteria. This cell signaling system comprises of a sensor protein that functions as autoinducer synthase and a receptor protein which binds to the signal molecules, acyl homoserine lactones inducing a cascade of reactions. Lately, disruption of QS has emerged as an anti-virulence strategy with great therapeutic potential. Here, we depict the current understanding of the existing QS network in Acinetobacter and describe important anti-virulent strategies developed in order to effectively tackle this pathogen. In addition, the prospects of quorum quenching to control Acinetobacter infections is also been discussed.
SM-1420 computer conjugation with the ES-5017 magnetic tape storage device and the SM-6313 printer
International Nuclear Information System (INIS)
Zhurkin, V.V.; Safonov, A.A.; Troitskij, A.N.
1987-01-01
The flow sheets are given and the methods of the technical implementation of expansion units of SM 5002.4 controllers to connect NML ES-5017 and analogue-digital printer ATsPU SM-6818, respectively, to SM-1420 computer are described
Matsui, Mari; Suzuki, Masato; Suzuki, Masahiro; Yatsuyanagi, Jun; Watahiki, Masanori; Hiraki, Yoichi; Kawano, Fumio; Tsutsui, Atsuko; Shibayama, Keigo; Suzuki, Satowa
2018-02-01
Multidrug-resistant (MDR) Acinetobacter spp. have been globally disseminated in association with the successful clonal lineage Acinetobacter baumannii international clone II (IC II). Because the prevalence of MDR Acinetobacter spp. in Japan remains very low, we characterized all Acinetobacter spp. ( n = 866) from 76 hospitals between October 2012 and March 2013 to describe the entire molecular epidemiology of Acinetobacter spp. The most prevalent species was A. baumannii ( n = 645; 74.5%), with A. baumannii IC II ( n = 245) accounting for 28.3% of the total. Meropenem-resistant isolates accounted for 2.0% ( n = 17) and carried IS Aba1-bla OXA-23-like ( n = 10), bla IMP ( n = 4), or IS Aba1-bla OXA-51-like ( n = 3). Multilocus sequence typing of 110 representative A. baumannii isolates revealed the considerable prevalence of domestic sequence types (STs). A. baumannii IC II isolates were divided into the domestic sequence type 469 (ST469) ( n = 18) and the globally disseminated STs ST208 ( n = 14) and ST219 ( n = 4). ST469 isolates were susceptible to more antimicrobial agents, while ST208 and ST219 overproduced the intrinsic AmpC β-lactamase. A. baumannii IC II and some A. baumannii non-IC II STs (e.g., ST149 and ST246) were associated with fluoroquinolone resistance. This study revealed that carbapenem-susceptible A. baumannii IC II was moderately disseminated in Japan. The low prevalence of acquired carbapenemase genes and presence of domestic STs could contribute to the low prevalence of MDR A. baumannii A similar epidemiology might have appeared before the global dissemination of MDR epidemic lineages. In addition, fluoroquinolone resistance associated with A. baumannii IC II may provide insight into the significance of A. baumannii epidemic clones. Copyright © 2018 American Society for Microbiology.
Nemec, A; Urbásková, P; Grimont, F; Vránková, J; Melter, O; Schindler, J
1996-05-01
A collection of 95 strains of the Acinetobacter calcoaceticus-Acinetobacter baumannii complex, isolated between 1991 and 1993 in the Prague Burn Center (BC), was studied. Ninety-one strains were isolated from 43 patients: 50 of them from burnt sites, 22 from endotracheal tube, 13 from urine, 3 from blood and 3 from venous catheter, and 4 strains were isolated from the hospital environment and the nursing staff. The strains were classified by restriction endonuclease fingerprinting of total DNA, plasmid profile analysis, ribotyping, comparison of antibiograms, biotyping and according to epidemiological data, into 31 relatedness groups each of them including 1 to 29 strains, likely to be isolates of the same strain. None of the methods used enabled to distinguish all groups. The importance of the polyphasic approach is emphasized since three multiresistant strains, isolated almost simultaneously in the BC, needed at least two methods to be distinguished (e.g. ribotyping and biotyping). Twenty-eight representative strains of different groups were identified by ribotyping: 18 of them were allocated to genomospecies 2 (A. baumannii), 5 to genomospecies 3 and 5 to genomospecies 13 sensu Tjernberg and Ursing. Only A. baumannii was found to spread among patients. Strains of two multiresistant groups persisted in the BC throughout the period studied and strains of one of these groups were responsible for an outbreak in the autumn of 1993. The methods mentioned above were used to describe 12 multiresistant strains isolated in three hospital wards in other localities. When ribotyped these strains were identified as A. baumannii. The strains of the same origin were identical in their typing profiles while the strains of different origins were easy to differentiate using any of the above methods; nevertheless, 2 of these groups were almost identical to 2 groups of multiresistant strains isolated in the BC.
Småhuse: Indretning og funktion
DEFF Research Database (Denmark)
Hansen, Ernst Jan de Place; Sigbrand, Lone; Frandsen, Anne Kathrine
Denne anvisning omhandler generelle krav og anbefalinger til indretning og funktion af nybyggede småhuse i henhold til bestemmelserne i Bygningsreglement 2010 (BR10). Småhuse - Indretning og funktionSmåhuse omfatter fritliggende og sammenbyggede enfamiliehuse med lodret lejlighedsskel i indtil...
Excited states in 146Sm and 147Sm
International Nuclear Information System (INIS)
Kownacki, J.; Sujkowski, Z.; Hammaren, E.; Liukkonen, E.; Piiparinen, M.; Lindblad, Th.; Ryde, H.
1979-10-01
The sup(144,146)Nd(α,xn) and sup(146,148)Nd( 3 He,xn) reactions with Esub(α) = 20 - 43 MeV and E 3 sub(He) = 19 - 27 MeV are used to investigate excited states in the isotopes 146 Sm and 147 Sm. The experiments involve measurements of singles γ-ray spectra and conversion electron spectra, γ-ray angular distributions and three parameter (E sub(γ)E sub(γ) time) coincidences. From these experiments information is obtained for states with spin up to I = 13 + and I = 27/2 - , respectively, These states are interpeted within the framework of the cluster-vibration model (CVM) as well as the shell model. (author)
Directory of Open Access Journals (Sweden)
Renata Souto
2014-06-01
Full Text Available P. aeruginosa and Acinetobacter spp. are important pathogens associated with late nosocomial pneumonia in hospitalized and institutionalized individuals. The oral cavity may be a major source of these respiratory pathogens, particularly in the presence of poor oral hygiene and periodontal infection. This study investigated the prevalence of P. aeruginosa and Acinetobacter spp. in subgingival biofilm and saliva of subjects with periodontal disease or health. Samples were obtained from 55 periodontally healthy (PH and 169 chronic periodontitis (CP patients. DNA was obtained from the samples and detection of P. aeruginosa and Acinetobacter spp. was carried out by multiplex and nested PCR. P. aeruginosa and Acinetobacter spp. were detected in 40% and 45% of all samples, respectively. No significant differences in the distribution of these microorganisms between men and women, subgingival biofilm and saliva samples, patients 35 years of age, and smokers and non-smokers were observed regardless periodontal status (p > 0.05. In contrast, the frequencies of P. aeruginosa and Acinetobacter spp. in saliva and biofilm samples were significantly greater in CP than PH patients (p < 0.01. Smokers presenting P. aeruginosa and high frequencies of supragingival plaque were more likely to present CP than PH. P. aeruginosa and Acinetobacter spp. are frequently detected in the oral microbiota of CP. Poor oral hygiene, smoking and the presence of P. aeruginosa are strongly associated with periodontitis.
NCBI nr-aa BLAST: CBRC-DSIM-04-0090 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-04-0090 ref|ZP_01847048.1| binding-protein-dependent transport systems in...ner membrane component [Methylobacterium sp. 4-46] gb|EDK94432.1| binding-protein-dependent transport systems
Kimura, Yui; Harada, Kazuki; Shimizu, Takae; Sato, Tomomi; Kajino, Akari; Usui, Masaru; Tamura, Yutaka; Tsuyuki, Yuzo; Miyamoto, Tadashi; Ohki, Asami; Watarai, Masahisa
2018-05-12
We investigated the prevalence of virulence factors and antimicrobial resistance among 67 Acinetobacter spp. isolates, consisting of 21 Acinetobacter baumannii and 46 non-baumannii Acinetobacter from companion animals. The PCR analysis showed that the most prevalent virulence gene was afa/draBC (29.9%), followed by papC (22.4%) and cvaC (20.9%). Antimicrobial susceptibility testing revealed that resistance to gentamicin (14.9%) and ciprofloxacin (11.9%) was relatively prevalent. Five gentamicin- and/or ciprofloxacin-resistant A. baumannii strains were assigned to ST25, ST149, ST164, ST203, and ST1198. All ciprofloxacin-resistant isolates harbored point mutations in gyrA and/or parC. This is the first preliminary monitoring of animal-origin Acinetobacter spp. in Japan. © 2018 The Societies and John Wiley & Sons Australia, Ltd.
Weigle Reactivation in Acinetobacter Calcoaceticus
DEFF Research Database (Denmark)
Berenstein, Dvora
1982-01-01
phage and host survivals of about 5 times 10-6 and 1 times 10-1, respectively. Intracellular development of W-reactivated P78 was followed by one-step growth experiments. Conditions which allowed maximal W-reactivation also extended the period of phage production and yielded a somewhat reduced burst......Weigle (W)-reactivation was demonstrated in Acinetobacter calcoaceticus for the UV-irra-diated lysogenic phage P78. The reactivation factor (survival of irradiated phage on irradiated bacteria/ survival on unirradiated bacteria) reached a maximum value of 20. This was obtained at UV-doses giving...
Directory of Open Access Journals (Sweden)
Akram A. Da’dara
2014-03-01
Full Text Available Schistosomes are parasitic worms that can survive in the hostile environment of the human bloodstream where they appear refractory to both immune elimination and thrombus formation. We hypothesize that parasite migration in the bloodstream can stress the vascular endothelium causing this tissue to release chemicals alerting responsive host cells to the stress. Such chemicals are called damage associated molecular patterns (DAMPs and among the most potent is the proinflammatory mediator, adenosine triphosphate (ATP. Furthermore, the ATP derivative ADP is a pro-thrombotic molecule that acts as a strong activator of platelets. Schistosomes are reported to possess at their host interactive tegumental surface a series of enzymes that could, like their homologs in mammals, degrade extracellular ATP and ADP. These are alkaline phosphatase (SmAP, phosphodiesterase (SmNPP-5 and ATP diphosphohydrolase (SmATPDase1. In this work we employ RNAi to knock down expression of the genes encoding these enzymes in the intravascular life stages of the parasite. We then compare the abilities of these parasites to degrade exogenously added ATP and ADP. We find that only SmATPDase1-suppressed parasites are significantly impaired in their ability to degrade these nucleotides. Suppression of SmAP or SmNPP-5 does not appreciably affect the worms’ ability to catabolize ATP or ADP. These findings are confirmed by the functional characterization of the enzymatically active, full-length recombinant SmATPDase1 expressed in CHO-S cells. The enzyme is a true apyrase; SmATPDase1 degrades ATP and ADP in a cation dependent manner. Optimal activity is seen at alkaline pH. The Km of SmATPDase1 for ATP is 0.4 ± 0.02 mM and for ADP, 0.252 ± 0.02 mM. The results confirm the role of tegumental SmATPDase1 in the degradation of the exogenous pro-inflammatory and pro-thrombotic nucleotides ATP and ADP by live intravascular stages of the parasite. By degrading host inflammatory signals
Copper Resistance of the Emerging Pathogen Acinetobacter baumannii
Williams, Caitlin L.; Neu, Heather M.; Gilbreath, Jeremy J.; Michel, Sarah L. J.; Zurawski, Daniel V.
2016-01-01
ABSTRACT Acinetobacter baumannii is an important emerging pathogen that is capable of causing many types of severe infection, especially in immunocompromised hosts. Since A. baumannii can rapidly acquire antibiotic resistance genes, many infections are on the verge of being untreatable, and novel therapies are desperately needed. To investigate the potential utility of copper-based antibacterial strategies against Acinetobacter infections, we characterized copper resistance in a panel of recent clinical A. baumannii isolates. Exposure to increasing concentrations of copper in liquid culture and on solid surfaces resulted in dose-dependent and strain-dependent effects; levels of copper resistance varied broadly across isolates, possibly resulting from identified genotypic variation among strains. Examination of the growth-phase-dependent effect of copper on A. baumannii revealed that resistance to copper increased dramatically in stationary phase. Moreover, A. baumannii biofilms were more resistant to copper than planktonic cells but were still susceptible to copper toxicity. Exposure of bacteria to subinhibitory concentrations of copper allowed them to better adapt to and grow in high concentrations of copper; this copper tolerance response is likely achieved via increased expression of copper resistance mechanisms. Indeed, genomic analysis revealed numerous putative copper resistance proteins that share amino acid homology to known proteins in Escherichia coli and Pseudomonas aeruginosa. Transcriptional analysis revealed significant upregulation of these putative copper resistance genes following brief copper exposure. Future characterization of copper resistance mechanisms may aid in the search for novel antibiotics against Acinetobacter and other highly antibiotic-resistant pathogens. IMPORTANCE Acinetobacter baumannii causes many types of severe nosocomial infections; unfortunately, some isolates have acquired resistance to almost every available antibiotic
Copper Resistance of the Emerging Pathogen Acinetobacter baumannii.
Williams, Caitlin L; Neu, Heather M; Gilbreath, Jeremy J; Michel, Sarah L J; Zurawski, Daniel V; Merrell, D Scott
2016-10-15
Acinetobacter baumannii is an important emerging pathogen that is capable of causing many types of severe infection, especially in immunocompromised hosts. Since A. baumannii can rapidly acquire antibiotic resistance genes, many infections are on the verge of being untreatable, and novel therapies are desperately needed. To investigate the potential utility of copper-based antibacterial strategies against Acinetobacter infections, we characterized copper resistance in a panel of recent clinical A. baumannii isolates. Exposure to increasing concentrations of copper in liquid culture and on solid surfaces resulted in dose-dependent and strain-dependent effects; levels of copper resistance varied broadly across isolates, possibly resulting from identified genotypic variation among strains. Examination of the growth-phase-dependent effect of copper on A. baumannii revealed that resistance to copper increased dramatically in stationary phase. Moreover, A. baumannii biofilms were more resistant to copper than planktonic cells but were still susceptible to copper toxicity. Exposure of bacteria to subinhibitory concentrations of copper allowed them to better adapt to and grow in high concentrations of copper; this copper tolerance response is likely achieved via increased expression of copper resistance mechanisms. Indeed, genomic analysis revealed numerous putative copper resistance proteins that share amino acid homology to known proteins in Escherichia coli and Pseudomonas aeruginosa Transcriptional analysis revealed significant upregulation of these putative copper resistance genes following brief copper exposure. Future characterization of copper resistance mechanisms may aid in the search for novel antibiotics against Acinetobacter and other highly antibiotic-resistant pathogens. Acinetobacter baumannii causes many types of severe nosocomial infections; unfortunately, some isolates have acquired resistance to almost every available antibiotic, and treatment options
A Pathogenic Potential of Acinetobacter baumannii-Derived Membrane Vesicles
Directory of Open Access Journals (Sweden)
Jong Suk Jin
2011-12-01
Full Text Available Acinetobacter baumannii secretes outer membrane vesicles (OMVs. A. baumannii OMVs deliver many virulence factors to host cells and then induce cytotoxicity and innate immune response. OMVs secreted from bacteria contribute directly to host pathology during A. baumannii infection.
The Genomic Diversification of the Whole Acinetobacter Genus: Origins, Mechanisms, and Consequences
Touchon, Marie; Cury, Jean; Yoon, Eun-Jeong; Krizova, Lenka; Cerqueira, Gustavo C.; Murphy, Cheryl; Feldgarden, Michael; Wortman, Jennifer; Clermont, Dominique; Lambert, Thierry; Grillot-Courvalin, Catherine; Nemec, Alexandr; Courvalin, Patrice; Rocha, Eduardo P.C.
2014-01-01
Bacterial genomics has greatly expanded our understanding of microdiversification patterns within a species, but analyses at higher taxonomical levels are necessary to understand and predict the independent rise of pathogens in a genus. We have sampled, sequenced, and assessed the diversity of genomes of validly named and tentative species of the Acinetobacter genus, a clade including major nosocomial pathogens and biotechnologically important species. We inferred a robust global phylogeny and delimited several new putative species. The genus is very ancient and extremely diverse: Genomes of highly divergent species share more orthologs than certain strains within a species. We systematically characterized elements and mechanisms driving genome diversification, such as conjugative elements, insertion sequences, and natural transformation. We found many error-prone polymerases that may play a role in resistance to toxins, antibiotics, and in the generation of genetic variation. Surprisingly, temperate phages, poorly studied in Acinetobacter, were found to account for a significant fraction of most genomes. Accordingly, many genomes encode clustered regularly interspaced short palindromic repeats (CRISPR)-Cas systems with some of the largest CRISPR-arrays found so far in bacteria. Integrons are strongly overrepresented in Acinetobacter baumannii, which correlates with its frequent resistance to antibiotics. Our data suggest that A. baumannii arose from an ancient population bottleneck followed by population expansion under strong purifying selection. The outstanding diversification of the species occurred largely by horizontal transfer, including some allelic recombination, at specific hotspots preferentially located close to the replication terminus. Our work sets a quantitative basis to understand the diversification of Acinetobacter into emerging resistant and versatile pathogens. PMID:25313016
Early Start Denver Model - intervention for de helt små børn med autisme
DEFF Research Database (Denmark)
Brynskov, Cecilia
2015-01-01
Early Start Denver Model (ESDM) er en autismespecifik interventionsmetode, som er udviklet til helt små børn med autisme (0-4 år). Metoden fokuserer på at styrke den tidlige kontakt og barnets motivation, og den arbejder målrettet med de socio-kommunikative forløbere for sprog og med den tidlige...
Yadzir, Z. H. M.; Shukor, M. Y.; Nazir, M. S.; Abdullah, M. A.
2012-09-01
A new indigenous bacterial strain from Malaysian soil contaminated with petroleum waste had been successfully isolated, characterized and identified for phenol removal. The gram negative bacteria showed 98% identity with Acinetobacter baumannii based on Biolog{trade mark, serif} Identification System and the determination of a partial 16S ribosomal RNA (rRNA) sequence. The isolate clustered with species belonging to Acinetobacter clade in a 16S rDNA-based neighbour-joining phylogenetic tree.
Ghosh, Sarit K.; Mallick, Kaushik; Tiwari, B.; Sinha, E.; Rout, S. K.
2018-01-01
Lead free ceramics Ba1-x Ln2x/3Zr0.3Ti0.7O3 (Ln = La, Nd, Sm, Eu and Sc), x = 0.02-0.10 are investigated for electrostrictive effect and energy storage properties in the proximity of relaxor-paraelectric phase boundary. Relaxor phase evidence from slim hysteresis loop and low remnant polarization are the key parameters responsible for improve the electrostrictive effect and energy storage properties simultaneously. With increase in rare earth content negative strain disappeared and almost hysteresis free strain is achieved. Strain-hysteresis profile in term of S-E, S-E 2 and S-P 2 is used to analyze the electrostrictive behavior of these ceramics. An average strain (S%) ˜ 0.03%, is accomplished at initial concentrations of x = 0.02-0.04 and electrostrictive coefficients (Q 11, and M 11) as well as the energy storage density is improved by a factor of 1.2 and 2.6 respectively when compare with pure (x = 0.0) ceramic. Above x ≥ 0.06, all compositions show a stable behavior which suggested the possibilities of these relaxor ceramics towards high precision actuators and energy storage application.
Rare cutaneous infection by Acinetobacter baumannii in an immunocompetent patient: a case report
Cirino, Pablo Vitoriano; Guimarães, Newton Sales; Follador, Ivonise
2008-01-01
O Acinetobacter baumanni é patógeno oportunista antigamente considerado de baixa virulência. Atualmente está envolvido em processos infecciosos que acometem pacientes imunocomprometidos,grandes queimados e pacientes em unidades de terapia intensiva que fazem uso de ventilação mecânica. Esse relato de caso chama atenção para infecção cutânea rara por essa bactéria em paciente imunocompetente.Acinetobacter baumannii is an oportunistic pathogen that used to be considered as having low virulence;...
International Nuclear Information System (INIS)
Zhao Kui; Guo Jiyu; Lu Xiuqin; Cheng Yehao; Huang Xiaolin; Ma Yong; Li Shuyuan; Ruan Ming; Li Zhichang; Jiang Chenglie
1997-01-01
A preliminary result was reported for the experiment to determine the mass of the heavier neutron-rich nucleus 158 Sm using the 160 Gd( 18 O, 20 Ne) two proton transfer reaction in last progress report. The average Q-value of (4.046 +- 0.102) MeV for the 160 Gd( 18 O, 20 Ne) 158 Sm reaction is given. A mass excess for 158 Sm of (-65.738 +- 0.102) MeV was derived. This is the first experimentally measured value of the mass of 158 Sm which is about 450 keV higher than the evaluation value from systematic trends listed in the 1993 atomic mass table. The new prediction shows better agreement with the measured values and a significant improvement over the earlier FRDM (finite-range droplet model) value
Durn, Goran; Goic-Barisic, Ivana; Kovacic, Ana
2014-01-01
Over the past decade, bacteria of the genus Acinetobacter have emerged as a leading cause of hospital-acquired infections. Outbreaks of Acinetobacter infections are considered to be caused exclusively by contamination and transmission in hospital environments. The natural habitats of clinically important multiresistant Acinetobacter spp. remain to be defined. In this paper, we report an incidental finding of a viable multidrug-resistant strain of Acinetobacter baumannii, related to clinical isolates, in acid paleosol from Croatia. The environmental isolate of A. baumannii showed 87% similarity to a clinical isolate originating from a hospital in this geographic area and was resistant to gentamicin, trimethoprim-sulfamethoxazole, ciprofloxacin, and levofloxacin. In paleosol, the isolate was able to survive a low pH (3.37), desiccation, and a high temperature (50°C). The probable source of A. baumannii in paleosol is illegally disposed waste of external origin situated in the abandoned quarry near the sampling site. The bacteria could have been leached from waste by storm water and thus infiltrated the paleosol. PMID:24584245
Carbapenem-resistance and pathogenicity of bovine Acinetobacter indicus-like isolates.
Directory of Open Access Journals (Sweden)
Peter Klotz
Full Text Available The objective of this study was to characterize blaOXA-23 harbouring Acinetobacter indicus-like strains from cattle including genomic and phylogenetic analyses, antimicrobial susceptibility testing and evaluation of pathogenicity in vitro and in vivo. Nasal and rectal swabs (n = 45 from cattle in Germany were screened for carbapenem-non-susceptible Acinetobacter spp. Thereby, two carbapenem resistant Acinetobacter spp. from the nasal cavities of two calves could be isolated. MALDI-TOF mass spectrometry and 16S rDNA sequencing identified these isolates as A. indicus-like. A phylogenetic tree based on partial rpoB sequences indicated closest relation of the two bovine isolates to the A. indicus type strain A648T and human clinical A. indicus isolates, while whole genome comparison revealed considerable intraspecies diversity. High mimimum inhibitory concentrations were observed for carbapenems and other antibiotics including fluoroquinolones and gentamicin. Whole genome sequencing and PCR mapping revealed that both isolates harboured blaOXA-23 localized on the chromosome and surrounded by interrupted Tn2008 transposon structures. Since the pathogenic potential of A. indicus is unknown, pathogenicity was assessed employing the Galleria (G. mellonella infection model and an in vitro cytotoxicity assay using A549 human lung epithelial cells. Pathogenicity in vivo (G. mellonella killing assay and in vitro (cytotoxicity assay of the two A. indicus-like isolates was lower compared to A. baumannii ATCC 17978 and similar to A. lwoffii ATCC 15309. The reduced pathogenicity of A. indicus compared to A. baumannii correlated with the absence of important virulence genes encoding like phospholipase C1+C2, acinetobactin outer membrane protein BauA, RND-type efflux system proteins AdeRS and AdeAB or the trimeric autotransporter adhesin Ata. The emergence of carbapenem-resistant A. indicus-like strains from cattle carrying blaOXA-23 on transposable elements and
2018 Status Report of NP04 (ProtoDUNE-SP)
Touramanis, C
2018-01-01
The NP04 Liquid Argon TPC has been constructed in the CERN Neutrino Facility and is in final preparation for taking beam data before the end of the current beam period at CERN. Progress in the last twelve months, current status, and plans are presented.
Directory of Open Access Journals (Sweden)
Bersissa Kumsa
Full Text Available This study was conducted to determine the presence of Acinetobacter and Rickettsia species DNA in lice and Melophagus ovinus (sheep ked of animals from Oromia Regional State in Ethiopia. From September through November 2011, a total of 207 cattle, 85 sheep, 47 dogs and 16 cats were examined for ectoparasites. Results of morphological identification revealed several species of ectoparasites: Linognathus vituli (L. vituli, Bovicola bovis (B. bovis and Solenopotes capillatus (S. capillatus on cattle; B. ovis and Melophagus ovinus (M. ovinus on sheep; and Heterodoxus spiniger (H. spiniger on dogs. There was a significantly (p≤0.0001 higher prevalence of L. vituli observed in cattle than both S. capillatus and B. bovis. Molecular identification of lice using an 18S rRNA gene analysis confirms the identified lice species by morphological methods. We detected different Acinetobacter species among lice (11.1% and keds (86.4% including A. soli in L. vituli of cattle, A. lowffii in M. ovinus of sheep, A. pittii in H. spiniger of dogs, 1 new Acinetobacter spp. in M. ovinus and 2 new Acinetobacter spp. in H. spiniger of dogs using partial rpoB gene sequence analysis. There was a significantly higher prevalence of Acinetobacter spp. in keds than in lice (p≤0.00001. Higher percentage of Acinetobacter spp. DNA was detected in H. spiniger than in both B. ovis and L. vituli (p≤0.00001. Carbapenemase resistance encoding genes for blaOXA-23, blaOXA-24, blaOXA-58, blaNDM-1 and blaOXA-51 were not found in any lice and keds. These findings suggest that synanthropic animals and their ectoparasites might increase the risk of human exposure to zoonotic pathogens and could be a source for Acinetobacter spp. infections in humans. However, additional epidemiological data are required to determine whether ectoparasites of animals can act as environmental reservoirs and play a role in spreading these bacteria to both animal and human hosts.
Kumsa, Bersissa; Socolovschi, Cristina; Parola, Philippe; Rolain, Jean-Marc; Raoult, Didier
2012-01-01
This study was conducted to determine the presence of Acinetobacter and Rickettsia species DNA in lice and Melophagus ovinus (sheep ked) of animals from Oromia Regional State in Ethiopia. From September through November 2011, a total of 207 cattle, 85 sheep, 47 dogs and 16 cats were examined for ectoparasites. Results of morphological identification revealed several species of ectoparasites: Linognathus vituli (L. vituli), Bovicola bovis (B. bovis) and Solenopotes capillatus (S. capillatus) on cattle; B. ovis and Melophagus ovinus (M. ovinus) on sheep; and Heterodoxus spiniger (H. spiniger) on dogs. There was a significantly (p≤0.0001) higher prevalence of L. vituli observed in cattle than both S. capillatus and B. bovis. Molecular identification of lice using an 18S rRNA gene analysis confirms the identified lice species by morphological methods. We detected different Acinetobacter species among lice (11.1%) and keds (86.4%) including A. soli in L. vituli of cattle, A. lowffii in M. ovinus of sheep, A. pittii in H. spiniger of dogs, 1 new Acinetobacter spp. in M. ovinus and 2 new Acinetobacter spp. in H. spiniger of dogs using partial rpoB gene sequence analysis. There was a significantly higher prevalence of Acinetobacter spp. in keds than in lice (p≤0.00001). Higher percentage of Acinetobacter spp. DNA was detected in H. spiniger than in both B. ovis and L. vituli (p≤0.00001). Carbapenemase resistance encoding genes for blaOXA-23, blaOXA-24, blaOXA-58, blaNDM-1 and blaOXA-51 were not found in any lice and keds. These findings suggest that synanthropic animals and their ectoparasites might increase the risk of human exposure to zoonotic pathogens and could be a source for Acinetobacter spp. infections in humans. However, additional epidemiological data are required to determine whether ectoparasites of animals can act as environmental reservoirs and play a role in spreading these bacteria to both animal and human hosts.
Celulitis por Acinetobacter junii-johnsonii adquirida en la comunidad: una presentación de caso
Directory of Open Access Journals (Sweden)
Andrés F. Henao-Martínez
2012-06-01
Full Text Available La infección de piel y tejidos blandos por Acinetobacter no relacionada con trauma es una presentación inusual. La mayoría de los casos descritos presentan enfermedades concomitantes y son causados por Acinetobacter baumanii. Se describe un caso de celulitis no traumática por A. junii-johnsonii con bacteriemia, de inicio en la comunidad y asociado con el tratamiento médico. De acuerdo con nuestro conocimiento, éste sería el primer caso reportado de infección de tejidos blandos y piel por A. juniijohnsonii.La vesícula hemorrágica podría ser una característica clínica de celulitis por Acinetobacter. doi: http://dx.doi.org/10.7705/biomedica.v32i2.652
Pneumonia adquirida na comunidade numa criança saudável por Acinetobacter
Directory of Open Access Journals (Sweden)
G. Moreira Silva
2012-03-01
Full Text Available Resumo: O género Acinetobacter tem sido implicado numa grande variedade de doenças infecciosas, em particular, nas infecções associadas aos cuidados de saúde. Actualmente há evidência a enfatizar o papel deste microrganismo nas infecções adquiridas na comunidade.à relatado o caso de uma criança previamente saudável, de 28 meses de idade, internada por febre associada a tosse e dor localizada no hemitórax esquerdo e cuja radiografia torácica revelou pneumonia necrotisante do lobo inferior. A investigação diagnóstica efetuada permitiu o diagnóstico de Pneumonia adquirida na comunidade a Acinetobacter lwoffii.A criança partilhava frequentemente o seu equipamento respiratório com familiares idosos com doença pulmonar crónica obstrutiva. Dado não terem sido apurados outros factores de risco, considera-se que a partilha do equipamento poderá ter sido o foco infeccioso.Os autores pretendem alertar para a possibilidade de Pneumonia adquirida na comunidade por Acinetobacter lwoffii, numa criança previamente saudável, relacionada com o mau uso e limpeza dos nebulizadores. Este caso realça o papel emergente desta bactéria, mesmo no contexto comunitário. Abstract: Acinetobacter is involved in a variety of infectious diseases primarily associated with healthcare. Recently there has been increasing evidence of the important role these pathogens play in community acquired infections.We report on the case of a previously healthy child, aged 28 months, admitted for fever, cough and pain on the left side of the chest, which on radiographic examination corresponded to a lower lobe necrotizing pneumonia. After detailed diagnostic workâup, community acquired Acinetobacter lwoffii pneumonia was diagnosed.The child had frequently shared respiratory equipment with elderly relatives with chronic obstructive pulmonary disease. As there were no other apparent risk factors, it could
Directory of Open Access Journals (Sweden)
Shaheda Anwar
2010-01-01
Full Text Available There are no standard methods for the detection of metallo-b-lactamase (MBL production in gram negative organism in routine microbiology practice. The present study was undertaken to evaluate the screening tests like double disk synergy test (DDST and disk potentiation test (DPT using ceftazidime (CAZ and imipenem (IPM disks with chelating agents like EDTA, 2-mercaptopropionic acid (2-MPA. A total of 132 Pseudomonas and 76 Acinetobacter isolates were obtained from Bangabandhu Sheikh Mujib Medical University (BSMMU and Bangladesh Institute of Research and Rehabilitation for Diabetes, Endocrine and Metabolic Disorders (BIRDEM hospitals of Dhaka city. A total of 53 and 29 IPM resistant Pseudomonas and Acinetobacter isolates were selected. EDTA-IPM microdilution minimum inhibitory concentration (EDTA-IPM MIC method detected MBL in 44 (83% IPM resistant Pseudomonas and 19 (65.5% Acinetobacter isolates. DDST with CAZ-0.1M EDTA and CAZ-2-MPA detected MBL in 73.6% and 67.9% of IPM resistant Pseudomonas and 55.2% and 48.3% of Acinetobacter isolates respectively. The detection rate was 67.9% and 66.1% in Pseudomonas and 51.7% and 44.8% in Acinetobacter isolates by EDTA-IPM and IPM-2-MPA methods respectively. In comparison to DDST, DPT with CAZ-0.1M EDTA showed higher sensitivity (89.7% and specificity (100% for detection of MBL in Pseudomonas and Acinetobacter. The results showed that simple screening tests like DPT with 0.1M EDTA was able to detect MBL producing Pseudomonas and Acinetobacter from clinical samples with high sensitivity and specificity. Ibrahim Med. Coll. J. 2010; 4(1: 26-30
Acinetobacter species in the hospital environment : tracing and epidemiology.
L. Dijkshoorn-de Bruin (Lenie)
1990-01-01
textabstractIn the course of the investigation a new taxonomic classification of Acinetobacter strains was introduced. The groups of this classification were established on the basis of DNA-DNA hybridization data of strains. In a final study of the present thesis, we investigated whether cell
Preparation and quality control of {sup 153}Sm radiopharmaceuticals
Energy Technology Data Exchange (ETDEWEB)
Swasono, R Tamat; Widyastuti, W; Purwadi, B; Laksmi, I [Radioisotope Production Center - BATAN, Jakarta (Indonesia)
1998-10-01
The paper summarizes the preparation and quality control of {sup 153}Sm-EDTMP and three {sup 153}Sm-radiosynovectomy agents. Natural and enriched Sm{sub 2}O{sub 3} (98.7% {sup 152}Sm) irradiated in RSG-GAS 30 MW reactor yielded pure and high specific activity {sup 153}Sm. Labeling of EDTMP with {sup 153}Sm was carried out by mixing {sup 153}SmCl{sub 3} solution of pH 4.0 to an EDTMP solution at room temperature then pH adjustment to 8. The {sup 153}Sm-EDTMP complex was separated from the free {sup 153}Sm{sup +3} on a Chelex 100 column. Radiochemical purity was determined by thin layer chromatography using Cellulose sheets and pyridine: ethanol: water (1: 2: 4) mixture as solvent. The {sup 153}Sm-EDTMP has been shown to be stable for two weeks. Three particulate preparations of {sup 153}Sm used for the irradiation of chronic synovitis have been studied. They are hydroxyapatite particles, human serum albumin microspheres and ferric hydroxide macroaggregates. The {sup 153}Sm-ferric hydroxide macroaggregates were prepared in a single step by coprecipitation of {sup 153}Sm in the formation of Fe(OH){sub 3}. Preparation of {sup 153}Sm-labelled hydroxyapatite particles and {sup 153}Sm-labelled albumin microspheres were carried out by {sup 153}Sm labelling of previously prepared particles. Radiolabelling efficiency were greater than 95% for hydroxyapatite particles and macroaggregates and was lower than 20% for albumin microspheres. The particle sizes were inspected using an optical microscope with a haemocytometer and micrometric ocular. (author)
Endophthalmitis caused by Acinetobacter baumanni: a case series.
Roy, R; Panigrahi, P; Malathi, J; Pal, S S; Nandi, K; Patil, A; Nigam, E; Arora, V
2013-03-01
To profile the etiology, clinical outcomes and drug sensitivity patterns in endophthalmitis caused by Acinetobacter baumanni. Retrospective analysis of all the cases of Acinetobacter baumanni endophthalmitis presenting to tertiary referral care ophthalmic hospital in Eastern India from January 2009 to December 2011 were done. A total of four cases were included in the study. Out of the four cases one was post traumatic and the rest were post cataract surgery. All the cases underwent vitreoretinal surgical intervention followed by intravitreal antibiotics. A. Baumanni was isolated from vitreous in all the cases. Among all the drugs tested bacteria were found sensitive to ciprofloxacin (100 %) whereas all tested resistant to ceftazidime. Out of the four cases one had to be eviscerated, another developed retinal detachment post vitrectomy, one was phthisical at final followup, and only one patient achieved a vision of 20/200 with clear media and attached retina at final visit. A. Baumanni is a very rare cause of endophthalmitis with poor visual and anatomical outcomes. Ciprofloxacin should be considered as first the line intravitreal antibiotic.
Raza, Rizwan; Abbas, Ghazanfar; Liu, Qinghua; Patel, Imran; Zhu, Bin
2012-06-01
Nanocomposite based cathode materials compatible for low temperature solid oxide fuel cells (LTSOFCs) are being developed. In pursuit of compatible cathode, this research aims to synthesis and investigation nanocomposite La0.3Sr0.2Mn0.1Zn0.4 oxide-Sm0.2Ce0.8O1.9 (LSMZ-SDC) based system. The material was synthesized through wet chemical method and investigated for oxide-ceria composite based electrolyte LTSOFCs. Electrical property was studied by AC electrochemical impedance spectroscopy (EIS). The microstructure, thermal properties, and elemental analysis of the samples were characterized by TGA/DSC, XRD, SEM, respectively. The AC conductivity of cathode was obtained for 2.4 Scm(-1) at 550 degrees C in air. This cathode is compatible with ceria-based composite electrolytes and has improved the stability of the material in SOFC cathode environment.
The genomic diversification of the whole Acinetobacter genus: origins, mechanisms, and consequences.
Touchon, Marie; Cury, Jean; Yoon, Eun-Jeong; Krizova, Lenka; Cerqueira, Gustavo C; Murphy, Cheryl; Feldgarden, Michael; Wortman, Jennifer; Clermont, Dominique; Lambert, Thierry; Grillot-Courvalin, Catherine; Nemec, Alexandr; Courvalin, Patrice; Rocha, Eduardo P C
2014-10-13
Bacterial genomics has greatly expanded our understanding of microdiversification patterns within a species, but analyses at higher taxonomical levels are necessary to understand and predict the independent rise of pathogens in a genus. We have sampled, sequenced, and assessed the diversity of genomes of validly named and tentative species of the Acinetobacter genus, a clade including major nosocomial pathogens and biotechnologically important species. We inferred a robust global phylogeny and delimited several new putative species. The genus is very ancient and extremely diverse: Genomes of highly divergent species share more orthologs than certain strains within a species. We systematically characterized elements and mechanisms driving genome diversification, such as conjugative elements, insertion sequences, and natural transformation. We found many error-prone polymerases that may play a role in resistance to toxins, antibiotics, and in the generation of genetic variation. Surprisingly, temperate phages, poorly studied in Acinetobacter, were found to account for a significant fraction of most genomes. Accordingly, many genomes encode clustered regularly interspaced short palindromic repeats (CRISPR)-Cas systems with some of the largest CRISPR-arrays found so far in bacteria. Integrons are strongly overrepresented in Acinetobacter baumannii, which correlates with its frequent resistance to antibiotics. Our data suggest that A. baumannii arose from an ancient population bottleneck followed by population expansion under strong purifying selection. The outstanding diversification of the species occurred largely by horizontal transfer, including some allelic recombination, at specific hotspots preferentially located close to the replication terminus. Our work sets a quantitative basis to understand the diversification of Acinetobacter into emerging resistant and versatile pathogens. © The Author(s) 2014. Published by Oxford University Press on behalf of the Society
Directory of Open Access Journals (Sweden)
Karolina Stojowska
Full Text Available We have designed a new ddLMS PCR (double digestion Ligation Mediated Suppression PCR method based on restriction site polymorphism upstream from the specific target sequence for the simultaneous identification and differentiation of bacterial strains. The ddLMS PCR combines a simple PCR used for species or genus identification and the LM PCR strategy for strain differentiation. The bacterial identification is confirmed in the form of the PCR product(s, while the length of the PCR product makes it possible to differentiate between bacterial strains. If there is a single copy of the target sequence within genomic DNA, one specific PCR product is created (simplex ddLMS PCR, whereas for multiple copies of the gene the fingerprinting patterns can be obtained (multiplex ddLMS PCR. The described ddLMS PCR method is designed for rapid and specific strain differentiation in medical and microbiological studies. In comparison to other LM PCR it has substantial advantages: enables specific species' DNA-typing without the need for pure bacterial culture selection, is not sensitive to contamination with other cells or genomic DNA, and gives univocal "band-based" results, which are easy to interpret. The utility of ddLMS PCR was shown for Acinetobacter calcoaceticus-baumannii (Acb complex, the genetically closely related and phenotypically similar species and also important nosocomial pathogens, for which currently, there are no recommended methods for screening, typing and identification. In this article two models are proposed: 3' recA-ddLMS PCR-MaeII/RsaI for Acb complex interspecific typing and 5' rrn-ddLMS PCR-HindIII/ApaI for Acinetobacter baumannii intraspecific typing. ddLMS PCR allows not only for DNA-typing but also for confirmation of species in one reaction. Also, practical guidelines for designing a diagnostic test based on ddLMS PCR for genotyping different species of bacteria are provided.
Stojowska, Karolina; Krawczyk, Beata
2014-01-01
We have designed a new ddLMS PCR (double digestion Ligation Mediated Suppression PCR) method based on restriction site polymorphism upstream from the specific target sequence for the simultaneous identification and differentiation of bacterial strains. The ddLMS PCR combines a simple PCR used for species or genus identification and the LM PCR strategy for strain differentiation. The bacterial identification is confirmed in the form of the PCR product(s), while the length of the PCR product makes it possible to differentiate between bacterial strains. If there is a single copy of the target sequence within genomic DNA, one specific PCR product is created (simplex ddLMS PCR), whereas for multiple copies of the gene the fingerprinting patterns can be obtained (multiplex ddLMS PCR). The described ddLMS PCR method is designed for rapid and specific strain differentiation in medical and microbiological studies. In comparison to other LM PCR it has substantial advantages: enables specific species' DNA-typing without the need for pure bacterial culture selection, is not sensitive to contamination with other cells or genomic DNA, and gives univocal "band-based" results, which are easy to interpret. The utility of ddLMS PCR was shown for Acinetobacter calcoaceticus-baumannii (Acb) complex, the genetically closely related and phenotypically similar species and also important nosocomial pathogens, for which currently, there are no recommended methods for screening, typing and identification. In this article two models are proposed: 3' recA-ddLMS PCR-MaeII/RsaI for Acb complex interspecific typing and 5' rrn-ddLMS PCR-HindIII/ApaI for Acinetobacter baumannii intraspecific typing. ddLMS PCR allows not only for DNA-typing but also for confirmation of species in one reaction. Also, practical guidelines for designing a diagnostic test based on ddLMS PCR for genotyping different species of bacteria are provided.
Acinetobacter infections prevalence and frequency of the antibiotics ...
African Journals Online (AJOL)
More than a half of the isolates were from the ICUs and were obtained from 293 infected patients of which 65, 2% (191 cases) were males (sex ratio = 1.9) and the median age was 56 years (interquartile range: 42-68 years). Acinetobacter clinical isolates were obtained from respiratory samples (44.67%) followed by blood ...
First report of an OXA-58 carbapenemase-producing Acinetobacter ...
African Journals Online (AJOL)
S. Natoubi
2016-11-18
Nov 18, 2016 ... urinary tract infection, in Morocco. Acinetobacter baumannii are organisms frequently found in the environment. This bacterium causes several types of infections, such as bacteremia, pneumonia and urinary tract infection [1]. Carbapenem resistance in A. baumannii is more often caused by the production of ...
Energy Technology Data Exchange (ETDEWEB)
Meza-Rocha, A.N., E-mail: ameza@fis.cinvestav.mx [Departamento de Física, Universidad Autónoma Metropolitana-Iztapalapa, P.O. Box 55-534, 09340 México D.F., México (Mexico); Speghini, A. [Dipartimento di Biotecnologie, Universita di Verona and INSTM, UdR Verona, Strada Le Grazie 15, I-37314 Verona (Italy); IFAC CNR, Nello Carrara Institute of Applied Physics, MDF Lab, I-50019 Sesto Fiorentino, FI (Italy); Bettinelli, M. [Dipartimento di Biotecnologie, Universita di Verona and INSTM, UdR Verona, Strada Le Grazie 15, I-37314 Verona (Italy); Caldiño, U. [Departamento de Física, Universidad Autónoma Metropolitana-Iztapalapa, P.O. Box 55-534, 09340 México D.F., México (Mexico)
2015-11-15
A spectroscopy study of Sm{sup 3+} and Sm{sup 3+}/Eu{sup 3+} doped zinc phosphate glasses is performed through photoluminescence spectra and decay time profile measurements. Under Sm{sup 3+} excitation at 344 nm, the Sm{sup 3+} singly doped glass shows an orange global emission with x=0.579 and y=0.414 CIE1931 chromaticity coordinates, whereas the Sm{sup 3+}/Eu{sup 3+} co-doped sample exhibits orange overall emissions (x=0.581 and y=0.398, and x=0.595 and y=0.387) and reddish-orange overall emission (x=0.634 and y=0.355) upon excitations at 344, 360 and 393 nm, respectively. Such luminescence from the co-doped sample is originated by the simultaneous emission of Sm{sup 3+} and Eu{sup 3+}. Under Sm{sup 3+} excitation at 344 and 360 nm, the Eu{sup 3+} emission is sensitized and enhanced by Sm{sup 3+} through a non-radiative energy transfer process. The non-radiative nature was inferred from the shortening of the Sm{sup 3+} lifetime observed in the Sm{sup 3+}/Eu{sup 3+} co-doped sample. An analysis of the Sm{sup 3+} emission decay time profiles using the Inokuti–Hirayama model suggests that an electric quadrupole–quadrupole interaction into Sm–Eu clusters might dominate the energy transfer process, with an efficiency of 0.17. - Highlights: • Zinc phosphate glasses are optically activated with Sm{sup 3+}/Eu{sup 3+} (ZPOSmEu). • Non-radiative energy transfer Sm{sup 3+}→Eu{sup 3+} takes place in ZPOSmEu. • ZPOSmEu overall emission can be modulated with the excitation wavelength. • ZPOSmEu might be useful as orange/reddish-orange phosphor for UV-white LEDs.
Probing metastable Sm2+ and optically stimulated tunnelling emission in YPO4: Ce, Sm
DEFF Research Database (Denmark)
Prasad, Amit Kumar; Kook, Myung Ho; Jain, Mayank
2017-01-01
When the model dosimetry system YPO4: Ce3+, Sm3+ is exposed to X-rays, the charge state of the dopants changes, becoming Ce4+ and Sm2+ via hole and electron trapping, respectively which are metastable; the original charge states can be achieved through electron transfer back from Sm2+ to Ce4+ via......) and its temperature dependence to provide insights into thermal quenching, and c) the kinetics of localised recombination from Sm2+ to Ce4+ on nanoseconds to seconds time scales using sub-band-edge excitation....
Luminescence properties of the Sm-doped borate glasses
International Nuclear Information System (INIS)
Kindrat, I.I.; Padlyak, B.V.; Drzewiecki, A.
2015-01-01
The optical absorption and photoluminescence (emission and excitation) spectra as well as decay kinetics of a series of the Sm-doped glasses with Li 2 B 4 O 7 , LiKB 4 O 7 , CaB 4 O 7 , and LiCaBO 3 compositions were investigated and analysed. The Li 2 B 4 O 7 :Sm, LiKB 4 O 7 :Sm, CaB 4 O 7 :Sm, and LiCaBO 3 :Sm glasses of high optical quality have been obtained from the corresponding polycrystalline compounds in the air atmosphere, using a standard glass technology. On the basis of electron paramagnetic resonance (EPR) and optical spectra analysis it was shown that the samarium impurity is incorporated into the glass network as Sm 3+ (4f 5 , 6 H 5/2 ) ions, exclusively. All observed 4f – 4f transitions of the Sm 3+ centres in the optical absorption and luminescence spectra of the investigated glasses are identified. Most intense emission band of the Sm 3+ ions peaked about 598 nm ( 4 G 5/2 → 6 H 7/2 transition) is characterised by a single exponential decay with typical lifetime values, which depend on the basic glass composition as well as concentration and local structure of the Sm 3+ luminescence centres. The quantum efficiency has been evaluated for observed transitions of the Sm 3+ centres using obtained experimental lifetimes and radiative lifetimes calculated by Judd–Ofelt theory. The calculated high quantum efficiencies and measured quantum yields of luminescence show that the investigated borate glasses are perspective luminescence materials. Energy transfer from the Ce 3+ non-controlled impurity and intrinsic luminescence centres to the Sm 3+ centres has been observed. Peculiarities of the Sm 3+ local structure in the network of investigated glasses have been discussed based on the obtained spectroscopic results and structural data. - Highlights: • The Sm-doped Li 2 B 4 O 7 , LiKB 4 O 7 , CaB 4 O 7 , and LiCaBO 3 glasses of high quality were obtained. • EPR, optical absorption and luminescence spectra of Sm 3+ ions in obtained glasses were
Acute toxicity of injection of 153Sm-EDTMP
International Nuclear Information System (INIS)
Chen Baiwei; Chai Xuehong
2004-01-01
Sm-153 has several distinct advantages as a radiopharmaceutical for the treat of patients with bone to skeletal metastasis. Sm-153 shows high skeletal uptake and rapid blood and nonosseous tissue clearance. Several paper have considered the toxicity of 153Sm-EDTMP. We report the acute toxicity in mice and rats after injection of 153Sm-EDTMP or unlabeled EDTMP. The EDTMP was injected to mice by 9.76, 7.8, 6.25, 5, 4 mg/Kg. The logarithmic dose of EDTMP were given to mice to determine LD50. The LD50 of EDTMP in mice is 7.1 mg/Kg. The decay of 153Sm-EDTMP for 4 months were injected to mice at dose of 225 mg/Kg. 153Sm-EDTMP were given at 4 difference dosage to rats by 74 MBq/Kg, 370 MBq/Kg, 1110 MBq/Kg, 1850 MBq/Kg. The LD50 of 153Sm-EDTMP in rats is more than 370 MBq/Kg. Although the cold EDTMP LD50 was low, chelated with Sm can decrease it's toxicity. The decay 153Sm-EDTMP can be safe at dose of 225 mg/Kg. The clinical dose will be used at 37 MBq/Kg. So there is no need to consider to acute toxicity in clinical used 153Sm-EDTMP in designated regimen because the safe range is wide enough to cover clinical used. (authors)
Molehin, Adebayo J; Sennoune, Souad R; Zhang, Weidong; Rojo, Juan U; Siddiqui, Arif J; Herrera, Karlie A; Johnson, Laura; Sudduth, Justin; May, Jordan; Siddiqui, Afzal A
2017-11-01
Schistosomiasis remains a major global health problem. Despite large-scale schistosomiasis control efforts, clear limitations such as possible emergence of drug resistance and reinfection rates highlight the need for an effective schistosomiasis vaccine. Schistosoma mansoni large subunit of calpain (Sm-p80)-based vaccine formulations have shown remarkable efficacy in protecting against S. mansoni challenge infections in mice and baboons. In this study, we evaluated the cross-species protective efficacy of Sm-p80 vaccine against S. japonicum and S. haematobium challenge infections in rodent models. We also elucidated the expression of Sm-p80 and Sm-p80 ortholog proteins in different developmental stages of S. mansoni, S. haematobium, and S. japonicum. Immunization with Sm-p80 vaccine reduced worm burden by 46.75% against S. japonicum challenge infection in mice. DNA prime/protein boost (1 + 1 dose administered on a single day) resulted in 26.95% reduction in worm burden in S. haematobium-hamster infection/challenge model. A balanced Th1 (IFN-γ, TNF-α, IL-2, and IL-12) and Th2 (IL-4, IgG1) type of responses were observed following vaccination in both S. japonicum and S. haematobium challenge trials and these are associated with the prophylactic efficacy of Sm-p80 vaccine. Immunohistochemistry demonstrated that Sm-p80/Sm-p80 ortholog proteins are expressed in different life cycle stages of the three major human species of schistosomes studied. The data presented in this study reinforce the potential of Sm-p80-based vaccine for both hepatic/intestinal and urogenital schistosomiasis occurring in different geographical areas of the world. Differential expression of Sm-p80/Sm-p80 protein orthologs in different life cycle makes this vaccine potentially useful in targeting different levels of infection, disease, and transmission.
Kim, Dae Hun; Ko, Kwan Soo
2015-07-01
To investigate pmrCAB sequence divergence in 5 species of Acinetobacter baumannii complex, a total of 80 isolates from a Korean hospital were explored. We evaluated nucleotide and amino acid polymorphisms of pmrCAB operon, and phylogenetic trees were constructed for each gene of prmCAB operon. Colistin and polymyxin B susceptibility was determined for all isolates, and multilocus sequence typing was also performed for A. baumannii isolates. Our results showed that each species of A. baumannii complex has divergent pmrCAB operon sequences. We identified a distinct pmrCAB allele allied with Acinetobacter nosocomialis in gene trees. Different grouping in each gene tree suggests sporadic recombination or emergence of pmrCAB genes among Acinetobacter species. Sequence polymorphisms among Acinetobacter species might not be associated with colistin resistance. We revealed that a distinct pmrCAB allele may be widespread across the continents such as North America and Asia and that sporadic genetic recombination or emergence of pmrCAB genes might occur. Copyright © 2015 Elsevier Inc. All rights reserved.
Fitzpatrick, Margaret A.; Hauser, Alan R.
2015-01-01
Acinetobacter baumannii frequently causes nosocomial infections and outbreaks. Whole-genome sequencing (WGS) is a promising technique for strain typing and outbreak investigations. We compared the performance of conventional methods with WGS for strain typing clinical Acinetobacter isolates and analyzing a carbapenem-resistant A. baumannii (CRAB) outbreak. We performed two band-based typing techniques (pulsed-field gel electrophoresis and repetitive extragenic palindromic-PCR), multilocus sequence type (MLST) analysis, and WGS on 148 Acinetobacter calcoaceticus-A. baumannii complex bloodstream isolates collected from a single hospital from 2005 to 2012. Phylogenetic trees inferred from core-genome single nucleotide polymorphisms (SNPs) confirmed three Acinetobacter species within this collection. Four major A. baumannii clonal lineages (as defined by MLST) circulated during the study, three of which are globally distributed and one of which is novel. WGS indicated that a threshold of 2,500 core SNPs accurately distinguished A. baumannii isolates from different clonal lineages. The band-based techniques performed poorly in assigning isolates to clonal lineages and exhibited little agreement with sequence-based techniques. After applying WGS to a CRAB outbreak that occurred during the study, we identified a threshold of 2.5 core SNPs that distinguished nonoutbreak from outbreak strains. WGS was more discriminatory than the band-based techniques and was used to construct a more accurate transmission map that resolved many of the plausible transmission routes suggested by epidemiologic links. Our study demonstrates that WGS is superior to conventional techniques for A. baumannii strain typing and outbreak analysis. These findings support the incorporation of WGS into health care infection prevention efforts. PMID:26699703
Koiwai, Kotaro; Hartmann, Marcus D.; Linke, Dirk; Lupas, Andrei N.; Hori, Katsutoshi
2016-01-01
Trimeric autotransporter adhesins (TAAs) on the cell surface of Gram-negative pathogens mediate bacterial adhesion to host cells and extracellular matrix proteins. However, AtaA, a TAA in the nonpathogenic Acinetobacter sp. strain Tol 5, shows nonspecific high adhesiveness to abiotic material surfaces as well as to biotic surfaces. It consists of a passenger domain secreted by the C-terminal transmembrane anchor domain (TM), and the passenger domain contains an N-terminal head, N-terminal stalk, C-terminal head (Chead), and C-terminal stalk (Cstalk). The Chead-Cstalk-TM fragment, which is conserved in many Acinetobacter TAAs, has by itself the head-stalk-anchor architecture of a complete TAA. Here, we show the crystal structure of the Chead-Cstalk fragment, AtaA_C-terminal passenger domain (CPSD), providing the first view of several conserved TAA domains. The YadA-like head (Ylhead) of the fragment is capped by a unique structure (headCap), composed of three β-hairpins and a connector motif; it also contains a head insert motif (HIM1) before its last inner β-strand. The headCap, Ylhead, and HIM1 integrally form a stable Chead structure. Some of the major domains of the CPSD fragment are inherently flexible and provide bending sites for the fiber between segments whose toughness is ensured by topological chain exchange and hydrophobic core formation inside the trimer. Thus, although adherence assays using in-frame deletion mutants revealed that the characteristic adhesive sites of AtaA reside in its N-terminal part, the flexibility and toughness of the CPSD part provide the resilience that enables the adhesive properties of the full-length fiber across a wide range of conditions. PMID:26698633
Study of fuel element characteristic of SM and SMP (SM-PRIMA) fuel assemblies
International Nuclear Information System (INIS)
Klinov, A.V.; Kuprienko, V.A.; Lebedev, V.A.; Makhin, V.M.; Tuchnin, L.M.; Tsykanov, V.A.
1999-01-01
The paper discusses the techniques and results of reactor tests and post-reactor investigations of the SM reactor fuel elements and fuel elements developed in the process of designing the specialized PRIMA test reactor with the SM reactor fuel elements used as a prototype and which are referred to as the SMP fuel elements. The behavior of fuel elements under normal operating conditions and under deviation from normal operating conditions was studied to verify the calculation techniques, to check the calculation results during preparation of the SM reactor safety substantiation report and to estimate the possibility of using such fuel elements in other projects. During tests of fuel rods under deviation from normal operating conditions their advantages were shown over fuel elements, the components of which were produced using the Al-based alloys. (author)
Evaluation of bacterial surfactant toxicity towards petroleum degrading microorganisms.
Lima, Tânia M S; Procópio, Lorena C; Brandão, Felipe D; Leão, Bruna A; Tótola, Marcos R; Borges, Arnaldo C
2011-02-01
The acute toxicity of bacterial surfactants LBBMA111A, LBBMA155, LBBMA168, LBBMA191 and LBBMA201 and the synthetic surfactant sodium dodecyl sulfate (SDS) on the bioluminescent bacterium Vibrio fischeri was evaluated by measuring the reduction of light emission (EC(20)) by this microorganism when exposed to different surfactant concentrations. Moreover, the toxic effects of different concentrations of biological and synthetic surfactants on the growth of pure cultures of isolates Acinetobacter baumannii LBBMA04, Acinetobacter junni LBBMA36, Pseudomonas sp. LBBMA101B and Acinetobacter baumanni LBBMAES11 were evaluated in mineral medium supplemented with glucose. The EC(20) values obtained confirmed that the biosurfactants have a significantly lower toxicity to V. fischeri than the SDS. After 30 min of exposure, bacterial luminescence was almost completely inhibited by SDS at a concentration of 4710 mg L(-1). Growth reduction of pure bacterial cultures caused by the addition of biosurfactants to the growth medium was lower than that caused by SDS. Copyright © 2010 Elsevier Ltd. All rights reserved.
Quorum sensing molecules production by nosocomial and soil isolates Acinetobacter baumannii.
Erdönmez, Demet; Rad, Abbas Yousefi; Aksöz, Nilüfer
2017-12-01
Acinetobacter species remain alive in hospitals on various surfaces, both dry and moist, forming an important source of hospital infections. These bacteria are naturally resistant to many antibiotic classes. Although the role of the quorum sensing system in regulating the virulence factors of Acinetobacter species has not been fully elucidated, it has been reported that they play a role in bacterial biofilm formation. The biofilm formation helps them to survive under unfavorable growth conditions and antimicrobial treatments. It is based on the accumulation of bacterial communication signal molecules in the area. In this study, we compared the bacterial signal molecules of 50 nosocomial Acinetobacter baumannii strain and 20 A. baumannii strain isolated from soil. The signal molecules were detected by the biosensor bacteria (Chromobacterium violaceum 026, Agrobacterium tumefaciens A136, and Agrobacterium tumefaciens NTL1) and their separation was determined by thin-layer chromatography. As a result, it has been found that soil-borne isolates can produce 3-oxo-C8-AHL and C8-AHL, whereas nosocomial-derived isolates can produce long-chain signals such as C10-AHL, C12-AHL, C14-AHL and C16-AHL. According to these results, it is possible to understand that these signal molecules are found in the infection caused by A. baumannii. The inhibition of this signaling molecules in a communication could use to prevent multiple antibiotic resistance of these bacteria.
Luminescence properties of the Sm-doped borate glasses
Energy Technology Data Exchange (ETDEWEB)
Kindrat, I.I. [University of Zielona Góra, Institute of Physics, Division of Spectroscopy of Functional Materials, 4a Szafrana Street, 65-516 Zielona Góra (Poland); Padlyak, B.V., E-mail: B.Padlyak@if.uz.zgora.pl [University of Zielona Góra, Institute of Physics, Division of Spectroscopy of Functional Materials, 4a Szafrana Street, 65-516 Zielona Góra (Poland); Vlokh Institute of Physical Optics, 23 Dragomanov Street, 79-005 Lviv (Ukraine); Drzewiecki, A. [University of Zielona Góra, Institute of Physics, Division of Spectroscopy of Functional Materials, 4a Szafrana Street, 65-516 Zielona Góra (Poland)
2015-10-15
The optical absorption and photoluminescence (emission and excitation) spectra as well as decay kinetics of a series of the Sm-doped glasses with Li{sub 2}B{sub 4}O{sub 7}, LiKB{sub 4}O{sub 7}, CaB{sub 4}O{sub 7}, and LiCaBO{sub 3} compositions were investigated and analysed. The Li{sub 2}B{sub 4}O{sub 7}:Sm, LiKB{sub 4}O{sub 7}:Sm, CaB{sub 4}O{sub 7}:Sm, and LiCaBO{sub 3}:Sm glasses of high optical quality have been obtained from the corresponding polycrystalline compounds in the air atmosphere, using a standard glass technology. On the basis of electron paramagnetic resonance (EPR) and optical spectra analysis it was shown that the samarium impurity is incorporated into the glass network as Sm{sup 3+} (4f{sup 5}, {sup 6}H{sub 5/2}) ions, exclusively. All observed 4f – 4f transitions of the Sm{sup 3+} centres in the optical absorption and luminescence spectra of the investigated glasses are identified. Most intense emission band of the Sm{sup 3+} ions peaked about 598 nm ({sup 4}G{sub 5/2} → {sup 6}H{sub 7/2} transition) is characterised by a single exponential decay with typical lifetime values, which depend on the basic glass composition as well as concentration and local structure of the Sm{sup 3+} luminescence centres. The quantum efficiency has been evaluated for observed transitions of the Sm{sup 3+} centres using obtained experimental lifetimes and radiative lifetimes calculated by Judd–Ofelt theory. The calculated high quantum efficiencies and measured quantum yields of luminescence show that the investigated borate glasses are perspective luminescence materials. Energy transfer from the Ce{sup 3+} non-controlled impurity and intrinsic luminescence centres to the Sm{sup 3+} centres has been observed. Peculiarities of the Sm{sup 3+} local structure in the network of investigated glasses have been discussed based on the obtained spectroscopic results and structural data. - Highlights: • The Sm-doped Li{sub 2}B{sub 4}O{sub 7}, LiKB{sub 4}O{sub 7}, Ca
Hasan, M J; Shamsuzzaman, S M
2017-12-01
The adeB gene in Acinetobacter baumannii regulates the bacterial internal drug efflux pump that plays a significant role in drug resistance. The aim of our study was to determine the occurrence of adeB gene in multidrug resistant and New Delhi metallo-beta-lactamase-1 (NDM- 1) gene in imipenem resistant Acinetobacter baumannii isolated from wound swab samples in a tertiary care hospital of Bangladesh. A total of 345 wound swab samples were tested for bacterial pathogens. Acinetobacter baumannii was identified by culture and biochemical tests. Antimicrobial susceptibility pattern was determined by the disc diffusion method according to CLSI standards. Extended spectrum beta-lactamases were screened using the double disc synergy technique. Gene encoding AdeB efflux pump and NDM-1 were detected by Polymerase Chain Reaction (PCR). A total 22 (6.37%) Acinetobacter baumannii were identified from 345 wound swab samples and 20 (91%) of them were multidrug resistant. High resistance rates to some antibiotics were seen namely, cefotaxime (95%), amoxyclavulanic acid (90%) and ceftriaxone (82%). All the identified Acinetobacter baumannii were sensitive to colistin and 82% to imipenem. Two (9%) ESBL producing Acinetobacter baumannii strains were detected. adeB gene was detected in 16 (80%) out of 20 multidrug resistant Acinetobacter baumannii. 4 (18%) of 22 Acinetobacter baumannii were imipenem resistant. NDM-1 gene was detected in 2 (50%) of the imipenem resistant strains of Acinetobacter baumannii. The results of this study provide insight into the role of adeB gene as a potential regulator of drug resistance in Acinetobacter baumanni in Bangladesh. NDM-1 gene also contributes in developing such resistance for Acinetobacter baumannii.
DEFF Research Database (Denmark)
Larsen, Inge Marie
2001-01-01
Afhandlingen følger opbygningen af og udviklingen i den vestsibiriske smørsektor og den internationale handel med sibirisk smør. Hvordan gik det til, at Rusland blev verdens næststørste smøreksportør? Indfaldsvinkelen er lokal sibirisk, national russisk og global, idet danske og engelske firmaers...
Acinetobacter baumannii in Localised Cutaneous Mycobacteriosis in Falcons
Directory of Open Access Journals (Sweden)
Margit Gabriele Muller
2010-01-01
Full Text Available Between May 2007 and April 2009, 29 falcons with identically localized, yellowish discolored cutaneous lesions in the thigh and lateral body wall region were presented at Abu Dhabi Falcon Hospital. Out of 18 falcons integrated in this study, 16 tested positive to Mycobacterium. avium complex. The 2 negative falcons tested positive in the Mycobacterium genus PCR. Moreover, 1 falcon tested positive to M. avium. paratuberculosis in tissue samples by PCR. In all cases, blood and fecal samples tested negative. In the acid-fast stain, all samples showed the for mycobacteriosis typical rods. Moreover, in 13 samples Acinetobacter baumannii was detected by PCR and proven by DNA sequencing. Clinical features included highly elevated WBCs, heterophilia, lymphocytopenia, monocytosis, severe anemia and weight loss. A. baumannii, a gram-negative bacillus with the ability to integrate foreign DNA, has emerged as one of the major multidrug resistant bacteria. In veterinary medicine, it has so far been detected in dogs, cats, horses and wild birds. To the authors' knowledge, this is the first report of an A. baumannii infection in falcons and of a veterinary Mycobacterium-Acinetobacter coinfection.
Directory of Open Access Journals (Sweden)
Dahraoui Souhail
2016-01-01
Full Text Available Treatment of Acinetobacter baumannii meningitis is an important challenge due to the accumulation of resistance of this bacteria and low meningeal diffusion of several antimicrobial requiring use of an antimicrobial effective combination to eradicate these species. We report a case of Acinetobacter baumannii multidrug-resistant nosocomial meningitis which was successfully treated with intravenous and intrathecal colistin associated with rifampicin.
The success of acinetobacter species; genetic, metabolic and virulence attributes.
Directory of Open Access Journals (Sweden)
Anton Y Peleg
Full Text Available An understanding of why certain Acinetobacter species are more successful in causing nosocomial infections, transmission and epidemic spread in healthcare institutions compared with other species is lacking. We used genomic, phenotypic and virulence studies to identify differences between Acinetobacter species. Fourteen strains representing nine species were examined. Genomic analysis of six strains showed that the A. baumannii core genome contains many genes important for diverse metabolism and survival in the host. Most of the A. baumannii core genes were also present in one or more of the less clinically successful species. In contrast, when the accessory genome of an individual A. baumannii strain was compared to a strain of a less successful species (A. calcoaceticus RUH2202, many operons with putative virulence function were found to be present only in the A. baumannii strain, including the csu operon, the acinetobactin chromosomal cluster, and bacterial defence mechanisms. Phenotype microarray analysis showed that compared to A. calcoaceticus (RUH2202, A. baumannii ATCC 19606(T was able to utilise nitrogen sources more effectively and was more tolerant to pH, osmotic and antimicrobial stress. Virulence differences were also observed, with A. baumannii ATCC 19606(T, A. pittii SH024, and A. nosocomialis RUH2624 persisting and forming larger biofilms on human skin than A. calcoaceticus. A. baumannii ATCC 19606(T and A. pittii SH024 were also able to survive in a murine thigh infection model, whereas the other two species were eradicated. The current study provides important insights into the elucidation of differences in clinical relevance among Acinetobacter species.
The Success of Acinetobacter Species; Genetic, Metabolic and Virulence Attributes
Peleg, Anton Y.; de Breij, Anna; Adams, Mark D.; Cerqueira, Gustavo M.; Mocali, Stefano; Galardini, Marco; Nibbering, Peter H.; Earl, Ashlee M.; Ward, Doyle V.; Paterson, David L.; Seifert, Harald; Dijkshoorn, Lenie
2012-01-01
An understanding of why certain Acinetobacter species are more successful in causing nosocomial infections, transmission and epidemic spread in healthcare institutions compared with other species is lacking. We used genomic, phenotypic and virulence studies to identify differences between Acinetobacter species. Fourteen strains representing nine species were examined. Genomic analysis of six strains showed that the A. baumannii core genome contains many genes important for diverse metabolism and survival in the host. Most of the A. baumannii core genes were also present in one or more of the less clinically successful species. In contrast, when the accessory genome of an individual A. baumannii strain was compared to a strain of a less successful species (A. calcoaceticus RUH2202), many operons with putative virulence function were found to be present only in the A. baumannii strain, including the csu operon, the acinetobactin chromosomal cluster, and bacterial defence mechanisms. Phenotype microarray analysis showed that compared to A. calcoaceticus (RUH2202), A. baumannii ATCC 19606T was able to utilise nitrogen sources more effectively and was more tolerant to pH, osmotic and antimicrobial stress. Virulence differences were also observed, with A. baumannii ATCC 19606T, A. pittii SH024, and A. nosocomialis RUH2624 persisting and forming larger biofilms on human skin than A. calcoaceticus. A. baumannii ATCC 19606T and A. pittii SH024 were also able to survive in a murine thigh infection model, whereas the other two species were eradicated. The current study provides important insights into the elucidation of differences in clinical relevance among Acinetobacter species. PMID:23144699
Curie temperature rising by fluorination for Sm2Fe17
Directory of Open Access Journals (Sweden)
Matahiro Komuro
2013-02-01
Full Text Available Fluorine atoms can be introduced to Sm2Fe17 using XeF2 below 423 K. The resulting fluorinated Sm2Fe17 powders have ferromagnetic phases containing Sm2Fe17FY1(0
Directory of Open Access Journals (Sweden)
Natan Raimundo Gonçalves de Assis
Full Text Available Schistosomiasis is an important parasitic disease worldwide that affects more than 207 million people in 76 countries and causes approximately 250,000 deaths per year. The best long-term strategy to control schistosomiasis is through immunization combined with drug treatment. Due to the ability of DNA vaccines to generate humoral and cellular immune responses, such vaccines are considered a promising approach against schistosomiasis. Sm29 and tetraspanin-2 (Sm-TSP2 are two proteins that are located in the S. mansoni tegument of adult worms and schistosomula and induce high levels of protection through recombinant protein immunization. In this study, we transfected BHK-21 cells with plasmids encoding Sm29, Sm-TSP2 or a chimera containing both genes. Using RT-PCR analysis and western blot, we confirmed that the DNA vaccine constructs were transcribed and translated, respectively, in BHK-21 cells. After immunization of mice, we evaluated the reduction in worm burden. We observed worm burden reductions of 17-22%, 22%, 31-32% and 24-32% in animals immunized with the pUMVC3/Sm29, pUMVC3/SmTSP-2, pUMVC3/Chimera and pUMVC3/Sm29 + pUMVC3/SmTSP-2 plasmids, respectively. We evaluated the humoral response elicited by DNA vaccines, and animals immunized with pUMVC3/Sm29 and pUMVC3/Sm29 + pUMVC3/SmTSP-2 showed higher titers of anti-Sm29 antibodies. The cytokine profile produced by the spleen cells of immunized mice was then evaluated. We observed higher production of Th1 cytokines, such as TNF-α and IFN-γ, in vaccinated mice and no significant production of IL-4 and IL-5. The DNA vaccines tested in this study showed the ability to generate a protective immune response against schistosomiasis, probably through the production of Th1 cytokines. However, future strategies aiming to optimize the protective response induced by a chimeric DNA construct need to be developed.
Gonçalves de Assis, Natan Raimundo; Batistoni de Morais, Suellen; Figueiredo, Bárbara Castro Pimentel; Ricci, Natasha Delaqua; de Almeida, Leonardo Augusto; da Silva Pinheiro, Carina; Martins, Vicente de Paulo; Oliveira, Sergio Costa
2015-01-01
Schistosomiasis is an important parasitic disease worldwide that affects more than 207 million people in 76 countries and causes approximately 250,000 deaths per year. The best long-term strategy to control schistosomiasis is through immunization combined with drug treatment. Due to the ability of DNA vaccines to generate humoral and cellular immune responses, such vaccines are considered a promising approach against schistosomiasis. Sm29 and tetraspanin-2 (Sm-TSP2) are two proteins that are located in the S. mansoni tegument of adult worms and schistosomula and induce high levels of protection through recombinant protein immunization. In this study, we transfected BHK-21 cells with plasmids encoding Sm29, Sm-TSP2 or a chimera containing both genes. Using RT-PCR analysis and western blot, we confirmed that the DNA vaccine constructs were transcribed and translated, respectively, in BHK-21 cells. After immunization of mice, we evaluated the reduction in worm burden. We observed worm burden reductions of 17-22%, 22%, 31-32% and 24-32% in animals immunized with the pUMVC3/Sm29, pUMVC3/SmTSP-2, pUMVC3/Chimera and pUMVC3/Sm29 + pUMVC3/SmTSP-2 plasmids, respectively. We evaluated the humoral response elicited by DNA vaccines, and animals immunized with pUMVC3/Sm29 and pUMVC3/Sm29 + pUMVC3/SmTSP-2 showed higher titers of anti-Sm29 antibodies. The cytokine profile produced by the spleen cells of immunized mice was then evaluated. We observed higher production of Th1 cytokines, such as TNF-α and IFN-γ, in vaccinated mice and no significant production of IL-4 and IL-5. The DNA vaccines tested in this study showed the ability to generate a protective immune response against schistosomiasis, probably through the production of Th1 cytokines. However, future strategies aiming to optimize the protective response induced by a chimeric DNA construct need to be developed. PMID:25942636
Directory of Open Access Journals (Sweden)
Monjuri Kataki
2017-02-01
Full Text Available BACKGROUND Acinetobacter infection have been clinically prominent pathogen in tropical countries have caused recurrent problems during wars and natural disasters and have recently caused multihospital outbreaks. Rational use of antimicrobial agents is clinically important to prevent Acinetobacter infections as well as to avoid poor outcomes. 1 The aim of the study is to see the prevalence of Acinetobacter as a pathogen in this tertiary care hospital, their susceptibility pattern along with prevalence of metallo-beta-lactamase. MATERIALS AND METHODS The samples were processed for a period of one year. Samples were collected from ICU including urine, sputum, endotracheal aspirate, BAL, blood, pus, body fluids (pleural fluid, CSF, etc. and the stool specimens were plated using appropriate culture media (MAC, BA, CLED, XLD. RESULTS Shows Acinetobacter baumannii is the significant species isolated is ICU among 700 cases, which yielded only 100% sensitivity to commonly used antibiotics. So, it is the need of the hour to implement infection control measures in a serious and intensive way. CONCLUSION So, it is the need of the hour to implement infection control measures in a serious and intensive way.
Directory of Open Access Journals (Sweden)
Shaheda Anwar
2010-07-01
Full Text Available The rapid spread of Metallo-b-lactamase (MBL producing Gram negative bacilli represents a matter of great concern worldwide. The study analyzed the occurrence of MBL production in carbapenem resistant Pseudomonas and Acinetobacter isolates over one year period. A total of 132 Pseudomonas and 76 Acinetobacter isolates were obtained from two tertiary care hospitals of Dhaka city. A total of 53 Pseudomonas and 29 Acinetobacter isolates were selected because of their resistance to carbapenem specially imipenem (IPM. Screening for MBL production was performed in these isolates by IPM-EDTA microdilution MIC method. 44 (83% IPM resistant Pseudomonas and 19 (65.5% Acinetobacter isolates were MBL producer by IPM-EDTA microdilution MIC method. These results suggest that MBL producing Pseudomonas and Acinetobacter isolates are emerging in our country and it is essential to screen carbapenem resistant isolates for MBL production. Ibrahim Med. Coll. J. 2010; 4(2: 63-65
Liu, Jyh-You; Wang, Fu-Der; Ho, Mao-Wang; Lee, Chen-Hsiang; Liu, Jien-Wei; Wang, Jann-Tay; Sheng, Wang-Huei; Hseuh, Po-Ren; Chang, Shan-Chwen
2016-12-01
Aminoglycosides possess in vitro activity against aerobic and facultative Gram-negative bacilli. However, nationwide surveillance on susceptibility data of Acinetobacter baumannii complex and Pseudomonas aeruginosa to aminoglycosides was limited, and aminoglycoside resistance has emerged in the past decade. We study the in vitro susceptibility of A. baumannii complex and other nonfermentative Gram-negative bacilli (NFGNB) to aminoglycosides. A total of 378 NFGNB blood isolates causing healthcare-associated bloodstream infections during 2008 and 2013 at four medical centers in Taiwan were tested for their susceptibilities to four aminoglycosides using the agar dilution method (gentamicin, amikacin, tobramycin, and isepamicin) and disc diffusion method (isepamicin). A. baumannii was highly resistant to all four aminoglycosides (range of susceptibility, 0-4%), whereas >80% of Acinetobacter nosocomialis and Acinetobacter pittii blood isolates were susceptible to amikacin (susceptibility: 96% and 91%, respectively), tobramycin (susceptibility: 92% and 80%, respectively), and isepamicin (susceptibility: 96% and 80%, respectively). All aminoglycosides except gentamicin possessed good in vitro activity (>94%) against P. aeruginosa. Amikacin has the best in vitro activity against P. aeruginosa (susceptibility, 98%), followed by A. nosocomialis (96%), and A. pittii (91%), whereas tobramycin and isepamicin were less potent against A. pittii (both 80%). Aminoglycoside resistances were prevalent in Stenotrophomonas maltophilia and Burkholderia cepacia complex blood isolates in Taiwan. Genospecies among the A. baumannii complex had heterogeneous susceptibility profiles to aminoglycosides. Aminoglycosides, except gentamicin, remained good in vitro antimicrobial activity against P. aeruginosa. Further in vivo clinical data and continuous resistance monitoring are warranted for clinical practice guidance. Copyright © 2015. Published by Elsevier B.V.
Yesim Cekin
2014-01-01
Aim: Acinetobacter species are amoung the most common two cause of infections isolated from patients of intensive care unit in our hospital. Doripenem which acts by inhibiting cell wall synthesis is resently introduced for use in our country is broad spectrum antibiotic belonging to carbapenems. There are many studies investigating the susceptibility of doripenem of Acinetobacter baumannii which is isolated as a cause of ventilatory associated pneumonia in the literature. We aimed to compare ...
Leaching kinetic of Nd. Y, Pr and Sm in rare earth hydroxide (REOH) use nitric acid
Purwani, MV; Suyanti
2018-02-01
The purpose of this study were to determine the order of reaction, rate reaction constant and activation energy of reaction Y(OH)3, Nd(OH)3, Pr(OH)3 and Sm(OH)3 with HNO3. The rate reaction constant is necessary to determine the residence time in the design of continuously stirred tank reactor (CSTR). The studied parameters were leaching temperature (60 - 90 °C) and leaching time (0-15 minutes). From the resulting data can be concluded that the leaching process were strongly influenced by the time and temperature process. Leaching rare earth hydroxide (REOH) using nitric acid follows second order. At leaching 10 grams of REOH using 40 ml HNO3 0.0576 mol were obtained maximum conversion at 90 °C and leaching time 15 minutes for Y was 0.95 (leaching efficiency was 95%), for Nd was 0.97 ( leaching efficiency was 97%), for Pr was 0.94 (leaching efficiency was 94%) and for Sm was 0.94 (leaching efficiency was 94%). The largest activation energy was Y of 23.34 kJ/mol followed by Pr of 20.00 kJ/mol, Sm of 17.94 kJ/mol and the smallest was Nd of 16.39 kJ/mol. The relationship between the rate constant of the reaction with T for Y was kY = 338.26 e-23,34/RT, for Nd was kNd = 33.69 e -16,39 / RT, for Pr was kPr = 102.04 e-20 / RT and for Sm adalah was kSm = 50.16 e-17,94/RT
Surussawadee, Janjira; Jindamorakot, Sasitorn; Nakase, Takashi; Lee, Ching-Fu; Limtong, Savitree
2015-07-01
Five strains representing one novel anamorphic yeast species were isolated from plant leaves collected in Thailand (strains DMKU-SP186(T), ST-111 and ST-201) and Taiwan (strains FN20L02 and SM13L16). On the basis of morphological, biochemical, physiological and chemotaxonomic characteristics and sequence analysis of the D1/D2 region of the large subunit (LSU) rRNA gene and the internal transcribed spacer (ITS) region, they were assigned to a single novel species of the genus Hannaella. The sequences of the D1/D2 regions of the LSU rRNA genes of four of the strains (DMKU-SP186(T), ST-111, FN20L02 and SM13L16) were identical, while differing from strain ST-201 by 2 substitutions and 2 gaps. The nucleotide sequence of the ITS regions of the five strains differed from each other by between 0 and 3 nucleotide substitutions. The novel species was most closely related to Hannaella luteola, but showed 1.0-1.3% nucleotide substitutions (between 6 substitutions out of 568-606 nt and 8 substitutions, and 2 gaps out of 597 nt) in the D1/D2 region of the LSU rRNA gene and 1.4-2.0% nucleotide substitutions (6-9 substitutions out of 435 nt) in the ITS region. Ballistospores were produced by three of the strains on cornmeal agar at 15 and 20 °C after 4 weeks, while H. luteola did not produce ballistospores. The name Hannaella phyllophila sp. nov. is proposed. The type strain is DMKU-SP186(T) ( = BCC 69500(T) = NBRC 110428(T) = CBS 13921(T)).
Directory of Open Access Journals (Sweden)
Sang-Yeop Lee
Full Text Available Burkholderia sp. K24, formerly known as Acinetobacter lwoffii K24, is a soil bacterium capable of utilizing aniline as its sole carbon and nitrogen source. Genomic sequence analysis revealed that this bacterium possesses putative gene clusters for biodegradation of various monocyclic aromatic hydrocarbons (MAHs, including benzene, toluene, and xylene (BTX, as well as aniline. We verified the proposed MAH biodegradation pathways by dioxygenase activity assays, RT-PCR, and LC/MS-based quantitative proteomic analyses. This proteogenomic approach revealed four independent degradation pathways, all converging into the citric acid cycle. Aniline and p-hydroxybenzoate degradation pathways converged into the β-ketoadipate pathway. Benzoate and toluene were degraded through the benzoyl-CoA degradation pathway. The xylene isomers, i.e., o-, m-, and p-xylene, were degraded via the extradiol cleavage pathways. Salicylate was degraded through the gentisate degradation pathway. Our results show that Burkholderia sp. K24 possesses versatile biodegradation pathways, which may be employed for efficient bioremediation of aniline and BTX.
Yun, Sung Ho; Choi, Chi-Won; Yi, Yoon-Sun; Kim, Jonghyun; Chung, Young-Ho; Park, Edmond Changkyun; Kim, Seung Il
2016-01-01
Burkholderia sp. K24, formerly known as Acinetobacter lwoffii K24, is a soil bacterium capable of utilizing aniline as its sole carbon and nitrogen source. Genomic sequence analysis revealed that this bacterium possesses putative gene clusters for biodegradation of various monocyclic aromatic hydrocarbons (MAHs), including benzene, toluene, and xylene (BTX), as well as aniline. We verified the proposed MAH biodegradation pathways by dioxygenase activity assays, RT-PCR, and LC/MS-based quantitative proteomic analyses. This proteogenomic approach revealed four independent degradation pathways, all converging into the citric acid cycle. Aniline and p-hydroxybenzoate degradation pathways converged into the β-ketoadipate pathway. Benzoate and toluene were degraded through the benzoyl-CoA degradation pathway. The xylene isomers, i.e., o-, m-, and p-xylene, were degraded via the extradiol cleavage pathways. Salicylate was degraded through the gentisate degradation pathway. Our results show that Burkholderia sp. K24 possesses versatile biodegradation pathways, which may be employed for efficient bioremediation of aniline and BTX. PMID:27124467
Fully dense anisotropic nanocomposite Sm(Co,Fe,Zr,Cu,B)z (z=7.5-12) magnets
International Nuclear Information System (INIS)
Huang, M.Q.; Turgut, Z.; Wheeler, B.; Lee, D.; Liu, S.; Ma, B.M.; Peng, Y.G.; Chu, S.Y.; Laughlin, D.E.; Horwath, J.C.; Fingers, R.T.
2005-01-01
Fully dense anisotropic nanocomposite Sm(Co 0.58 Fe 0.31 Zr 0.05 Cu 0.04 B 0.02 ) z (z=7.5-12) magnets have been synthesized via rapid hot pressing and hot deformation processes. The highest (BH) max ∼10.6 MGOe was observed for a magnet with z=10. X-ray diffraction and M-H measurements indicated that the easy magnetization direction of magnets prefers to be in the hot pressing direction. Transmission electron microscopy investigation confirmed that plastic deformation is an important route for forming magnetic anisotropy in the Sm-Co-type nanocomposite magnets. Some stripe and/or platelike patterns have been observed inside the nanograins (50-200 nm), which may present as twins, and stacking faults. The (0001) twins have been observed in the 2:17R phase
Directory of Open Access Journals (Sweden)
Carolina de Souza Gusatti
2009-04-01
Full Text Available Acinetobacter spp é um importante patógeno causador de infecções nosocomiais que acomete pacientes imunocomprometidos e capaz de adquirir resistência a antimicrobianos com facilidade. Os esgotos hospitalares são importantes disseminadores de genes de resistência a antimicrobianos para a microbiota ambiental. Neste contexto, 30 cepas de Acinetobacter spp provenientes de efluente de um hospital em Porto Alegre, RS, foram analisados quanto ao perfil de susceptibilidade a β-lactamases, quinolonas e aminoglicosídeos através de antibiograma e testes de triagem para metalo beta-lactamases e β-lactamases de espectro estendido. O perfil encontrado revela cepas multi-resistentes e que mecanismos de resistência como a produção de β-lactamases de espectro estendido e bombas de efluxo podem estar presentes nesses isolados.Acinetobacter spp is an important pathogen that is responsible for nosocomial infections affecting immunocompromised patients, and it can easily acquire resistance to antimicrobial agents. Hospital sewage is an important means for disseminating genes for resistance to antimicrobial agents, to the microbiota of the environment. Within this context, 30 strains of Acinetobacter spp from the sewage of a hospital in Porto Alegre, Rio Grande do Sul, were analyzed regarding their profile of susceptibility to β-lactams, quinolones and aminoglycosides, by means of an antibiogram and tests to screen for metallo-β-lactamases and extended-spectrum β-lactamases. The profile obtained revealed the presence of multidrug-resistant strains and showed that resistance mechanisms such as the production of extended-spectrum β-lactamases and efflux pumps may be present in these strains.
Magnetic properties of Sm-based filled skutterudite phosphides
Energy Technology Data Exchange (ETDEWEB)
Giri, R.; Sekine, C.; Shimaya, Y.; Shirotani, I.; Matsuhira, K.; Doi, Y.; Hinatsu, Y.; Yokoyama, M.; Amitsuka, H
2003-05-01
Filled skutterudites SmFe{sub 4}P{sub 12} and SmOs{sub 4}P{sub 12} have been prepared at high temperature and high pressure. The temperature dependence of electrical resistivity in both compounds shows metallic behavior. The magnetic susceptibility and specific heat measurements indicate that SmFe{sub 4}P{sub 12} shows a ferromagnetic ordering at 1.5 K, whereas SmOs{sub 4}P{sub 12} is an antiferromagnet with a T{sub N} of 4.6 K.
Infection with Acinetobacter baumannii in an intensive care unit in the Western part of Romania.
Lăzureanu, Voichița; Poroșnicu, Mirela; Gândac, Ciprian; Moisil, Teodora; Bădițoiu, Luminița; Laza, Ruxandra; Musta, Virgil; Crișan, Alexandru; Marinescu, Adelina-Raluca
2016-03-08
Acinetobacter baumannii is one of the main causes of morbidity and mortality in critical condition patients. The pathogen's ability to survive under a wide range of environment conditions and to persist for long periods of time on areas represents a frequent cause of endemic infection hotbeds especially in the Intensive Care Unit. The objectives of the study are: determining the 5-year incidence of A. baumannii infection in patients admitted in the ICU which needed mechanical ventilation; the analysis of these cases regarding pathological antecedents; processing the data regarding these cases; gradual analysis of the susceptibility/resistance of isolated A. baumannii strains; observing the emergence of A. baumannii infection in patients transferred into the ICU. We have performed an observational retrospective study regarding the incidence of Acinetobacter baumannii infections in the Intensive Care Unit of the Hospital of Infectious Diseases and Pneumophtisiology "Victor Babes" Timisoara, Clinic II Infectious Diseases, during June 2011 - June 2015. We have identified a high prevalence of Acinetobacter baumannii infection, with an average period of 6 days. Bronchial suction was the most common pathological product in the study (90 % of the cases). Resistance to antimicrobials has been determined: the lowest resistance was recorded for ampicillin + sulbactam (81.1 %), and the highest resistance rate was recorded for ceftazidime and imipenem (94.6 % each). When comparing resistance to third generation cephalosporins, the difference was not statistically significant (94.6 % for ceftazidime vs. 86.5 % for cefoperazone, p = 0.117). Within the present study we were able to observe a significantly high resistance of the germ to carbapenems, with a good sensitivity to aminoglycosides, and to colistin. Only one strain of Acinetobacter baumannii was resistant to all classes of tested antibiotics. Generally, carbapenems represented the elective treatment in
Ogutlu, Aziz; Guclu, Ertugrul; Karabay, Oguz; Utku, Aylin Calica; Tuna, Nazan; Yahyaoglu, Mehmet
2014-01-09
The consumption of carbapenems has increased worldwide, together with the increase in resistant gram negative bacilli. Subsequently, the prevalence of carbapenem-resistant Acinetobacter infections has increased rapidly and become a significant problem particularly in intensive care unit patients. The aim of the present study was to evaluate the changes in the prevalence of Acinetobacter infection by restricting the consumption of carbapenems in intensive care unit patients. This study was conducted between May 1, 2011 and February 28, 2013. The amount of carbapenem consumption and the number of patients with multi-drug resistant Acinetobacter baumannii (MDRAB) isolates during the study period were retrospectively obtained from the records of the patients, who were hospitalized in the intensive care unit. The study period was divided into two periods named as: Carbapenem non-restricted period (CNRP) and carbapenem-restricted period (CRP). During CNRP, no restrictions were made on the use of carbapenems. During CRP, the use of carbapenems was not allowed if there was an alternative to carbapenems. Primary Endpoint: MDRAB infection after ICU admission. The definition of nosocomial infections related to Acinetobacter spp. was based on the criteria of the Center for Disease Control (CDC). The correlation between the amount of carbapenem consumption and the number of infections with MDRAB strains between the two periods were evaluated. During the study period, a total of 1822 patients' (1053 patients in CNRP and 769 patients in CRP) records were evaluated retrospectively. A total of 10.82 defined daily dose (DDD/100 ICU days) of anti-pseudomonal carbapenem were used in CNRP, and this figure decreased to 6.95 DDD/100 ICU days in CRP. In the 8-month CNRP, 42 (3.98%) MDRAB-related nosocomial infections were detected, and 14 (1.82%) infections were detected in CRP (p = 0.012). The prevalence of MDRAB strains isolated in the CNRP was 2.24-fold higher than the prevalence in
Directory of Open Access Journals (Sweden)
Muhammad Raihan Jumat
2018-04-01
Full Text Available A membrane bioreactor (MBR-based wastewater treatment plant (WWTP in Saudi Arabia is assessed over a five-month period in 2015 and once in 2017 for bacterial diversity and transcriptional activity using metagenomics, metatranscriptomics and real time quantitative polymerase chain reaction (RT-qPCR. Acinetobacter spp. are shown to be enriched in the chlorinated effluent. Members of the Acinetobacter genus are the most abundant in the effluent and chlorinated effluent. At the species level, Acinetobacter junii have higher relative abundances post MBR and chlorination. RNA-seq analysis show that, in A. junii, 288 genes and 378 genes are significantly upregulated in the effluent and chlorinated effluent, respectively, with 98 genes being upregulated in both. RT-qPCR of samples in 2015 and 2017 confirm the upregulation observed in RNA-seq. Analysis of the 98 genes show that majority of the upregulated genes are involved in cellular repair and metabolism followed by resistance, virulence, and signaling. Additionally, two different subpopulations of A. junii are observed in the effluent and chlorinated effluent. The upregulation of cellular repair and metabolism genes, and the formation of different subpopulations of A. junii in both effluents provide insights into the mechanisms employed by A. junii to persist in the conditions of a WWTP.
Jumat, Muhammad; Haroon, Muhammad; Aljassim, Nada I.; Cheng, Hong; Hong, Pei-Ying
2018-01-01
A membrane bioreactor (MBR)-based wastewater treatment plant (WWTP) in Saudi Arabia is assessed over a five-month period in 2015 and once in 2017 for bacterial diversity and transcriptional activity using metagenomics, metatranscriptomics and real time quantitative polymerase chain reaction (RT-qPCR). Acinetobacter spp. are shown to be enriched in the chlorinated effluent. Members of the Acinetobacter genus are the most abundant in the effluent and chlorinated effluent. At the species level, Acinetobacter junii have higher relative abundances post MBR and chlorination. RNA-seq analysis show that, in A. junii, 288 genes and 378 genes are significantly upregulated in the effluent and chlorinated effluent, respectively, with 98 genes being upregulated in both. RT-qPCR of samples in 2015 and 2017 confirm the upregulation observed in RNA-seq. Analysis of the 98 genes show that majority of the upregulated genes are involved in cellular repair and metabolism followed by resistance, virulence, and signaling. Additionally, two different subpopulations of A. junii are observed in the effluent and chlorinated effluent. The upregulation of cellular repair and metabolism genes, and the formation of different subpopulations of A. junii in both effluents provide insights into the mechanisms employed by A. junii to persist in the conditions of a WWTP.
Jumat, Muhammad
2018-04-11
A membrane bioreactor (MBR)-based wastewater treatment plant (WWTP) in Saudi Arabia is assessed over a five-month period in 2015 and once in 2017 for bacterial diversity and transcriptional activity using metagenomics, metatranscriptomics and real time quantitative polymerase chain reaction (RT-qPCR). Acinetobacter spp. are shown to be enriched in the chlorinated effluent. Members of the Acinetobacter genus are the most abundant in the effluent and chlorinated effluent. At the species level, Acinetobacter junii have higher relative abundances post MBR and chlorination. RNA-seq analysis show that, in A. junii, 288 genes and 378 genes are significantly upregulated in the effluent and chlorinated effluent, respectively, with 98 genes being upregulated in both. RT-qPCR of samples in 2015 and 2017 confirm the upregulation observed in RNA-seq. Analysis of the 98 genes show that majority of the upregulated genes are involved in cellular repair and metabolism followed by resistance, virulence, and signaling. Additionally, two different subpopulations of A. junii are observed in the effluent and chlorinated effluent. The upregulation of cellular repair and metabolism genes, and the formation of different subpopulations of A. junii in both effluents provide insights into the mechanisms employed by A. junii to persist in the conditions of a WWTP.
Arterial injury promotes medial chondrogenesis in Sm22 knockout mice.
Shen, Jianbin; Yang, Maozhou; Jiang, Hong; Ju, Donghong; Zheng, Jian-Pu; Xu, Zhonghui; Liao, Tang-Dong; Li, Li
2011-04-01
Expression of SM22 (also known as SM22alpha and transgelin), a vascular smooth muscle cells (VSMCs) marker, is down-regulated in arterial diseases involving medial osteochondrogenesis. We investigated the effect of SM22 deficiency in a mouse artery injury model to determine the role of SM22 in arterial chondrogenesis. Sm22 knockout (Sm22(-/-)) mice developed prominent medial chondrogenesis 2 weeks after carotid denudation as evidenced by the enhanced expression of chondrogenic markers including type II collagen, aggrecan, osteopontin, bone morphogenetic protein 2, and SRY-box containing gene 9 (SOX9). This was concomitant with suppression of VSMC key transcription factor myocardin and of VSMC markers such as SM α-actin and myosin heavy chain. The conversion tendency from myogenesis to chondrogenesis was also observed in primary Sm22(-/-) VSMCs and in a VSMC line after Sm22 knockdown: SM22 deficiency altered VSMC morphology with compromised stress fibre formation and increased actin dynamics. Meanwhile, the expression level of Sox9 mRNA was up-regulated while the mRNA levels of myocardin and VSMC markers were down-regulated, indicating a pro-chondrogenic transcriptional switch in SM22-deficient VSMCs. Furthermore, the increased expression of SOX9 was mediated by enhanced reactive oxygen species production and nuclear factor-κB pathway activation. These findings suggest that disruption of SM22 alters the actin cytoskeleton and promotes chondrogenic conversion of VSMCs.
New strains of oil-degrading microorganisms for treating contaminated soils and wastes
Muratova, A. Yu; Panchenko, L. V.; Semina, D. V.; Golubev, S. N.; Turkovskaya, O. V.
2018-01-01
Two new strains Achromobacter marplatensis101n and Acinetobacter sp. S-33, capable of degrading 49 and 46% of oil within 7 days were isolated, identified, and characterized. The application of A. marplatensis 101n in combination with ammonium nitrate (100 mg·kg-1) for 30 days of cultivation resulted in the degradation of 49% of the initial total petroleum hydrocarbon content (274 g·kg-1) in the original highly acid (pH 4.9) oil-contaminated waste. Up to 30% of oil sludge added to a liquid mineral medium at a concentration of 15% was degraded after 10 days of cultivation of A. marplatensis 101n. Application of yellow alfalfa (Medicago falcata L.) plants with Acinetobacter sp. S-33 for bioremediation of oil-sludge-contaminated soil improved the quality of cleanup in comparison with the bacterium- or plant-only treatment. Inoculation of Acinetobacter sp. S-33 increased the growth of both roots and shoots by more than 40%, and positively influenced the soil microflora. We conclude that the new oil-degrading strains, Acinetobacter sp. S-33 and A. marplatensis 101n, can serve as the basis for new bioremediation agents for the treatment of oil contaminated soils and waste.
Assessment of microseeds biodegradability of Sm and Sm:Ba splenic implants in rabbits
International Nuclear Information System (INIS)
Siqueira, Savio Lana; Barroso, Thiago Vinicius Villar; Campos, Tarcisio P.R.
2009-01-01
The radioactive interstitial implants have applications in controlling neoplasm in several regions of the human body. Currently the permanent brachytherapy seeds implanted in the spleen and other organs are made of I-125 seeds. After the total emission of radiation, the metal encapsulated seed remains inert in the implanted area. Seeds of bioactive ceramics have been prepared with Sm-152 incorporation to be activated in Sm-153. This study aimed to develop surgical technique for implanting biodegradable micro-seeds in the spleen of the rabbit. Three micro-seeds were introduced by hypodermic needle in the spleen in eight rabbits by median laparotomy. Subsequently, there were clinical and functional reactions of the animal to the implanted foreign body. The other objective was to perform the animal monitoring by radiography, produced in time sequence, and pathological studies of a fragment of the spleens of rabbits. The results show the effectiveness of surgery, the identification of the implanted material by radiography in vivo, and the biocompatibility of micro-seeds most of Sm and Sm:Ba. These seeds of reduced volume, 0.3x 1.6 mm, could be monitored for radiological studies in 2 periods: early and later implant. On the later studies, radiography was taken at 60d post-implant. Biopsies were taken and radiographs of the samples were also performed for evidencing the degradation state of the seeds. The results of the two groups of four rabbits are presented. They show partial degradation of the seed verified by radiographic contrast which is related to the atomic number of the elements and mass density in the seed. The biopsy showed that the ceramic is clearly absorbed by the spleen tissue and form tissue-implant interface. The histological slides showed an inflammatory reaction with presence of fibrosis of the giant cell foreign body. In conclusion, the radiograph shows a suitable noninvasive technique for monitoring the degradation of micro-seed ceramics in vivo
Assessment of microseeds biodegradability of Sm and Sm:Ba splenic implants in rabbits
Energy Technology Data Exchange (ETDEWEB)
Siqueira, Savio Lana; Barroso, Thiago Vinicius Villar [Faculdade de Ciencias Medicas de Minas Gerais, Belo Horizonte, MG (Brazil). Dept. de Anatomia; Campos, Tarcisio P.R., E-mail: campos@nuclear.ufmg.b [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Programa de Ciencias e Tecnicas Nucleares
2009-07-01
The radioactive interstitial implants have applications in controlling neoplasm in several regions of the human body. Currently the permanent brachytherapy seeds implanted in the spleen and other organs are made of I-125 seeds. After the total emission of radiation, the metal encapsulated seed remains inert in the implanted area. Seeds of bioactive ceramics have been prepared with Sm-152 incorporation to be activated in Sm-153. This study aimed to develop surgical technique for implanting biodegradable micro-seeds in the spleen of the rabbit. Three micro-seeds were introduced by hypodermic needle in the spleen in eight rabbits by median laparotomy. Subsequently, there were clinical and functional reactions of the animal to the implanted foreign body. The other objective was to perform the animal monitoring by radiography, produced in time sequence, and pathological studies of a fragment of the spleens of rabbits. The results show the effectiveness of surgery, the identification of the implanted material by radiography in vivo, and the biocompatibility of micro-seeds most of Sm and Sm:Ba. These seeds of reduced volume, 0.3x 1.6 mm, could be monitored for radiological studies in 2 periods: early and later implant. On the later studies, radiography was taken at 60d post-implant. Biopsies were taken and radiographs of the samples were also performed for evidencing the degradation state of the seeds. The results of the two groups of four rabbits are presented. They show partial degradation of the seed verified by radiographic contrast which is related to the atomic number of the elements and mass density in the seed. The biopsy showed that the ceramic is clearly absorbed by the spleen tissue and form tissue-implant interface. The histological slides showed an inflammatory reaction with presence of fibrosis of the giant cell foreign body. In conclusion, the radiograph shows a suitable noninvasive technique for monitoring the degradation of micro-seed ceramics in vivo
Acinetobacter baumannii-Infected Vascular Catheters Collected from Horses in an Equine Clinic
Vaneechoutte, Mario; Devriese, Luc A.; Dijkshoorn, Lenie; Lamote, Benedicte; Deprez, Piet; Verschraegen, Gerda; Haesebrouck, Freddy
2000-01-01
Acinetobacter baumannii was isolated from tips clipped from seven intravenous jugular catheters collected from horses in the Ghent University equine clinic. They originated from seven different horses. Three of the seven showed evidence of local infection.
Directory of Open Access Journals (Sweden)
Anthony J Brzoska
Full Text Available Members of the genus Acinetobacter have been the focus recent attention due to both their clinical significance and application to molecular biology. The soil commensal bacterium Acinetobacter baylyi ADP1 has been proposed as a model system for molecular and genetic studies, whereas in a clinical environment, Acinetobacter spp. are of increasing importance due to their propensity to cause serious and intractable systemic infections. Clinically, a major factor in the success of Acinetobacter spp. as opportunistic pathogens can be attributed to their ability to rapidly evolve resistance to common antimicrobial compounds. Whole genome sequencing of clinical and environmental Acinetobacter spp. isolates has revealed the presence of numerous multidrug transporters within the core and accessory genomes, suggesting that efflux is an important host defense response in this genus. In this work, we used the drug-susceptible organism A. baylyi ADP1 as a model for studies into the evolution of efflux mediated resistance in genus Acinetobacter, due to the high level of conservation of efflux determinants across four diverse Acinetobacter strains, including clinical isolates. A single exposure of therapeutic concentrations of chloramphenicol to populations of A. baylyi ADP1 cells produced five individual colonies displaying multidrug resistance. The major facilitator superfamily pump craA was upregulated in one mutant strain, whereas the resistance nodulation division pump adeJ was upregulated in the remaining four. Within the adeJ upregulated population, two different levels of adeJ mRNA transcription were observed, suggesting at least three separate mutations were selected after single-step exposure to chloramphenicol. In the craA upregulated strain, a T to G substitution 12 nt upstream of the craA translation initiation codon was observed. Subsequent mRNA stability analyses using this strain revealed that the half-life of mutant craA mRNA was significantly
Directory of Open Access Journals (Sweden)
J. Dilip Kumar
2007-01-01
Full Text Available A procedure was developed for the determination of Sm, Eu and Yb in water samples by inductively coupled plasma-optical emission spectrometry (ICP-OES after preconcentration on synthesized 5-(4-pyridyl azo-8-quinolinol supported by Borassus flabellifer inflorescence (BFI. The sorbed element was subsequently eluted with 0.4 M HNO3 and the acid eluates were analyzed by ICP-OES. Under the optimal conditions, Sm, Eu and Yb in aqueous samples were concentrated 100-fold. Recoveries were obtained by the proposed method in the range of 98.6 -99.8%. This method was also applied for the analysis of spiked and natural water samples. The results provide strong evidence to support the hypothesis of an adsorption mechanism.
Bansal, Narottam P.; Zhong, zhimin
2005-01-01
Nanopowders of Sm0.5Sr0.5CoO(3-x) (SSC) and La0.6Sr0.4CoO(3-x) (LSC) compositions, which are being investigated as cathode materials for intermediate temperature solid oxide fuel cells, were synthesized by a solution-combustion method using metal nitrates and glycine as fuel. Development of crystalline phases in the as-synthesized powders after heat treatments at various temperatures was monitored by x-ray diffraction. Perovskite phase in LSC formed more readily than in SSC. Single phase perovskites were obtained after heat treatment of the combustion synthesized LSC and SSC powders at 1000 and 1200 C, respectively. The as-synthesized powders had an average particle size of 12 nm as determined from x-ray line broadening analysis using the Scherrer equation. Average grain size of the powders increased with increase in calcination temperature. Morphological analysis of the powders calcined at various temperatures was done by scanning electron microscopy.
SmB6 electron-phonon coupling constant from time- and angle-resolved photoelectron spectroscopy
Sterzi, A.; Crepaldi, A.; Cilento, F.; Manzoni, G.; Frantzeskakis, E.; Zacchigna, M.; van Heumen, E.; Huang, Y. K.; Golden, M. S.; Parmigiani, F.
2016-08-01
SmB6 is a mixed valence Kondo system resulting from the hybridization between localized f electrons and delocalized d electrons. We have investigated its out-of-equilibrium electron dynamics by means of time- and angle-resolved photoelectron spectroscopy. The transient electronic population above the Fermi level can be described by a time-dependent Fermi-Dirac distribution. By solving a two-temperature model that well reproduces the relaxation dynamics of the effective electronic temperature, we estimate the electron-phonon coupling constant λ to range from 0.13 ±0.03 to 0.04 ±0.01 . These extremes are obtained assuming a coupling of the electrons with either a phonon mode at 10 or 19 meV. A realistic value of the average phonon energy will give an actual value of λ within this range. Our results provide an experimental report on the material electron-phonon coupling, contributing to both the electronic transport and the macroscopic thermodynamic properties of SmB6.
Sandhya, K L; Chandani, A D L; Fukuda, Atsuo; Vij, Jagdish K; Emelyanenko, A V; Ishikawa, Ken
2013-01-01
In the binary mixture phase diagram of MC881 and MC452, the borderline between anticlinic antiferroelectric SmC(A)(*) and synclinic ferroelectric SmC(*) becomes apparently parallel to the temperature ordinate axis at the critical concentration r(c). The free energy difference between SmC(A)(*) and SmC^{*} is extremely small in a wide temperature range near r(c). In such circumstances, by observing Bragg reflection spectra due to the director helical structure and electric-field-induced birefringence, we have observed the continuous change from SmC(A)(*) to SmC(*) for r/~r(c). These intriguing phenomena have been explained, successfully at least in the high-temperature region, by a thermal equilibrium between the synclinic and anticlinic orderings and the resulting Boltzmann distribution for the ratio between them; the thermal equilibrium is considered to be attained in a nonuniform defect-assisted way through solitary waves moving around dynamically. We have also discussed qualitatively an important role played by the effective long-range interlayer interactions in the low-temperature region.
Synthesis and bio-evaluation of nano-hydroxyapatite trapped by 153Sm
International Nuclear Information System (INIS)
Bing Wenzeng; Luo Shunzhong; Wen Guanghua; Jiang Shubin; Xiong Xiaoling; Liu Guoping
2006-03-01
After nanoHA was synthesized, 153 Sm-EDTMP-nanoHA and 153 Sm-citrate-nanoHA were prepared and proved stable in vitro. ECT images of New Zealand rabbits injected with 153 Sm-EDTMP-nanoHA had better contrast, skeletal figure visible, liver and spleen clear. The images of 153 Sm-citrate-nanoHA showed a similar results but kidney invisible, which meant 153 Sm-citrate-nanoHA showed a similar results but kidney invisible, which meant 153 Sm-citrate-nanoHA was mainly excreted through liver and gall. 153 Sm-EDTMP-nanoHA's half effective inhibition concentrations to SMMC-7721 and MCF-7 cells were 1.98 g/L and 0.075 g/L respectively and 153 Sm-citrate-nanoHA's were 1.89 g/L and 0.094 g/L proportionally. 153 Sm-EDTMP-nanoHA and 153 Sm-citrate-nanoHA were worthy of a further research because their half effective inhibition concentrations were much lower than ones of the single nanoHA. (authors)
checkCIF/PLATON report Datablock: Sm
Indian Academy of Sciences (India)
Moiety formula C59 H45 N2 O6 Sm. Sm (C14 H12 N2) ... 4.0 Ratio. PLAT234_ALERT_4_C Large Hirshfeld Difference O4 -- C24 .. 0.16 Ang. ... outliers and unusual parameters, but every test has its limitations and alerts that are not important.
Nanocrystallization in Cu-Zr-Al-Sm Bulk Metallic Glasses
Sikan, Fatih; Yasar, Bengisu; Kalay, Ilkay
2018-04-01
The effect of rare-earth element (Sm) microalloying on the thermal stability and crystallization kinetics of melt-spun ribbons and suction-cast rods of Zr48Cu38.4Al9.6Sm4 alloy were investigated using differential scanning calorimetry (DSC), X-ray diffraction (XRD), transmission electron microscopy (TEM), and atom probe tomography (APT). The XRD results of constant heating rate annealing indicated that amorphous Zr48Cu38.4Al9.6Sm4 melt-spun ribbons devitrifies into Cu2Sm at 673 K (400 °C). The sequence continues with the precipitation of Cu10Zr7 and then these two phases coexist. XRD and TEM studies on 1 mm diameter as suction-cast rods indicated the precipitation of 30-nm-mean size Cu2Sm crystals during solidification. TEM investigation of the isothermal crystallization sequence of melt-spun ribbons and 1-mm-diameter suction-cast rods revealed the precipitation of Cu2Sm nanocrystals at the onset of crystallization and the restriction of the growth of these nanocrystals up to 10 nm diameter with further annealing. APT analysis of 1-mm-diameter suction-cast rods showed that the limited growth of Cu2Sm nanocrystals is due to sluggish diffusion of Sm and Al-Zr pile up at the interface.
Kobs, Vanessa Cristine; Ferreira, Jéssica Augustini; Bobrowicz, Thaís Alexandra; Ferreira, Leslie Ecker; Deglmann, Roseneide Campos; Westphal, Glauco Adrieno; França, Paulo Henrique Condeixa de
2016-01-01
Members of the Acinetobacter genus are key pathogens that cause healthcare-associated infections, and they tend to spread and develop new antibiotic resistance mechanisms. Oxacillinases are primarily responsible for resistance to carbapenem antibiotics. Higher rates of carbapenem hydrolysis might be ascribed to insertion sequences, such as the ISAba1 sequence, near bla OXA genes. The present study examined the occurrence of the genetic elements bla OXA and ISAba1 and their relationship with susceptibility to carbapenems in clinical isolates of the Acinetobacter calcoaceticus-Acinetobacter baumannii complex. Isolates identified over 6 consecutive years in a general hospital in Joinville, Southern Brazil, were evaluated. The investigation of 5 families of genes encoding oxacillinases and the ISAba1 sequence location relative to bla OXA genes was conducted using polymerase chain reaction. All isolates presented the bla OXA-51-like gene (n = 78), and 91% tested positive for the bla OXA-23-like gene (n = 71). The presence of ISAba1 was exclusively detected in isolates carrying the bla OXA-23-like gene. All isolates in which ISAba1 was found upstream of the bla OXA-23-like gene (n = 69) showed resistance to carbapenems, whereas the only isolate in which ISAba1 was not located near the bla OXA-23-like gene was susceptible to carbapenems. The ISAba1 sequence position of another bla OXA-23-like-positive isolate was inconclusive. The isolates exclusively carrying the bla OXA-51-like gene (n = 7) showed susceptibility to carbapenems. The presence of the ISAba1 sequence upstream of the bla OXA-23-like gene was strongly associated with carbapenem resistance in isolates of the A. calcoaceticus-A. baumannii complex in the hospital center studied.
Directory of Open Access Journals (Sweden)
R. H. González
2009-06-01
Full Text Available A set of 43 strains corresponding to 20 classified and unclassified genomic Acinetobacter species was analyzed for the production of typical N-acyl homoserine lactone quorum sensing molecules in culture broths. A large percentage of the strains (74% displayed quorum sensing signals that could be separated into three statistically significantly different chromatographic groups (p Rf2 > Rf1. None of the three signals could be specifically assigned to a particular species in the genus; furthermore, no distinction could be made between the quorum sensing signals secreted by typical opportunistic strains of the A. calcoaceticus-A. baumannii complex, isolated from patients, with respect to the other species of the genus, except for the Rf1 signal which was present in all the QS positive strains belonging to this complex and DNA group 13 TU. In conclusion, quorum sensors in Acinetobacter are not homogenously distributed among species and one of them is present in most of the A. calcoaceticus-baumannii complex.Se analizó la producción de moléculas típicas de N-acil homoserina lactona con actividad de quorum sensing en cultivos líquidos de un grupo de 43 cepas correspondientes a 20 especies genómicas clasificadas y no clasificadas de Acinetobacter. Un porcentaje alto de las cepas (74% mostraron señales de quorum sensing que pudieron ser separadas en tres grupos cromatográficos significativamente diferentes entre sí (p Rf2 > Rf1. Ninguna de las tres señales pudo ser asignada a una especie en particular dentro del género; es más, no se encontró diferencia entre las señales producidas por las cepas típicamente oportunistas (complejo A. calcoaceticus-A. baumannii aisladas de pacientes respecto de las producidas por otras cepas del mismo género, excepto para el caso de Rf1, que se encontró presente en todos los aislamientos quorum sensing positivos del mencionado complejo y en las cepas del grupo de DNA 13TU. En conclusión, los sensores de
DEFF Research Database (Denmark)
Kaas, Rolf Sommer; Mordhorst, Hanne; Leekitcharoenphon, Pimlapas
2017-01-01
Acinetobacter johnsonii C6 originates from creosote-polluted groundwater and performs ecological and evolutionary interactions with Pseudomonas putida in biofilms. The draft genome of A. johnsonii C6 is 3.7 Mbp and was shaped by mobile genetic elements. It reveals genes facilitating the biodegrad......Acinetobacter johnsonii C6 originates from creosote-polluted groundwater and performs ecological and evolutionary interactions with Pseudomonas putida in biofilms. The draft genome of A. johnsonii C6 is 3.7 Mbp and was shaped by mobile genetic elements. It reveals genes facilitating...
Directory of Open Access Journals (Sweden)
Pablo Vitoriano Cirino
2008-08-01
Full Text Available O Acinetobacter baumanni é patógeno oportunista antigamente considerado de baixa virulência. Atualmente está envolvido em processos infecciosos que acometem pacientes imunocomprometidos,grandes queimados e pacientes em unidades de terapia intensiva que fazem uso de ventilação mecânica. Esse relato de caso chama atenção para infecção cutânea rara por essa bactéria em paciente imunocompetente.Acinetobacter baumannii is an oportunistic pathogen that used to be considered as having low virulence; however, it is currently known to be involved in infectious processes in patients with immunosuppression, large burns and those under mechanical ventilation in intensive care units. This case report emphasizes the possibility of cutaneous infection by A. baumanni in immunocompetent patients.
Directory of Open Access Journals (Sweden)
Yiqi Fu
Full Text Available BACKGROUND/OBJECTIVE: Several studies have described the epidemiological distribution of blaOXA-58-harboring Acinetobacter baumannii in China. However, there is limited data concerning the replicon types of blaOXA-58-carrying plasmids and the genetic context surrounding blaOXA-58 in Acinetobacter spp. in China. METHODOLOGY/PRINCIPAL FINDINGS: Twelve non-duplicated blaOXA-58-harboring Acinetobacter spp. isolates were collected from six hospitals in five different cities between 2005 and 2010. The molecular epidemiology of the isolates was carried out using PFGE and multilocus sequence typing. Carbapenemase-encoding genes and plasmid replicase genes were identified by PCR. The genetic location of blaOXA-58 was analyzed using S1-nuclease method. Plasmid conjugation and electrotransformation were performed to evaluate the transferability of blaOXA-58-harboring plasmids. The genetic structure surrounding blaOXA-58 was determined by cloning experiments. The twelve isolates included two Acinetobacter pittii isolates (belong to one pulsotype, three Acinetobacter nosocomialis isolates (belong to two pulsotypes and seven Acinetobacter baumannii isolates (belong to two pulsotypes/sequence types. A. baumannii ST91 was found to be a potential multidrug resistant risk clone carrying both blaOXA-58 and blaOXA-23. blaOXA-58 located on plasmids varied from ca. 52 kb to ca. 143 kb. All plasmids can be electrotransformed to A. baumannii recipient, but were untypeable by the current replicon typing scheme. A novel plasmid replicase named repAci10 was identified in blaOXA-58-harboring plasmids of two A. pittii isolates, three A. nosocomialis isolates and two A. baumannii isolates. Four kinds of genetic contexts of blaOXA-58 were identified. The transformants of plasmids with structure of IS6 family insertion sequence (ISOur1, IS1008 or IS15-ΔISAba3-like element-blaOXA-58 displayed carbapenem nonsusceptible, while others with structure of intact ISAba3-like element
Colistin-Resistant Acinetobacter baumannii Clinical Strains with Deficient Biofilm Formation
Dafopoulou, Konstantina; Xavier, Basil Britto; Hotterbeekx, An; Janssens, Lore; Lammens, Christine; Dé, Emmanuelle; Goossens, Herman; Tsakris, Athanasios; Malhotra-Kumar, Surbhi
2015-01-01
In two pairs of clinical colistin-susceptible/colistin-resistant (Csts/Cstr) Acinetobacter baumannii strains, the Cstr strains showed significantly decreased biofilm formation in static and dynamic assays (P Cstr strain and a frameshift mutation in CarO and the loss of a 47,969-bp element containing multiple genes associated with biofilm production in the other. PMID:26666921
Gamma ray irradiation characteristics of SM fibers
International Nuclear Information System (INIS)
Ito, Ryuichi; Okano, Hiroaki; Hashiba, Keichi; Nakai, Hisanori
1987-01-01
1.3 μm range single mode (SM) optical fibers have been used for wide application of mainly long distance communication. At present, in order to realize the larger capacity and longer distance between relay points, the development of 1.5 μm range SM fibers of low dispersion and small loss has been actively promoted. As for the radiation withstanding property of SM fibers, report is scarce. The authors reported on the gamma ray irradiation characteristics of 1.3 μm range SM fibers, but since 1.5 μm range SM fibers are designed with the different structure from that of 1.3 μm fibers, it is necessary to evaluate from new viewpoint. In this report, mainly on the structure having triangular distribution, the effect that the manufacturing condition and the structural defects of glass exert on the gamma ray irradiation characteristics is described. The specimens were mainly dispersion shift type fibers (DSF), and for comparison, single window, double window and 1.3 μm SM fibers were examined. Co-60 gamma ray was irradiated, and the optical loss and electron spin resonance were measured. By low temperature and low speed drawing, the good result in the optical loss was obtained. The presence of oxygen at the time of sintering materials had no effect. The dependence of the ESR on the drawing condition was not very remarkable. (Kako, I.)
Perez, Leandro Reus Rodrigues
2015-02-01
In this study the ability for biofilm production among meropenem (MEM)-resistant and -susceptible Acinetobacter baumannii isolates was verified. MEM susceptibility and biofilm production were screened in 116 isolates. Meropenem-resistant A. baumannii isolates showed a reduced ability to produce biofilms compared to those susceptible to MEM (Pbaumanni isolates.
International Nuclear Information System (INIS)
Chang, Yi-Huang; Chang, Ku-Shang; Lee, Ching-Fu; Hsu, Chuan-Liang; Huang, Cheng-Wei; Jang, Hung-Der
2015-01-01
To realize the feasibility of biodiesel production from high-lipid cell culture, microbial lipid production by the oleaginous yeasts was studied using glucose and sucrose as carbon source. Among the tested strains, Cryptococcus sp. SM5S05 accumulated the highest levels of intracellular lipids. The crude lipid contents of Cryptococcus sp. cultured in yeast malt agar reached 30% on a dry weight basis. The accumulation of lipids strongly depended on carbon/nitrogen ratio and nitrogen concentration. The highest content of lipids, measured at a carbon/nitrogen ratio of 60–90 and at a nitrogen concentration of 0.2%, was 60–57% lipids in the dry biomass. Batch cultures using corncob hydrolysate demonstrated that there was minimal inhibitory effect with a reducing sugar concentration of 60 g l −1 or higher. Batch cultures of Cryptococcus sp. SM5S05 in the corncob hydrolysate medium with 60 g l −1 glucose resulted in a dry biomass, lipid yields, and content of 12.6 g l −1 , 7.6 g l −1 , and 60.2%, respectively. The lipids contained mainly long-chain saturated and unsaturated fatty acids with 16 and 18 carbon atoms. The fatty acid profile of Cryptococcus oils was quite similar to that of conventional vegetable oil. The cost of lipid production could be further reduced with corncob hydrolysate being utilized as the raw material for the oleaginous yeast. The results showed that the microbial lipid from Cryptococcus sp. was a potential alternative resource for biodiesel production. - Highlights: • Microbial oil production from oleaginous yeast Cryptococcus sp. was studied. • Accumulation of lipid strongly depended on C/N ratio and nitrogen concentration. • Cultures in hydrolysate medium with 60 g/l glucose resulted in maximum lipid yields. • Maximal lipid content in the Cryptococcus sp. were 60.2% on dried weight basis
Selective mutism: more than social anxiety?
Yeganeh, Robin; Beidel, Deborah C; Turner, Samuel M
2006-01-01
This study investigated the relationship between selective mutism (SM), social phobia (SP), oppositionality, and parenting styles. Twenty-one children with SP, 21 children with SM and SP, and 21 normal children ages 7-15, and the mother of each child, participated in an assessment of psychopathological factors potentially related to SM. Children with SM did not endorse higher levels of social anxiety than did children with SP, although clinicians gave higher severity ratings to those who had both disorders. In addition, although a dimensional measure of oppositionality (Eyberg Child Behavior Inventory) did not reveal group differences, there were significantly more diagnoses of oppositional defiant disorder among children with SM (29%) in comparison to children with SP alone (5%). With respect to parenting styles, there were no significant differences among parents of children with SM and the other groups, except that children with SP reported significantly less warmth/acceptance from parents than normal children. These data replicate previous findings that children with SM do not report greater social anxiety than other children with a SP diagnosis. Furthermore, they suggest that oppositional behaviors may be part of the clinical presentation of a subset of children with SM.
Directory of Open Access Journals (Sweden)
Bandana Baniya
2017-11-01
Full Text Available Abstract Introduction Pseudomonas aeruginosa and Acinetobacter spp. are found to be associated with biofilm and metallo-β-lactamase production and are the common causes of serious infections mainly in hospitalized patients. So, the main aims of this study were to determine the rates of biofilm production and metallo beta-lactamase production (MBL among the strains of Pseudomonas aeruginosa and Acinetobacter spp. isolated from hospitalized patients. Methods A total of 85 P. aeruginosa isolates and 50 Acinetobacter spp. isolates isolated from different clinical specimens from patients admitted to Shree Birendra Hospital, Kathmandu, Nepal from July 2013 to May 2014 were included in this study. The bacterial isolates were identified with the help of biochemical tests. Modified Kirby-Bauer disc diffusion technique was used for antimicrobial susceptibility testing. Combined disc diffusion technique was used for the detection of MBL production, while Congo red agar method and tube adherence method were used for detection of biofilm production. Results Around 16.4% of P. aeruginosa isolates and 22% of the strains of Acinetobacter spp. were metallo β-lactamase producers. Out of 85 P. aeruginosa isolates, 23 (27.05% were biofilm producers according to tube adherence test while, only 13 (15.29% were biofilm producers as per Congo red agar method. Similarly, out of 50 Acinetobacter spp. 7 (14% isolates were biofilm producers on the basis of tube adherence test, while only 5 (10% were positive for biofilm production by Congo red agar method. Highest rates of susceptibility of P. aeruginosa as well as Acinetobacter spp. were seen toward colistin. Conclusion In our study, biofilm production and metallo beta-lactamase production were observed among Pseudomonas aeruginosa and Acinetobacter spp. However, no statistically significant association could be established between biofilm production and metallo beta-lactamase production.
Wang, Qinqin; Zhou, Yanbin; Li, Shaoli; Zhuo, Chao; Xu, Siqi; Huang, Lixia; Yang, Ling; Liao, Kang
2013-01-01
Background Detection of Acinetobacter baumannii has been relying primarily on bacterial culture that often fails to return useful results in time. Although DNA-based assays are more sensitive than bacterial culture in detecting the pathogen, the molecular results are often inconsistent and challenged by doubts on false positives, such as those due to system- and environment-derived contaminations. In addition, these molecular tools require expensive laboratory instruments. Therefore, establishing molecular tools for field use require simpler molecular platforms. The loop-mediated isothermal amplification method is relatively simple and can be improved for better use in a routine clinical bacteriology laboratory. A simple and portable device capable of performing both the amplification and detection (by fluorescence) of LAMP in the same platform has been developed in recent years. This method is referred to as real-time loop-mediated isothermal amplification. In this study, we attempted to utilize this method for rapid detection of A. baumannii. Methodology and Significant Findings Species-specific primers were designed to test the utility of this method. Clinical samples of A. baumannii were used to determine the sensitivity and specificity of this system compared to bacterial culture and a polymerase chain reaction method. All positive samples isolated from sputum were confirmed to be the species of Acinetobacter by 16S rRNA gene sequencing. The RealAmp method was found to be simpler and allowed real-time detection of DNA amplification, and could distinguish A. baumannii from Acinetobacter calcoaceticus and Acinetobacter genomic species 3. DNA was extracted by simple boiling method. Compared to bacterial culture, the sensitivity and specificity of RealAmp in detecting A. baumannii was 98.9% and 75.0%, respectively. Conclusion The RealAmp assay only requires a single unit, and the assay positivity can be verified by visual inspection. Therefore, this assay has
Rodríguez Guardado, A; Blanco, A; Asensi, V; Pérez, F; Rial, J C; Pintado, V; Bustillo, E; Lantero, M; Tenza, E; Alvarez, M; Maradona, J A; Cartón, J A
2008-04-01
The treatment of multidrug-resistant Acinetobacter baumannii meningitis is a serious therapeutic problem due to the limited penetration of antibiotics into the CSF. We describe the clinical features and the outcome of a group of patients with nosocomial neurosurgical meningitis treated with different therapeutic options. All patients with nosocomial post-surgical meningitis due to A. baumannii diagnosed between 1990 and 2004 were retrospectively reviewed. During the period of study, 51 cases of this nosocomial infection were identified. Twenty-seven patients were treated with intravenous (iv) monotherapy: carbapenems (21 cases), ampicillin/sulbactam (4 cases) and other antibiotics (2 cases). Four patients were treated with iv combination therapy. Nineteen patients were treated with iv and intrathecal regimens: colistin by both routes (8 cases), carbapenems plus iv and intrathecal (4 cases) or only intrathecal (5 cases) aminoglycosides, and others (2 cases). Seventeen patients died due to the infection. One patient died without treatment. The mean (SD) duration of therapy was 17.4 (8.3) days (range 3-44). Although no patients treated with colistin died, we did not observe statistically significant differences in the mortality among the groups with different treatments. Nosocomial Acinetobacter meningitis has a high mortality. Combined therapy with iv and intrathecal colistin is a useful and safe option in the treatment of nosocomial Acinetobacter meningitis.
Directory of Open Access Journals (Sweden)
Lul Raka
Full Text Available Infections caused by bacteria of genus Acinetobacter pose a significant health care challenge worldwide. Information on molecular epidemiological investigation of outbreaks caused by Acinetobacter species in Kosova is lacking. The present investigation was carried out to enlight molecular epidemiology of Acinetobacterbaumannii in the Central Intensive Care Unit (CICU of a University hospital in Kosova using pulse field gel electrophoresis (PFGE. During March - July 2006, A. baumannii was isolated from 30 patients, of whom 22 were infected and 8 were colonised. Twenty patients had ventilator-associated pneumonia, one patient had meningitis, and two had coinfection with bloodstream infection and surgical site infection. The most common diagnoses upon admission to the ICU were politrauma and cerebral hemorrhage. Bacterial isolates were most frequently recovered from endotracheal aspirate (86.7%. First isolation occurred, on average, on day 8 following admission (range 1-26 days. Genotype analysis of A. baumannii isolates identified nine distinct PFGE patterns, with predominance of PFGE clone E represented by isolates from 9 patients. Eight strains were resistant to carbapenems. The genetic relatedness of Acinetobacter baumannii was high, indicating cross-transmission within the ICU setting. These results emphasize the need for measures to prevent nosocomial transmission of A. baumannii in ICU.
Paisio, Cintia E; Quevedo, María R; Talano, Melina A; González, Paola S; Agostini, Elizabeth
2014-08-01
The use of native bacteria is a useful strategy to decontaminate industrial effluents. In this work, two bacterial strains isolated from polluted environments constitutes a promising alternative since they were able to remove several phenolic compounds not only from synthetic solutions but also from effluents derived from a chemical industry and a tannery which are complex matrices. Acinetobacter sp. RTE 1.4 showed ability to completely remove 2-methoxyphenol (1000 mg/L) while Rhodococcus sp. CS 1 not only degrade the same concentration of this compound but also removed 4- chlorophenol, 2,4-dichlorophenol and pentachlorophenol with high efficiency. Moreover, both bacteria degraded phenols naturally present or even exogenously added at high concentrations in effluents from the chemical industry and a tannery in short time (up to 5 d). In addition, a significant reduction of biological oxygen demand and chemical oxygen demand values was achieved after 7 d of treatment for both effluents using Acinetobacter sp. RTE 1.4 and Rhodococcus sp. CS1, respectively. These results showed that Acinetobacter sp. RTE1.4 and Rhodococcus sp. CS 1 might be considered as useful biotechnological tools for an efficient treatment of different effluents, since they showed wide versatility to detoxify these complex matrices, even supplemented with high phenol concentrations.
International Nuclear Information System (INIS)
Gasiglia, Haroldo Taurian
2000-01-01
This work presents a study on the preparation of the complexes 1 53S m - EDTMP, 153 Sm - HEDP, 153 Sm - NTMP, 153 Sm - DTPMP and 153 Sm - HDTMP at room temperature. The preparation of the complex 153 Sm - HDTMP, under heating (70 - 72 deg C), was also studied. Several factors affecting the 153 Sm - EDTMP complexing yields were studied, due to its importance for use in Nuclear Medicine. These factors were: the molar ratio [ligand] / [metal], the ligand concentration and the incubation time of the mixture ligand-metal. The preparation of this complex, in low molar ratios, was also investigated. A study of the 153 Sm - EDTMP concerning the 'in vitro' stability, when this complex was prepared in low radioactive concentrations was performed. A study on the temperature influence on its degradation, when this complex was obtained in higher radioactive concentrations, was also performed. The preparation of the complexes 153 Sm - HEDP, 153 Sm - NTMP, 153 Sm - DTPMP and 153 Sm - HDTMP was investigated by preparing the complexes in two situations: high molar ratio and ligand concentration and low molar ratio and ligand concentration. The 'in vitro' stability of each complex, obtained in low radioactive concentration was studied. In the specific case of the complex 153 Sm - HDTMP, its biological distribution in mice was performed. All the complexes were investigated by high performance liquid chromatography (HPLC) and its complexing yields were determined by other three chromatographic processes: ionic exchange, thin layer chromatography (TLC - SG) and paper chromatography. The chromatographic processes were performed by association with specific radiochemical techniques. This work also presents a comparative study on the chromatograms obtained by thin layer chromatography (TLC - SG) and paper chromatography, when evaluated by the technique of cutting the strips into pieces and the chromatograms performed directly on a radiochromatography. The shape of the chromatograms and R
PREVALENCE OF ACINETOBACTER BAUMANNII ISOLATED FROM CLINICAL SPECIMENS IN ADAM MALIK HOSPITAL
Directory of Open Access Journals (Sweden)
Evita Mayasari
2014-05-01
Full Text Available AbstrakAcinetobacter baumannii merupakan spesies Acinetobacter spp. tersering diisolasi darimanusia, dan lebih sering dijumpai pada infeksi nosokomial dibandingkan dengan infeksi dikomunitas. Eksistensi bakteri ini di lingkungan terkait dengan keragaman reservoir, kemampuanmemperoleh gen pembawa sifat resisten antimikroba, dan sifat resisten terhadap pengeringan.Infeksi disebabkan strain A.baumannii yang resisten terhadap banyak antibiotik tidak mudahdikendalikan dan menjadi permasalahan di berbagai negara. Penelitian ini bertujuan untukmengetahui prevalensi A.baumannii dari spesimen klinis di instalasi mikrobiologi klinik RSUPHaji Adam Malik serta pola kepekaannya terhadap berbagai antibiotik. Identifikasi dan ujikepekaan menggunakan mesin otomatis Vitek 2 dengan Advanced Expert System (AES.Penelitian ini menemukan 644/3693 (17,44% isolat A.baumannii dari berbagai spesimen klinis.A.baumannii paling banyak diisolasi dari spesimen dahak. Penelitian ini menemukan 147/644(23% bahwa isolat carbapenem-resistent A.baumannii (imipenem dan meropenem. Sebagianbesar isolat sensitif terhadap colistin, amikacin dan tigecycline. Prevalensi A.baumanni yangditemukan pada penelitian ini adalah rendah namun resistensinya tinggi terhadap antibiotikterutama golongan penicillin, cephalosporin dan fluoroquinolon.AbstractAcinetobacter baumannii is the most frequent species of Acinetobacter spp. isolated fromhumans and more common in nosocomial infection than it is in community acquired infection.A.baumannii existence in environment is associated with the diversity of its reservoirs, itscapacity to accumulate genes of antimicrobial resistence, and its resistence to desiccation.Infection of Multidrug resistent (MDR strain of A.baumannii is not easy to manage and it hasbecome a problem in many countries. The aim of this retrospective study was to investigatethe prevalence of A.baumannii from routine clinical specimens sent to clinical microbiologylaboratory RSUP HAM
Directory of Open Access Journals (Sweden)
Lovely Barai
2010-07-01
Full Text Available Critically ill patients admitted in intensive care units (ICU are always at a higher risk of developing infections with various antibiotic resistant organisms. The objective of this study was to know the antibiotic resistance pattern of the common isolates from blood, urine, respiratory secretions and pus/wound swab of patients admitted in ICU at BIRDEM (Bangladesh Institute of Research and Rehabilitation in Diabetes, Endocrine and Metabolic Disorder hospital, during a one year period from March 2006 to February 2007. A total of 1660 samples were analyzed. Growth was obtained in 34% of the samples yielding 632 organisms. The major organism isolated were Pseudomonas sp. (29.1%, Acinetobacter sp. (27.5%, Candida sp. (12.8%, Escherichia coli (10.3% and Klebsiella sp. (9.7%. Staphylococcus aureus, Enterobacter sp, Citrobacter sp, Enterococcus sp, Providencia sp and Serratia sp accounted for 10.6% of the isolates. All the isolates were highly resistant (>80% to cephalosporins and fluoroquinolones. The frequency of third generation cephalosporin resistant E. coli, Klebsiella and imipenem resistant Pseudomonas and Acinetobacter were >50%. Acinetobacter was remarkably resistant to most antibiotics including imipenem (>70% resistant, but most of the members of the Enterobacteriacae group showed maximum sensitivity to imipenem (50%-94%. The findings of this study might help clinicians to formulate their first line empirical antibiotic treatment regimens for the patients admitted in ICUs. Ibrahim Med. Coll. J. 2010; 4(2: 66-69
Extrahuman Epidemiology of Acinetobacter baumannii in Lebanon
Rafei, Rayane; Hamze, Monzer; Pailhoriès, Hélène; Eveillard, Matthieu; Marsollier, Laurent; Joly-Guillou, Marie-Laure; Dabboussi, Fouad
2015-01-01
The presence of Acinetobacter baumannii outside hospitals is still a controversial issue. The objective of our study was to explore the extrahospital epidemiology of A. baumannii in Lebanon. From February 2012 to October 2013, a total of 73 water samples, 51 soil samples, 37 raw cow milk samples, 50 cow meat samples, 7 raw cheese samples, and 379 animal samples were analyzed by cultural methods for the presence of A. baumannii. Species identification was performed by rpoB gene sequencing. Antibiotic susceptibility was investigated, and the A. baumannii population was studied by two genotyping approaches: multilocus sequence typing (MLST) and blaOXA-51 sequence-based typing (SBT). A. baumannii was detected in 6.9% of water samples, 2.7% of milk samples, 8.0% of meat samples, 14.3% of cheese samples, and 7.7% of animal samples. All isolates showed a susceptible phenotype against most of the antibiotics tested and lacked carbapenemase-encoding genes, except one that harbored a blaOXA-143 gene. MLST analysis revealed the presence of 36 sequence types (STs), among which 24 were novel STs reported for the first time in this study. blaOXA-51 SBT showed the presence of 34 variants, among which 21 were novel and all were isolated from animal origins. Finally, 30 isolates had new partial rpoB sequences and were considered putative new Acinetobacter species. In conclusion, animals can be a potential reservoir for A. baumannii and the dissemination of new emerging carbapenemases. The roles of the novel animal clones identified in community-acquired infections should be investigated. PMID:25616788
Structural and Magnetic Properties of Sm Implanted GaN
International Nuclear Information System (INIS)
Li-Juan, Jiang; Xiao-Liang, Wang; Hong-Ling, Xiao; Zhan-Guo, Wang; Chun, Feng; Ming-Lan, Zhang; Jian, Tang
2009-01-01
The structural and magnetic properties of Sm ion-implanted GaN with different Sm concentrations are investigated. XRD results do not show any peaks associated with second phase formation. Magnetic investigations performed by superconducting quantum interference device reveal ferromagnetic behavior with an ordering temperature above room temperature in all the implanted samples, while the effective magnetic moment per Sm obtained from saturation magnetization gives a much higher value than the atomic moment of Sm. These results could be explained by the phenomenological model proposed by Dhar et al. [Phys. Rev. Lett. 94(2005)037205, Phys. Rev. B 72(2005)245203] in terms of a long-range spin polarization of the GaN matrix by the Sm atoms. (condensed matter: electronicstructure, electrical, magnetic, and opticalproperties)
Sešlap půdy NPR Boubín neprospívá
Czech Academy of Sciences Publication Activity Database
Rusek, Josef
-, - (2008), s. 24-27 ISSN 0862-5166 R&D Projects: GA ČR GA206/99/1416; GA MŽP SM/6/1/04; GA MŽP SP/2D2/58/07 Institutional research plan: CEZ:AV0Z60660521 Keywords : treading of soil * biological degradation * Biospheric Reserve Boubínský prales Subject RIV: EH - Ecology, Behaviour
Emission properties of Sm(III) complex having ten-coordination structure
International Nuclear Information System (INIS)
Hasegawa, Yasuchika; Tsuruoka, Shin-ichi; Yoshida, Takahiko; Kawai, Hideki; Kawai, Tsuyoshi
2008-01-01
Sammarium(III) complex having ten-coordination structure, bis-(1,10-phenanthroline)tris-(hexafluoroacetylacetonato)samarium(III) (Sm(hfa) 3 (phen) 2 ) was prepared by chelation of tris-(hexafluoroacetylacetonato) samarium(III) (Sm(hfa) 3 (H 2 O) 2 ) with 1,10-phenantroline (phen). The characteristic ten-coordination structure of Sm(hfa) 3 (phen) 2 was determined by 1 H NMR and elemental analyses. Strong deep-red emission (λ max =643 nm) and narrow emission band (FWHM=5 nm) of Sm(hfa) 3 (phen) 2 originated from electronic allowed transition from characteristics ten coordinate structure. The emission quantum yields Sm(hfa) 3 (phen) 2 excited at absorption bands of ligands and Sm(III) ion were found to be 0.36 and 1.4%, respectively
Bande, L. O. S.; Mariadi; Gusnawaty, HS; Nuriadi; Trisulpa, L.; Rahmania
2018-02-01
A shell of cashew nut (Anacardium occidentanle) has contained Cashew Nut Shell Liquid (CNSL) that is used as botanical pesticides. CNSL oil consists of active substance such as anacardat acid, cardol and cardanol. Utilization of the pesticides from shells of cashew nut to control pests and diseases of plants would be affected on biological agents. The objective of this research was to investigate pesticides inhibition on the increase of mycelium Trichoderma sp. and Gliocladium sp. by in vitro method. The tested concentration sample consisted of 0.0% (control), 2.5%, 7.5% and 10.0% in PDA media. The results of this research showed that 2.5% botanical pesticides concentration could minimize mycelium of Trichoderma sp. and Gliocladium sp. 22.73% and 21.04% respectively and also the increase shells of cashew extract could be affected the increase of mycelium inhibition. The extract with 2.5% concentration was the recommended concentration to control of fruit rot diseases and if concentration was 10.0% then its inhibition become 54.98% and 49.35%, respectively. The results proved that uncontrolled utilization of the pesticides could be affected on decrease of Trichoderma sp. and Gliocladium sp. growth.
Directory of Open Access Journals (Sweden)
Vanessa Cristine Kobs
Full Text Available Abstract: INTRODUCTION: Members of the Acinetobacter genus are key pathogens that cause healthcare-associated infections, and they tend to spread and develop new antibiotic resistance mechanisms. Oxacillinases are primarily responsible for resistance to carbapenem antibiotics. Higher rates of carbapenem hydrolysis might be ascribed to insertion sequences, such as the ISAba1 sequence, near bla OXA genes. The present study examined the occurrence of the genetic elements bla OXA and ISAba1 and their relationship with susceptibility to carbapenems in clinical isolates of the Acinetobacter calcoaceticus-Acinetobacter baumannii complex. METHODS: Isolates identified over 6 consecutive years in a general hospital in Joinville, Southern Brazil, were evaluated. The investigation of 5 families of genes encoding oxacillinases and the ISAba1 sequence location relative to bla OXA genes was conducted using polymerase chain reaction. RESULTS: All isolates presented the bla OXA-51-like gene (n = 78, and 91% tested positive for the bla OXA-23-like gene (n = 71. The presence of ISAba1 was exclusively detected in isolates carrying the bla OXA-23-like gene. All isolates in which ISAba1 was found upstream of the bla OXA-23-like gene (n = 69 showed resistance to carbapenems, whereas the only isolate in which ISAba1 was not located near the bla OXA-23-like gene was susceptible to carbapenems. The ISAba1 sequence position of another bla OXA-23-like-positive isolate was inconclusive. The isolates exclusively carrying the bla OXA-51-like gene (n = 7 showed susceptibility to carbapenems. CONCLUSIONS: The presence of the ISAba1 sequence upstream of the bla OXA-23-like gene was strongly associated with carbapenem resistance in isolates of the A. calcoaceticus-A. baumannii complex in the hospital center studied.
Phase formation and crystallization behavior of melt spun Sm-Fe-based alloys
International Nuclear Information System (INIS)
Shield, J.E.
1999-01-01
The phase formation and microstructures of Sm-Fe alloys have been investigated at Sm levels of 11 and 17 atomic percent and with alloying additions of Ti and C. At lower Sm content, virtually phase pure SmFe 7 formed, while higher Sm content resulted in the formation of SmFe 7 , SmFe 2 and amorphous phases. The addition of Ti and C resulted in greater stability and a larger volume fraction of the amorphous phase. The binary Sm-Fe alloys at both Sm levels had tremendously variable microstructures, with large discrepancies in grain size and phase distribution from region to region. The addition of Ti and C tended to result in a more homogeneous microstructure, as well as a refinement in the microstructural scale. (orig.)
Directory of Open Access Journals (Sweden)
Luján Roca DA
2013-01-01
Full Text Available INFECTION - LIMA, PERU Introduction: Urinary tract infection (UTI is one of the most common infections in clinical practice. Gram negative bacteria as Klebsiella pneumoniae, Serratia spp. and Acinetobacter spp. can cause UTI. Objective: To study antibiotic resistance in K. pneumoniae, Serratia spp. and Acinetobacter spp. strains isolated from UTI Material and methods: Urine cultures were collected from January 2003 to December 2003. Identification of isolated bacteria included biochemical characteristics. Bauer-Kirby disc diffusion test was performed. Results: A total of 106 strains were evaluated (41 of K. pneumoniae, 28 of Serratia spp. and 37 of Acinetobacter spp.. Among K. pneumoniae isolates resistance to ampicillin (83% was remarkable. The Serratia spp. isolates displayed a high level of resistance to nalidixic acid (79% and gentamicin (75%. In Acinetobacter spp. isolates high resistance rates were observed against amikacin (81%, gentamicin (67% and trimethoprim/sulfamethoxazole(71%. Conclusions: In general, antibiotic resistance patterns were high. Acinetobacter spp. showed elevated resistance rates (>50% against antibiotics included.
NCBI nr-aa BLAST: CBRC-AGAM-04-0111 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-AGAM-04-0111 ref|NP_001029470.1| non imprinted in Prader-Willi/Angelman syndro...me 2 [Bos taurus] sp|Q3SWX0|NIPA2_BOVIN Non-imprinted in Prader-Willi/Angelman syndrome region protein 2 hom...olog gb|AAI04628.1| Non imprinted in Prader-Willi/Angelman syndrome 2 [Bos taurus] NP_001029470.1 2e-72 51% ...
NCBI nr-aa BLAST: CBRC-GGAL-04-0044 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-04-0044 ref|NP_077809.1| adrenergic receptor, alpha 1d [Rattus norvegicus...] sp|P23944|ADA1D_RAT Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (RA42) gb|AAB59704.1| alpha 1a/d adrenergic receptor NP_077809.1 1e-171 59% ...
In vivo and in vitro binding assay of 153Sm-EDTMP
International Nuclear Information System (INIS)
Chen Daming; Wang Yuqing; Jin Xiaohai; Fan Hongqiang; Bai Hongsheng; Jia Bin; Zhang Jingming
1999-01-01
With the waters ultra hydrogel TM 120 μm hplc column (7.7 mm x 300 mm), several experiments have been finished, including the in vitro binding assay of 153 Sm-EDTMP, 153 SmCl 3 with the Cys, BSA, mouse plasma; HPLC analysis of the urine and the extracting solution of liver homogenate after having injected the 153 Sm-EDTMP and 153 SmCl 3 2h; HPLC analysis of the production ( 153 Sm-EDTMP) radiation self-decomposition with large dose. For the HPLC analysis, the condition is the mobile phase of 0.85 mol/mL PBS (pH7.5), flow rate of 0.5 mL/min, sampling of 15 μL. The results are following: (1) The 153 SmCl 3 not only is able to bind with the mouse plasma in vitro, but also is able to be absorbed by liver in vivo; (2) 153 Sm-EDTMP is not bind with the mouse plasma, the Cys and BSA in vitro and vivo; 153 Sm-EDTMP is not found in the extracted solution of liver homogenate at n(EDTMP): n(Sm) ≥ 5:1; 153 Sm-EDTMP is not decomposed in the urine, 1 53 Sm-EDTMP is stable in vivo; (3) 153 Sm-EDTMP radiation self-decomposition is not detected with large dose in the term of validity (6 d), but two small degradation peaks have been found in the production solution after 60 d, the radiochemistry purity of production is always great than 98% during the period
Directory of Open Access Journals (Sweden)
M. S. Ramírez
2010-06-01
Full Text Available Acinetobacter baumannii is considered an important pathogen in our hospital environment having a well-known capacity to acquire different mechanisms of antibiotic resistance. Previous studies in our laboratory had exposed the high dispersion of class 2 integrons in this species. In the present study, we analyzed 7 multiresistant intI2 positive A. baumannii isolates, 6 of which were found to harbour the Tn7::In2-8 element. Our results demonstrate the unusually high distribution of Tn7::In2-8 among different A. baumannii clones from Chile, suggesting a particular behavior of these elements at geographical level.Acinetobacter baumannii, patógeno de importancia clínica en el ámbito hospitalario, es reconocido como un microorganismo que posee la capacidad de evolucionar rápidamente hacia la multirresistencia. Estudios previos efectuados en nuestro laboratorio han demostrado la alta dispersión de los integrones de clase 2 en aislamientos de esta especie. En el presente trabajo se analizaron 7 aislamientos de Acinetobacter baumannii multirresistentes portadores de la integrasa de clase 2, 6 de los cuales portaban el inusual arreglo Tn7::In2-8. Nuestros resultados muestran una elevada frecuencia de dispersión del elemento Tn7::In2-8 en diferentes clones circulantes en Chile, lo que sugiere un comportamiento geográfico particular.
Directory of Open Access Journals (Sweden)
Khadijah Ahmadi
2014-10-01
Full Text Available Background: The members of the genus Acinetobacter are Gram-negative cocobacilli that are frequently found in the environment but also in the hospital setting where they have been associated with outbreaks of nosocomial infections such as meningitis, endocarditis, skin and soft tissue infections, urinary tract infection, conjunctivitis, burn wound infection and bacteremia. This organism has been shown resistance to different antimicrobial agents. The aim of this study was to determination antibiotic resistance profile of Acinetobacter strains isolated from hospitalized patients in Taleghani hospital (Ahvaz, Iran. Materials and Methods: This cross-sectional study was conducted on 43 Acinetobacter strains isolated from hospitalized patients. Clinical specimens were cultured on microbiological media. Subsequently, drug susceptibility test was performed using the disc diffusion method according to CLSI recommendations. Results: Acinetobacter strains were isolated from different specimens consisting biopsy 24 (55.8%, wound 13 (30/2% and blood 6 (14%. In antimicrobial susceptibility testing, colistin exhibited the greatest activity (60.5% against isolated strains. 33 (76/7% isolates demonstrated resistance to imipenem. Conclusion: In outbreak situations, surveillance cultures of patients involved in the outbreak or who are deemed at risk for colonization/infection with the outbreak organism are often parts of the planned intervention.
Genetic Regulation of Virulence and Antibiotic Resistance in Acinetobacter baumannii
Kröger, Carsten; Kary, Stefani C.; Schauer, Kristina; Cameron, Andrew D. S.
2016-01-01
Multidrug resistant microorganisms are forecast to become the single biggest challenge to medical care in the 21st century. Over the last decades, members of the genus Acinetobacter have emerged as bacterial opportunistic pathogens, in particular as challenging nosocomial pathogens because of the rapid evolution of antimicrobial resistances. Although we lack fundamental biological insight into virulence mechanisms, an increasing number of researchers are working to identify virulence factors and to study antibiotic resistance. Here, we review current knowledge regarding the regulation of virulence genes and antibiotic resistance in Acinetobacter baumannii. A survey of the two-component systems AdeRS, BaeSR, GacSA and PmrAB explains how each contributes to antibiotic resistance and virulence gene expression, while BfmRS regulates cell envelope structures important for pathogen persistence. A. baumannii uses the transcription factors Fur and Zur to sense iron or zinc depletion and upregulate genes for metal scavenging as a critical survival tool in an animal host. Quorum sensing, nucleoid-associated proteins, and non-classical transcription factors such as AtfA and small regulatory RNAs are discussed in the context of virulence and antibiotic resistance. PMID:28036056
Acinetobacter Prosthetic Joint Infection Treated with Debridement and High-Dose Tigecycline.
Vila, Andrea; Pagella, Hugo; Amadio, Claudio; Leiva, Alejandro
2016-12-01
Prosthesis retention is not recommended for multidrug-resistant Acinetobacter prosthetic joint infection due to its high failure rate. Nevertheless, replacing the prosthesis implies high morbidity and prolonged hospitalization. Although tigecycline is not approved for the treatment of prosthetic joint infection due to multidrug resistant Acinetobacter baumannii, its appropriate use may preclude prosthesis exchange. Since the area under the curve divided by the minimum inhibitory concentration is the best pharmacodynamic predictor of its efficacy, we used tigecycline at high dose, in order to optimize its efficacy and achieve implant retention in 3 patients who refused prosthesis exchange. All patients with prosthetic joint infections treated at our Institution are prospectively registered in a database. Three patients with early prosthetic joint infection of total hip arthroplasty due to multidrug resistant A. baumannii were treated with debridement, antibiotics and implant retention, using a high maintenance dose of tigecycline (100 mg every 12 hours). The cases were retrospectively reviewed. All patients signed informed consent for receiving off-label use of tigecycline. Tigecycline was well tolerated, allowing its administration at high maintenance dose for a median of 40 days (range 30-60). Two patients were then switched to minocycline at standard doses for a median of 3.3 months in order to complete treatment. Currently, none of the patients showed relapse. Increasing the dose of tigecycline could be considered as a means to better attain pharmacodynamic targets in patients with severe or difficult-to-treat infections. Tigecycline at high maintenance dose might be useful when retention of the implant is attempted for treatment for prosthetic joint infections due to multidrug resistant Acinetobacter. Although this approach might be promising, off-label use of tigecycline should be interpreted cautiously until prospective data are available. Tigecycline is
Characterization of rhamnolipids produced by non-pathogenic Acinetobacter and Enterobacter bacteria
Czech Academy of Sciences Publication Activity Database
Hošková, M.; Schreiberová, O.; Ježdík, R.; Chudoba, J.; Masák, M.; Sigler, Karel; Řezanka, Tomáš
2013-01-01
Roč. 130, FEB 2013 (2013), s. 510-516 ISSN 0960-8524 R&D Projects: GA ČR(CZ) GAP503/11/0215 Grant - others:GA MPO(CZ) FR-TI1/456 Institutional support: RVO:61388971 Keywords : Pseudomonas aeruginosa * Acinetobacter calcoaceticus * Enterobacter asburiae Subject RIV: EE - Microbiology, Virology Impact factor: 5.039, year: 2013
The effectiveness of samarium-153 (153Sm) lexidronam (EDTMP) in treatment of bone metastases
International Nuclear Information System (INIS)
Ma Yubo; Huang Gang; Liu Jianjun
2004-01-01
Objectives: To evaluate the effectiveness of samarium-153 (153Sm) lexidronam (EDTMP) in treatment of bone metastases. Methods: 380 patients with bone metastases were studied (221 men, 159 women; average age 65.3 y; ranged 27-91 y; average weight 59.3 kg, ranged 39-95 kg). The tumor types were prostate carcinoma (n=155), pulmonary carcinoma (n=92), breast cancer (n=57), gastric carcinoma (n=12), colorectal carcinoma (n=22), nasopharyngeal carcinoma (n=8), lymphoma (n=8), hepatic carcinoma (n=6), ovary carcinoma (n=4) and others (n=16). All patients were received 135Sm-EDTMP 0.8 or 1.0 mCi/kg during 1 to 7 course of treatment. Patients and physician evaluations were used to assess pain relief. Numbers of metastatic foci and activity of ROIs were used to observe post-therapy change in bone scanning. Results: In 380 patients, pain relief was observed in 257 patients (67.6%). Persistence of pain relief was seen through 2 to 24 weeks. The mean relief time is 5.8±3.4 weeks. KPS score was higher 10% than pre-therapy (71.2%±9.6% Vs 80.9%±10.3%, p<0.001). Numbers of metastatic foci (11.2+8.8 Vs 8.4±5.7, p<0.001) and activity of ROIs (3.28±2.04 Vs 2.15±0.94, p<0.01) were less than pre-therapy. Bone marrow suppression was mild and reversible (5.87±1.56 Vs 4.94±1.16 x 109/L). Conclusions: 153Sm-EDTMP provided relief of pain associated with bone metastases and inhibition of metastatic foci. As a relief drug of painful bone metastases, 153Sm-EDTMP is safe and effective. (authors)
Energy Technology Data Exchange (ETDEWEB)
Krishnan, M. [Surface Engineering Division, CSIR-National Aerospace Laboratories, Bangalore 560 017 (India); Department of Physics, National Institute of Technology Calicut, Calicut 673601 (India); Predeep, P. [Department of Physics, National Institute of Technology Calicut, Calicut 673601 (India); Sridhara Rao, D.V. [Defence Metallurgical Research Laboratories, Hyderabad 500058 (India); Prajapat, C.L.; Singh, M.R. [Technical Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Barshilia, Harish C. [Surface Engineering Division, CSIR-National Aerospace Laboratories, Bangalore 560 017 (India); Chowdhury, P., E-mail: pchowdhury@nal.res.in [Surface Engineering Division, CSIR-National Aerospace Laboratories, Bangalore 560 017 (India)
2017-05-15
Hard magnetic thin films with high coercivity were fabricated by magnetron sputtering on MgO(100) and quartz substrates. The films were grown by depositing sequentially Sm and Co layers at an elevated substrate temperature of 500 °C. Subsequent post-annealing was carried out at various temperatures in range of 500–700 °C to form Sm-Co hard magnetic thin films. X-ray diffraction studies revealed the formation of randomly oriented SmCo{sub 5} crystallites on quartz substrate, whereas, a textured growth of Sm{sub 2}Co{sub 7} with strong (110) crystalline phases was observed on MgO substrate. Microstructural analyses were carried out using Transmission Electron Microscopy (TEM) for samples grown on MgO substrate at 650 °C and inferred the presence of high density planar defects along with large grain boundaries. Further microdiffraction studies confirmed the presence of SmCo{sub 3} as an impurity phase in the films. Magnetic hysteresis measurements indicate the square hysteresis behaviors with high coercivity value of 3.1 T and 2.7 T for 650 °C annealed samples on both MgO and quartz substrates, respectively. The origin of such high coercivity value was then correlated with pinning type of spin reversal mechanism as confirmed through the analyses of demagnetization curves. The magnetic force microscopy images for films on MgO substrate, annealed at 650 °C, revealed the presence of magnetic domains with size higher than 1 µm. The formed magnetic domains lacked well defined boundaries indicating an enhanced exchange coupling between the grain clusters. - Highlights: • Ewald technique in micromagnetic simulations with periodic boundary conditions. • Effect of micromagnetic parameters on hysteresis in exchange spring magnets. • Importance of the interface exchange coupling for hard-soft nanocomposites. • Geometry dependence of the optimal soft phase size in exchange spring magnets.
Díaz-Tello, José; Rojas-Jaimes, Jesús; Ibarra-Trujillo, Jimmy; Tárraga-Gonzales, Delza
2017-01-01
The objective was to detect Gram-negative bacilli and Gram-positive cocci isolated from the environmental microbiota of the Intensive Care Unit (ICU) departments of Neonatology, Pediatrics, and Transplants (kidney, liver, and general) in a Lima hospital and determine their antimicrobial sensitivity. Eighty samples were obtained from inanimate surfaces using a wet swab. A total of 61 bacterial strains were identified, including Staphylococcus epidermis (46.0%), Alcaligenes sp. (21.3%), Pseudomonas aeruginosa (16.4%), Acinetobacter sp. (13.1%), Staphylococcus aureus (1.6%), and Staphylococcus haemolyticus (1.6%). Acinetobacter sp. and P. aeruginosa showed a heightened sensitivity to the antibiotics assessed, while Alcaligenes sp. and S. epidermidis presented the highest antimicrobial resistance. It is recommended that sustained asepsis and monitoring methods be used in ICUs.
Directory of Open Access Journals (Sweden)
Clarice Carvalho Alves
2015-02-01
Full Text Available BACKGROUND: A vaccine against schistosomiasis would have a great impact in disease elimination. Sm29 and Sm22.6 are two parasite tegument proteins which represent promising antigens to compose a vaccine. These antigens have been associated with resistance to infection and reinfection in individuals living in endemic area for the disease and induced partial protection when evaluated in immunization trials using naïve mice. METHODOLOGY/PRINCIPALS FINDINGS: In this study we evaluated rSm29 and rSm22.6 ability to induce protection in Balb/c mice that had been previously infected with S. mansoni and further treated with Praziquantel. Our results demonstrate that three doses of the vaccine containing rSm29 were necessary to elicit significant protection (26%-48%. Immunization of mice with rSm29 induced a significant production of IL-2, IFN-γ, IL-17, IL-4; significant production of specific antibodies; increased percentage of CD4+ central memory cells in comparison with infected and treated saline group and increased percentage of CD4+ effector memory cells in comparison with naïve Balb/c mice immunized with rSm29. On the other hand, although immunization with Sm22.6 induced a robust immune response, it failed to induce protection. CONCLUSION/SIGNIFICANCE: Our results demonstrate that rSm29 retains its ability to induce protection in previously infected animals, reinforcing its potential as a vaccine candidate.
Potential topical natural repellent against Ae. aegypti, Culex sp. and Anopheles sp. mosquitoes
Directory of Open Access Journals (Sweden)
Dewi Nur Hodijah
2014-08-01
Full Text Available AbstrakLatar belakang:Minyak atsiri daun sirih diketahui mempunyai daya proteksi. Dibuatkan losion berdasarkan pengantar sediaan farmasi yang ditambahkan minyak atsiri daun nilam. Sediaan losion dipilih agar dapat menempel lebih lama di permukaan kulit. Tujuan penelitian ini untuk membandingkan daya proteksi antara losion dengan penambahan minyak nilam dan losion tanpa penambahan minyak nilam dibandingkan daya proteksi dengan DEET. Metode: Penelitian ini merupakan penelitian eksperimental laboratorium. Semua nyamuk uji berasal dari insektarium laboratorium penelitian kesehatan Loka litbang P2B2 Ciamis. Konsentrasi minyak atsiri daun sirih dalam losion adalah 4%; konsentrasi minyak nilam sebagai zat pengikat adalah 0,4%. Formula yang digunakan yaitu formula dasar yang ada pada pengantar sediaan farmasi. Uji repelensi dilakukan dengan menggunakan metoda yang direkomendasikan oleh Komisi pestisida.Hasil: Dihasilkan formulasi losion yang stabil dan masih memenuhi standar formulasi sediaan. Berdasarkan hasil, diperoleh data bahwa DEET dan losion hasil modifikasi memiliki rata-rata daya proteksi di atas 90% selama 6 jam terhadap nyamuk Ae.aegypti dan Culex sp. Kesimpulan: Penambahan minyak nilam pada losion sirih dapat meningkatkan daya proteksi terhadap hinggapan nyamuk Ae. aegypti dan Culex sp. (Health Science Indones 2014;1:44-8Kata kunci:repelen alamiah, minyak atsiri, daun sirih, daun nilam, Ae. aegypti, Culex sp.AbstractBackground: Betel leaf essential oil lotion has been known to have insect repellent properties. A lotion was made based on a pharmaceutical formula from a monograph where patchouli leaf essential oil was added. A lotion preparation was intended to enhance adherence of the formula on the surface of the skin. The purpose of this study was to compare protection percentage of lotion with patchouli oil and without patchouli oil lotion compared to DEET.Methods: This study is an experimental laboratory-based research. All mosquitoes
Directory of Open Access Journals (Sweden)
Neda Farahani
2013-03-01
Full Text Available Background & Objective : Currently, Acinetobacter baumannii is an important nosocomial pathogen insofar as its hospital outbreaks have been described from various geographical areas. Since the discrimination of strains within a species is important for delineating nosocomial outbreaks, this study was conducted with the aim of genotyping the A. baumannii clinical strains in Tehran via the pulsed-field gel electrophoresis (PFGE method, which is the most accurate method used for the typing of bacterial species. Materials & methods: This study was performed on 70 isolates of acinetobacter baumannii isolated from patients from Baqiyatallah, Rasoole Akram, and Milad hospitals in Tehran. Cultural and biochemical methods were used for the identification of the isolates in species level, and then susceptibility tests were carried out on 50 isolates of A. baumannii using the disk diffusion method. The PFGE method was performed on the isolates by Apa I restriction enzyme. Finally, the results of the PFGE were analyzed. Result: Acinetobacter baumannii strains isolated from hospitals in Tehran showed seven different genetic patterns, two of which were sporadic . Also, genotypic profiles were different in each hospital, and different patterns of genetic resistance to common antibiotics were observed. Conclusion: A lthough diversity was observed among the strains of A. baumannii by the PFGE method in Tehran, no epidemic strains were found among them.
Hydrogen-induced amorphization of SmFe{sub 3}
Energy Technology Data Exchange (ETDEWEB)
Kubis, M.; Handstein, A.; Gebel, B.; Gutfleisch, O.; Mueller, K.-H.; Schultz, L. [Institut fuer Festkoerper- und Werkstofforschung Dresden e.V. (Germany). Inst. fuer Metallische Werkstoffe
2000-07-01
The hydrogen absorption behavior of SmFe{sub 3} (PuNi{sub 3}-type structure) was observed in the range from 0.05 to 4 MPa by differential scanning calorimetry. The structural changes were observed by X-ray diffraction measurements. For pressures below 0.8 MPa two exothermic reactions were found which are attributed (i) to the interstitial absorption and (ii) to the disproportionation into SmH{sub 2} and {alpha}-Fe. For higher hydrogen pressures, the second exothermic peak occured at significantly lower temperatures and splitted into two peaks. The first one was identified as the exothermic signal of the hydrogen-induced amorphization of the SmFe{sub 3} hydride. The second peak is caused by the precipitation of SmH{sub 2} and {alpha}-Fe from the amorphous material. (orig.)
International Nuclear Information System (INIS)
Sajimol, R.; Bera, S.; Nalini, S.; Sivaraman, N.; Joseph, M.; Kumar, T.
2016-01-01
Rate of evaporation of Sm and Nd from their mixture was studied based on their ion intensities using thermal ionization mass spectrometry. Because of the comparatively larger evaporation rate of Sm, it was found possible to get the isotopic composition of Nd (fission product monitor) free from isobaric interference of Sm isotopes. The decrease in ion intensity of Sm was studied as a function of time and filament temperature. Based on this study, an easy and time effective method for the determination of burn-up of spent nuclear fuel was examined and the results are compared with that obtained by the conventional method. Typical burn-up value obtained for a pressurized heavy water reactor fuel dissolver solution using the direct method by preferential evaporation of Sm is: 0.84 at.%, whereas the one obtained by the use of conventional method is 0.82 at.%. In both the cases, Nd was employed as the fission product monitor. (author)
Photoluminescent properties of LiSrxBa1-xPO4:RE3+ (RE = Sm3+, Eu3+) f-f transition phosphors
International Nuclear Information System (INIS)
Tu Dong; Liang Yujun; Liu Rong; Cheng Zheng; Yang Fan; Yang Wenlong
2011-01-01
Highlights: → Novel phosphors LiSr x Ba 1-x PO 4 : Sm 3+ and LiSr x Ba 1-x PO 4 : Eu 3+ have been synthesized by solid-state reaction method. → The LiSr x Ba 1-x PO 4 : Sm 3+ and LiSr x Ba 1-x PO 4 : Eu 3+ phosphors may be potential f-f transition phosphors used in LED. → The emission intensity of the LiSr x Ba 1-x PO 4 : Sm 3+ and LiSr x Ba 1-x PO 4 : Eu 3+ phosphors can be enhanced by increasing the value of x. - Abstract: Rare-earth ions (Sm 3+ or Eu 3+ ) doped LiSr x Ba 1-x PO 4 (x = 0, 0.2, 0.4, 0.6, 0.8, 1.0) f-f transition phosphor powders were prepared by a high temperature solid-state reaction. The resulted phosphors were characterized by X-ray diffraction (XRD) and photoluminescence (PL) spectroscopy. The results of XRD indicate that the phase structure of the sample changes from LiBaPO 4 to LiSrPO 4 when x changes from 0 to 1.0. The excitation spectra indicate that only direct excitation of rare earth ions (Sm 3+ or Eu 3+ ) can be observed. The doped rare earth ions show their characteristic emission in LiSr x Ba 1-x PO 4 , i.e., Eu 3+5 D 0 - 7 F J (J = 0, 1, 2, 3, 4), Sm 3+4 G 5/2 → 6 H J (J = 5/2, 7/2, 9/2, 11/2), respectively. The dependence of the emission intensities of the LiSr x Ba 1-x PO 4 :Sm 3+ and LiSr x Ba 1-x PO 4 :Eu 3+ phosphors on the x value and Ln 3+ (Ln 3+ = Sm 3+ , Eu 3+ ) concentration is also investigated.
Abdalla, Nazar M; Osman, Amani A; Haimour, Waleed O; Sarhan, Mohammed A A; Mohammed, Mohammed N; Zyad, Eyhab M; Al-Ghtani, Abdalla M
2013-03-15
This study aimed at evaluating the sensitivity of antibiotics towards nosocomial infections caused by Acinetobacter species. The study took place during the period Dec. 2011- Dec. 2012 at Assir Central Hospital in collaboration with the department of microbiology, college of medicine, King Khalid University, Abha. A prospective study involving 150 patients presented with nosocomial infections due to Acinetobacter species detected by bacteriological tests; direct microscopy, culture in blood agar media, fermentation test in MacConkey media and MIC (minimum inhibitory concentration) for antibiotics sensitivity using Muller Hinton media and Chemical test using API 20. A 150 nosocomial infections in this study showed gram-negative coccobacilli, non motile, glucose-negative fermentor and oxidase negative. All isolates showed 100% sensitivity to: Imipramine, Meropenem, Colistin. From the rest of tested antibiotics the higher resistant ones were; Nitrofurantoin 87% and Cefoxitin 85%. The least resistant antibiotics; Imipenem 3% and Ticarcillin 7%. While variable resistance in the rest of tested antimicrobials. A 47 patients (31.3%) have used antibiotics prior to this study. The high rate of usage occurred in elder patients. The frequency of Acinetobacter calcoaceticus baumannii complex multi-drugs resistance ABCMDR is rising including almost all commonly used antibiotics. Only few antibiotics exert 100% sensitivity towards these bacteria.
International Nuclear Information System (INIS)
Raut, R.; Ganguly, S.; Kshetri, R.; Banerjee, P.; Bhattacharya, S.; Dasmahapatra, B.; Mukherjee, A.; Mukherjee, G.; Sarkar, M. Saha; Goswami, A.; Gangopadhyay, G.; Mukhopadhyay, S.; Krishichayan,; Chakraborty, A.; Ghughre, S. S.; Bhattacharjee, T.; Basu, S. K.
2006-01-01
The high spin states of 143 Sm have been studied by in-beam γ-spectroscopy following the reaction 130 Te( 20 Ne,7n) 143 Sm at E lab =137 MeV, using a Clover detector array. More than 50 new gamma transitions have been placed above the previously known J π =23/2 - , 30 ms isomer at 2795 keV. The level scheme of 143 Sm has been extended up to 12 MeV and spin-parity assignments have been made to most of the newly proposed level. Theoretical calculation with the relativistic mean field approach using blocked BCS method, has been performed. A sequence of levels connected by M1 transitions have been observed at an excitation energy ∼8.6 MeV. The sequence appears to be a magnetic rotational band from systematics
Tigecycline use in two cases with multidrug-resistant Acinetobacter baumannii meningitis.
Tutuncu, E Ediz; Kuscu, Ferit; Gurbuz, Yunus; Ozturk, Baris; Haykir, Asli; Sencan, Irfan
2010-09-01
The treatment of post-surgical meningitis due to multidrug-resistant (MDR) Acinetobacter baumannii is a therapeutic dilemma. The cases of two patients with MDR A. baumannii meningitis secondary to surgical site infections, successfully treated with combination regimens including tigecycline, are presented. Copyright © 2009 International Society for Infectious Diseases. Published by Elsevier Ltd. All rights reserved.
Chemical methods for Sm-Nd separation and its application in isotopic geological dating
International Nuclear Information System (INIS)
Guo Qifeng.
1990-01-01
Three chemical methods for Sm-Nd separation are mainly desribed: low chromatography of butamone-ammonium thiocyanate for hight concentration Sm and Nd separation, P 240 column chromatography for medium concentration Sm-Nd separation, and pressure ion exchange for low concentration Sm-Nd. The first Sm-Nd synchrone obtained in China with Sm-Nd methods is introduced and Sm-Nd isotopic geological dating in Early Archaean rocks in eastern Hebei has been determined
Smáčivost povrchových úprav DPS
Minář, Jan
2016-01-01
Tato bakalářská práce se zabývá měřením smáčecích charakteristik pomocí metody smáčecích vah u vzorků různých povrchových úprav od firmy Gatema. Věnuje se vlivu izotermálního stárnutí a přetavovacích procesů na smáčecí charakteristiky povrchových úprav ENIG, bezolovnatý HAL a imerzní cín. U povrchové úpravy imerzním cínem je sledován vliv intermetalické vrstvy na celkovou smáčivost. Dále se zabývá smáčivostí vrstvy niklu, po odstripování zlata, u povrchové úpravy ENIG. This bachelor’s thes...
VUV light induced valence degeneration in Sm over-layer on HOPG
International Nuclear Information System (INIS)
Kutluk, G; Nakatake, M; Arita, M; Namatame, H; Taniguchi, M; Ishitobi, Y; Sumida, H
2013-01-01
Systematic investigation of the influence of vacuum ultraviolet (VUV) irradiation on the valence degeneration in a Sm over-layer on a HOPG substrate was performed using in-situ photoemission spectroscopy (XPS, UPS, and ARPES) for the Sm coverage regime of 0.05-3.6 Å. This investigation confirmed that VUV irradiation-induced degeneration of divalent Sm exerts a more profound effect than Sm contamination during photoemission spectroscopy even under UHV. We found that the charge transfer occurs mainly from divalent Sm to the HOPG surface.
β-decay spectroscopy of neutron-rich 160,161,162Sm isotopes
Directory of Open Access Journals (Sweden)
Patel Z.
2016-01-01
Full Text Available Neutron-rich 160,161,162Sm isotopes have been populated at the RIBF, RIKEN via β first time. β-coincident γ rays were observed in all three isotopes including γ rays from the isomeric decay of 160Sm and 162Sm. The isomers in 160Sm and 162Sm have previously been observed but have been populated via β decay for the first time. The isomeric state in 162Sm is assigned a 4−v72+[ 633 ]⊗v12−[ 521 ]${4^ - }v{{7 \\over 2}^ + }\\left[ {633} \\right] \\otimes v{{1 \\over 2}^ - }\\left[ {521} \\right]$ configuration based on the decay pattern. The level schemes of 160Sm and 162Sm are presented. The ground states in the parent nuclei 160Pm and 162Pm are both assigned a 6−v72+[633]⊗π52−[532]${6^ - }v{{7 \\over 2}^ + }\\left[ {633} \\right] \\otimes \\pi {{5 \\over 2}^ - }\\left[ {532} \\right]$ configuration based on the population of states in the daughter nuclei. Blocked BCS calculations were performed to further investigate the spin-parities of the ground states in 160Pm, 161Pm, and 162Pm, and the isomeric state in 162Sm
Directory of Open Access Journals (Sweden)
Songzhe eHE
2015-05-01
Full Text Available Objective To investigate the in vitro and in vivo antibacterial activities of tigecycline and other 13 common antimicrobial agents, alone or in combination, against multi-drug resistant Acinetobacter baumannii.MethodsAn in vitro susceptibility test of 101 Acinetobacter baumannii was used to detect minimal inhibitory concentrations (MICs. A mouse lung infection model of multi-drug resistant Acinetobacter baumannii,established by the ultrasonic atomization method, was used to define in vivo antimicrobial activities.Results Multi-drug resistant Acinetobacter baumannii showed high sensitivity to tigecycline (98% inhibition, polymyxin B (78.2% inhibition, and minocycline (74.2% inhibition. However, the use of these antimicrobial agents in combination with other antimicrobial agents produced synergistic or additive effects. In vivo data showed that white blood cell (WBC counts in drug combination groups C (minocycline + amikacin and D (minocycline + rifampicin were significantly higher than in groups A (tigecycline and B (polymyxin B (P < 0.05, after administration of the drugs 24h post-infection. Lung tissue inflammation gradually increased in the model group during the first 24h after ultrasonic atomization infection; vasodilation, congestion with hemorrhage were observed 48h post infection. After three days of anti-infective therapy in groups A, B, C and D, lung tissue inflammation in each group gradually recovered with clear structures. The mortality rates in drug combination groups (groups C and D were much lower than in groups A and B.ConclusionThe combination of minocycline with either rifampicin or amikacin is more effective against multidrug-resistant Acinetobacter baumannii than single-agent tigecycline or polymyxin B. In addition, the mouse lung infection by ultrasonic atomization is a suitable model for drug screening and analysis of infection mechanism.
Jouda, Jean-Bosco; Kusari, Souvik; Lamshöft, Marc; Mouafo Talontsi, Ferdinand; Douala Meli, Clovis; Wandji, Jean; Spiteller, Michael
2014-10-01
Three new polyketides named penialidins A-C (1-3), along with one known compound, citromycetin (4), were isolated from an endophytic fungus, Penicillium sp., harbored in the leaves of the Cameroonian medicinal plant Garcinia nobilis. Their structures were elucidated by means of spectroscopic and spectrometric methods (NMR and HRMS(n)). The antibacterial efficacies of the new compounds (1-3) were tested against the clinically-important risk group 2 (RG2) bacterial strains of Staphylococcus aureus and Escherichia coli. The ecologically imposing strains of E. coli (RG1), Bacillus subtilis and Acinetobacter sp. BD4 were also included in the assay. Compound 3 exhibited pronounced activity against the clinically-relevant S. aureus as well as against B. subtilis comparable to that of the reference standard (streptomycin). Compound 2 was also highly-active against S. aureus. By comparing the structures of the three new compounds (1-3), it was revealed that altering the substitutions at C-10 and C-2 can significantly increase the antibacterial activity of 1. Copyright © 2014 Elsevier B.V. All rights reserved.
Neonatal meningitis Escherichia coli isolates (SP-4, SP-5, SP-13, SP-16, SP-46, and SP-65) were recovered from infants in the Netherlands from 1989 to 1997. Here, we report the draft genome sequences for these six E. coli isolates, which are currently being used to validate food safety processing te...
Higher-order scalar interactions and SM vacuum stability
Energy Technology Data Exchange (ETDEWEB)
Lalak, Zygmunt; Lewicki, Marek; Olszewski, Paweł [Institute of Theoretical Physics, Faculty of Physics, University of Warsawul. Hoża 69, Warsaw (Poland)
2014-05-26
Investigation of the structure of the Standard Model effective potential at very large field strengths opens a window towards new phenomena and can reveal properties of the UV completion of the SM. The map of the lifetimes of the vacua of the SM enhanced by nonrenormalizable scalar couplings has been compiled to show how new interactions modify stability of the electroweak vacuum. Whereas it is possible to stabilize the SM by adding Planck scale suppressed interactions and taking into account running of the new couplings, the generic effect is shortening the lifetime and hence further destabilisation of the SM electroweak vacuum. These findings have been illustrated with phase diagrams of modified SM-like models. It has been demonstrated that stabilisation can be achieved by lowering the suppression scale of higher order operators while picking up such combinations of new couplings, which do not deepen the new minima of the potential. Our results show the dependence of the lifetime of the electroweak minimum on the magnitude of the new couplings, including cases with very small couplings (which means very large effective suppression scale) and couplings vastly different in magnitude (which corresponds to two different suppression scales)
Synthesis and magnetic properties of SmOOH crystals
Energy Technology Data Exchange (ETDEWEB)
Samata, Hiroaki, E-mail: samata@maritime.kobe-u.ac.jp [Graduate School of Maritime Sciences, Kobe University, Fukaeminami, Higashinada, Kobe, Hyogo 658-0022 (Japan); Hanioka, Masashi [Graduate School of Maritime Sciences, Kobe University, Fukaeminami, Higashinada, Kobe, Hyogo 658-0022 (Japan); Ozawa, Tadashi C. [Materials Development Group, Superconducting Properties Unit, National Institute for Materials Science, Sengen, Tsukuba, Ibaraki 305-0047 (Japan)
2016-01-15
Samarium oxyhydroxide (SmOOH) crystals were synthesized using a flux method. The as-grown crystals were yellowish, transparent, and elongated with a maximum length of approximately 1.0 mm. SmOOH adopts a monoclinic structure in the space group P2{sub 1}/m with a=0.4356 nm, b=0.3766 nm, c=0.6139 nm, and β=108.464°. The magnetic susceptibility of the SmOOH crystals exhibited typical Van Vleck paramagnetism, and the experimental data at temperatures above 200 K were in close agreement with the calculated results using a spin-orbit coupling constant λ=443 K (308 cm{sup −1}). - Highlights: • SmOOH crystals were synthesized via flux method and characterized. • Magnetic susceptibilities above 200 K agreed with theoretical Van Vleck values. • Discrepancies were observed at lower temperatures based on the crystalline field.
Biochemical Characterization of Lipases Obtained from Acinetobacter psychrotolerans Strains
Directory of Open Access Journals (Sweden)
Şule SEREN
2017-12-01
Full Text Available In this study, extracellular lipases obtained from Acinetobacter psychrotolerans strains (Xg1 and Xg2 were characterized. The effects of varying pH values (3.0-10.0 and various temperatures (10-90 °C on lipase activities were examined. Also the effects of different metal ions, organic solvents and detergents on lipases were studied. The extracellular crude lipases were concentrated using ultrafiltration. Zymogram analysis of these lipases was performed. Lipases exhibited maximum activity at pH 8 and 30 °C. While lipase obtained from the Xg1 strain exhibited the highest stability in the presence of various organic solvents, including hexane, ethyl acetate, chloroform and N,N dietil formamide, lipase obtained from the Xg2 strain was sensitive in the presence of isopropanol, acetonitrile, and butan-1-ol. The lipases of the Xg1 and Xg2 strains were inhibited in the presence of Cu2+ and Zn2+. Also, the lipase of the Xg1 strain was inhibited in the presence of Fe3+. In the presence of EDTA, the lipase activities of the Xg1 and Xg2 strains were partially inhibited. In presence of SDS, they were exactly inhibited. According to the zymogram results, the molecular weights of the lipases obtained from the Acinetobacter psychrotolerans Xg1 and Xg2 strains have been found approximately 37 and 30 kDa, respectively.
Cryo-electron tomography analysis of membrane vesicles from Acinetobacter baumannii ATCC19606(T)
Koning, Roman I.; de Breij, Anna; Oostergetel, Gert T.; Nibbering, Peter H.; Koster, Abraham J.; Dijkshoorn, Lenie
Acinetobacter baumannii is an important nosocomial pathogen responsible for colonization and infection of critically ill patients. Its virulence attributes together with the condition of the host determine the pathogenicity of A. baumannii. These virulence factors may be delivered to host cells by
Towards an explanation for the success of Acinetobacter baumannii in the human host
Breij, Anastasia (Anna)
2012-01-01
Acinetobacter baumannii is an important nosocomial pathogen responsible for outbreaks of infection worldwide. The studies presented in this thesis aimed to gain further insight into the bacterial and host factors associated with the pathogenesis of A. baumannii to seek an explanation for the
Gaderer, Romana; Lamdan, Netta L; Frischmann, Alexa; Sulyok, Michael; Krska, Rudolf; Horwitz, Benjamin A; Seidl-Seiboth, Verena
2015-01-16
The proteins Sm1 and Sm2 from the biocontrol fungus Trichoderma virens belong to the cerato-platanin protein family. Members of this family are small, secreted proteins that are abundantly produced by filamentous fungi with all types of life-styles. Some species of the fungal genus Trichoderma are considered as biocontrol fungi because they are mycoparasites and are also able to directly interact with plants, thereby stimulating plant defense responses. It was previously shown that the cerato-platanin protein Sm1 from T. virens - and to a lesser extent its homologue Epl1 from Trichoderma atroviride - induce plant defense responses. The plant protection potential of other members of the cerato-platanin protein family in Trichoderma, however, has not yet been investigated. In order to analyze the function of the cerato-platanin protein Sm2, sm1 and sm2 knockout strains were generated and characterized. The effect of the lack of Sm1 and Sm2 in T. virens on inducing systemic resistance in maize seedlings, challenged with the plant pathogen Cochliobolus heterostrophus, was tested. These plant experiments were also performed with T. atroviride epl1 and epl2 knockout strains. In our plant-pathogen system T. virens was a more effective plant protectant than T. atroviride and the results with both Trichoderma species showed concordantly that the level of plant protection was more strongly reduced in plants treated with the sm2/epl2 knockout strains than with sm1/epl1 knockout strains. Although the cerato-platanin genes sm1/epl1 are more abundantly expressed than sm2/epl2 during fungal growth, Sm2/Epl2 are, interestingly, more important than Sm1/Epl1 for the promotion of plant protection conferred by Trichoderma in the maize-C. heterostrophus pathosystem.
The ternary systems Sc-Sm(Dy)-Si at 870 K
International Nuclear Information System (INIS)
Kotur, B.Ya.; Mokra, I.Ya.; Toporinskij, A.Ya.
1991-01-01
Isothermal cross sections of the ternary systems Sc-Sm-Si and Sc-Dy-Si at 870 K have been plotted. Investigation of scandium and disprosium in ternary systems have been examined by X-ray diffraction and microstructure analysis. Besides literary data on binary systems Sc-Si, Sm-Si, Dy-Si have been used. Formation of limited (Sc-Sm-Si, Sc-Dy-Si) and continuous (Sc-Dy-Si) solid solutions based on bisilicides of Sc and Sm(Dy) is discovered. Two and five ternary compounds in Sc-Sm-Si and Sc-Dy-Si systems have been determined and their crystal structure has been established. When investigating of Sc-(rare earth element)-Si ternary systems and should take into account the specific interaction of scandium and samarium with REE
Directory of Open Access Journals (Sweden)
Beieler Alison M
2009-02-01
Full Text Available Abstract Introduction Multidrug-resistant Acinetobacter baumannii has become a significant cause of healthcare-associated infections, but few reports have addressed Acinetobacter baumannii infections associated with orthopedic devices. The current recommended treatment for complicated infections due to orthopedic devices, including resistant gram-negative rods, consists of antimicrobial therapy with debridement and removal of implants. Case presentation The patient, a 47-year-old woman, had previously had a prior total hip arthroplasty at 16 years of age for a complex femoral neck fracture, and multiple subsequent revisions. This time, she underwent a fifth revision secondary to pain. Surgery was complicated by hypotension resulting in transfer to the intensive care unit and prolonged respiratory failure. She received peri-operative cefazolin but postoperatively developed surgical wound drainage requiring debridement of a hematoma. Cultures of this grew ampicillin-sensitive Enterococcus and Acinetobacter baumannii (sensitive only to amikacin and imipenem. The patient was started on imipenem. Removal of the total hip arthroplasty was not recommended because of the recent surgical complications, and the patient was eventually discharged home. She was seen weekly for laboratory tests and examinations and, after 4 months of therapy, the imipenem was discontinued. She did well clinically for 7 months before recurrent pain led to removal of the total hip arthroplasty. Intra-operative cultures grew ampicillin-sensitive Enterococcus and coagulase-negative Staphylococcus but no multidrug-resistant Acinetobacter baumannii. The patient received ampicillin for 8 weeks and had not had recurrent infection at the time of writing, 37 months after discontinuing imipenem. Conclusion We describe the successful treatment of an acute infection from multidrug-resistant Acinetobacter baumannii with debridement and retention of the total hip arthroplasty, using
Fusarium wilt is a major disease of watermelon caused by the soil-borne fungus Fusarium oxysporum Schlechtend.:Fr. f. sp. niveum (E.F. Sm.) W.C. Snyder & H.N. Hans (Fon). Fon race 1 is most prevalent throughout the U.S. while race 2 is more virulent. Our overall objective is to identify and utilize ...
Range Roads: Final Programmatic Environmental Assessment
2002-12-01
Natural Resources Conservation Service as Lakeland Series soils. Other surface soils found at Eglin include the Tifton and Troup Series (Albertson et...feet) USCS Class Clay (%) K-Factor Lakeland 0-40 SP-SM 1-8 0.17 40-80 SP, SP-SM 1-6 Tifton 0-16 SM 10-20 0.20 16-34 SM 13-22 34-60 SM...Revised Recovery Plan. U.S. Fish and Wildlife Service, Region 4, Atlanta, GA . April 1998. Jelks, H. L. and K. A. Shawn, 1998. Draft Okaloosa Darter
Klimaforsøg med fravænnede smågrise
DEFF Research Database (Denmark)
Feenstra, A.
Publikationen belyser betydningen af luftfugtighed og ventilationsluftmængder for smågrise. Undersøgelsen var led i bestræbelserne på at nedbringe energiforbruget i smågrisestalde, og resultaterne viser at ventilationsmængden kan formindskes uden skadelige virkninger for dyrene.......Publikationen belyser betydningen af luftfugtighed og ventilationsluftmængder for smågrise. Undersøgelsen var led i bestræbelserne på at nedbringe energiforbruget i smågrisestalde, og resultaterne viser at ventilationsmængden kan formindskes uden skadelige virkninger for dyrene....
Spin measurements for 147Sm+n resonances: Further evidence for nonstatistical effects
International Nuclear Information System (INIS)
Koehler, P. E.; Ullmann, J. L.; Bredeweg, T. A.; O'Donnell, J. M.; Reifarth, R.; Rundberg, R. S.; Vieira, D. J.; Wouters, J. M.
2007-01-01
We have determined the spins J of resonances in the 147 Sm(n,γ) reaction by measuring multiplicities of γ-ray cascades following neutron capture. Using this technique, we were able to determine J values for all but 14 of the 141 known resonances below E n =1 keV, including 41 firm J assignments for resonances whose spins previously were either unknown or tentative. These new spin assignments, together with previously determined resonance parameters, allowed us to extract level spacings (D 0,3 =11.76±0.93 and D 0,4 =11.21±0.85 eV) and neutron strength functions (10 4 S 0,3 =4.70±0.91 and 10 4 S 0,4 =4.93±0.92) for J=3 and 4 resonances, respectively. Furthermore, cumulative numbers of resonances and cumulative reduced neutron widths as functions of resonance energy indicate that very few resonances of either spin have been missed below E n =700 eV. This conclusion is strengthened by the facts that, over this energy range, Wigner distributions calculated using these D 0 values agree with the measured nearest-neighbor level spacings to within the experimental uncertainties, and that the Δ 3 values calculated from the data also agree with the expected values. Because a nonstatistical effect recently was reported near E n =350 eV from an analysis of 147 Sm(n,α) data, we divided the data into two regions; 0 n n n 0 distribution for resonances below 350 eV is consistent with the expected Porter-Thomas distribution. However, we found that Γ n 0 data in the 350 n 2 distribution having ν≥2 We discuss possible explanations for these observed nonstatistical effects and their possible relation to similar effects previously observed in other nuclides
Epidemiology of multiple Acinetobacter outbreaks in The Netherlands during the period 1999-2001
van den Broek, P. J.; Arends, J.; Bernards, A. T.; De Brauwer, E.; Mascini, E. M.; van der Reijden, T. J. K.; Spanjaard, L.; Thewessen, E. A. P. M.; van der Zee, A.; van Zeijl, J. H.; Dijkshoorn, L.
An increase in the number of outbreaks of Acinetobacter infection was notified in The Netherlands during 1999-2001. The present study compared the outbreaks at the species and strain levels, and analysed the epidemiology and control measures at the different locations. For each institute, three
Goncharov, I; Palfi, Z; Bindereif, A; Michaeli, S
1999-04-30
Trans-splicing in trypanosomes involves the addition of a common spliced leader (SL) sequence, which is derived from a small RNA, the SL RNA, to all mRNA precursors. The SL RNA is present in the cell in the form of a ribonucleoprotein, the SL RNP. Using conventional chromatography and affinity selection with 2'-O-methylated RNA oligonucleotides at high ionic strength, five proteins of 70, 16, 13, 12, and 8 kDa were co-selected with the SL RNA from Leptomonas collosoma, representing the SL RNP core particle. Under conditions of lower ionic strength, additional proteins of 28 and 20 kDa were revealed. On the basis of peptide sequences, the gene coding for a protein with a predicted molecular weight of 11.9 kDa was cloned and identified as homologue of the cis-spliceosomal SmE. The protein carries the Sm motifs 1 and 2 characteristic of Sm antigens that bind to all known cis-spliceosomal uridylic acid-rich small nuclear RNAs (U snRNAs), suggesting the existence of Sm proteins in trypanosomes. This finding is of special interest because trypanosome snRNPs are the only snRNPs examined to date that are not recognized by anti-Sm antibodies. Because of the early divergence of trypanosomes from the eukaryotic lineage, the trypanosome SmE protein represents one of the primordial Sm proteins in nature.
NCBI nr-aa BLAST: CBRC-PTRO-04-0004 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PTRO-04-0004 sp|Q8VBS7|VN1A6_MOUSE Vomeronasal type-1 receptor A6 (Vomeronasal... type-1 receptor A3) (Vomeronasal type-1 receptor A1) (Vomeronasal type-1 receptor A10) dbj|BAB79209.1| vomeronasa...l receptor 1 A1 [Mus musculus] dbj|BAB79210.1| vomeronasal receptor 1 A3 [Mus musculus] gb|AAK98772.1| vomeronasa
Directory of Open Access Journals (Sweden)
Fahimeh Nourbakhsh
2017-01-01
Full Text Available Background Acinetobacter baumannii is a significant nosocomial pathogen around the world, especially in the intensive care unit that most A. baumannii infections are caused by the outbreak strains. Objectives This study has been performed in Acinetobacter baumannii isolates, aimed to detect integron classes I, II, III and molecular typing of A. baumannii genes. Methods In this Cross-sectional study, Acinetobacter baumannii isolated from 150 patients in Isfahan hospitals then antibiotic resistance pattern was determined by disk diffusion method (Kirby Bauer. The presence of genes coding in antibiotic resistance and integrons class I, II, III were analyzed by using of M-PCR method. The data were analyzed by Chi-square, Fischer’s test and SPSS statistical software version 16. Results Antibiotic resistance pattern for Acinetobacter baumannii show that the high resistance was for ciprofloxacin with frequency of 98.3%, ceftazidime with 89.4%, and tetracycline with frequency of 87.3%. The most sensitive antibiotics were chloramphenicol, and nitrofurantoin with frequency of 3.5% and 3.2% resistance. The detection of dfrA1 (63.7%, sul1 (68.6%, aac (3-IV (54.4%, tet (B (22.4%, tet (A (78.3%, aadA1 (15.4%, CITM (17. %, vim (12.2%, Qnr (17.1%, blaSHV (19.8%, sim (7.8%, Oxa-24-like (13.2%, Oxa-51-like (11.9%, Oxa-58-like (39.4%, Oxa-23-like (12.6%, imp (9.2%, cmlA (19% and cat1 (8.6% were respectively reported too. Also in this study Frequency of integrons class 1, 2, 3 were (100%, (28%, (6.6% respectively. Conclusions High prevalence of integrons among Acinetobater baumannii isolated from Isfahan hospitals indicate the importance role of integron classes in multidrug resistance. Considering the increasing pattern of MDR infections is one of the important issues of treatment which can be effective strategy for curing.
Drug resistance patterns of acinetobacter baumannii in makkah, saudi arabia
International Nuclear Information System (INIS)
Khan, M.A.; Ashshi, A.M.; Mahomed, M.F.
2012-01-01
Background: Acinetobacter baumannii causes infections of respiratory, urinary tract, blood stream and surgical sites. Its clinical significance has increased due to its rapidly developing resistance to major groups of antibiotics used for its treatment. There is limited data available on antimicrobial susceptibility of A. baumannii from Saudi Arabia. Objectives: To determine the patterns of drug resistance of Acinetobacter baumannii and predisposing factors for its acquisition.Subjects and Methods: In this descriptive study, 72 hospitalized patients infected with A baumannii were studied. The clinical and demographic data of the patients were collected using a predesigned questionnaire. Isolation and identification of A.baumannii from all clinical specimens were done using standard microbiological methods. Antibiotic susce ptibility testing was performed by disk diffusion method recommended by Clinical Laboratory Standards Institute. Results: Majority of the isolates (61.1%) were from respiratory tract infections. A.baumannii isolates showed high drug resistance to piperacil lin (93.1%), aztreonam (80.5%), ticarcillin, ampicillin, and tetracycline (76.4%, each) and cefotaxime (75%). Only amikacin showed low rate of resistance compared to other antibiotics (40.3%). About 36% patients had some underlying diseases with diabetes mellitus (11%) being the predominant underlying disease. Conclusions: High antimicrobial resistance to commonly used antibiotics was seen against A.baumannii isolates. Only amikacin was most effective against it. (author)
Soil Moisture Active Passive Mission L4_SM Data Product Assessment (Version 2 Validated Release)
Reichle, Rolf Helmut; De Lannoy, Gabrielle J. M.; Liu, Qing; Ardizzone, Joseph V.; Chen, Fan; Colliander, Andreas; Conaty, Austin; Crow, Wade; Jackson, Thomas; Kimball, John;
2016-01-01
core validation site comparisons indicate that "Version 2" of the L4_SM data product meets the self-imposed L4_SM accuracy requirement, which is formulated in terms of the ubRMSE: the RMSE (Root Mean Square Error) after removal of the long-term mean difference. The overall ubRMSE of the 3-hourly L4_SM surface soil moisture at the 9 km scale is 0.035 cubic meters per cubic meter requirement. The corresponding ubRMSE for L4_SM root zone soil moisture is 0.024 cubic meters per cubic meter requirement. Both of these metrics are comfortably below the 0.04 cubic meters per cubic meter requirement. The L4_SM estimates are an improvement over estimates from a model-only SMAP Nature Run version 4 (NRv4), which demonstrates the beneficial impact of the SMAP brightness temperature data. L4_SM surface soil moisture estimates are consistently more skillful than NRv4 estimates, although not by a statistically significant margin. The lack of statistical significance is not surprising given the limited data record available to date. Root zone soil moisture estimates from L4_SM and NRv4 have similar skill. Results from comparisons of the L4_SM product to in situ measurements from nearly 400 sparse network sites corroborate the core validation site results. The instantaneous soil moisture and soil temperature analysis increments are within a reasonable range and result in spatially smooth soil moisture analyses. The O-F residuals exhibit only small biases on the order of 1-3 degrees Kelvin between the (re-scaled) SMAP brightness temperature observations and the L4_SM model forecast, which indicates that the assimilation system is largely unbiased. The spatially averaged time series standard deviation of the O-F residuals is 5.9 degrees Kelvin, which reduces to 4.0 degrees Kelvin for the observation-minus-analysis (O-A) residuals, reflecting the impact of the SMAP observations on the L4_SM system. Averaged globally, the time series standard deviation of the normalized O-F residuals is
Cheon, Shinhye; Kim, Mi-Ja; Yun, Seon-Jin; Moon, Jae Young; Kim, Yeon-Sook
2016-03-01
Nosocomial infections caused by multidrug-resistant (MDR) Acinetobacter baumannii have become public-health problem. However, few studies have evaluated the control of endemic MDR A. baumannii in Intensive Care Units (ICUs). Therefore, we investigated the effectiveness of antimicrobial stewardship and comprehensive intensified infection control measures for controlling endemic MDR A. baumannii in ICUs at a tertiary care center. Carbapenem use was strictly restricted through antimicrobial stewardship. Environmental cleaning and disinfection was performed at least 3 times per day in addition to basic infection control measures. Isolation using plastic curtains and contact precautions were applied to patients who were colonized or infected with MDR A. baumannii. The outcome was measured as the incidence density rate of hospital-onset MDR A. baumannii among patients in the ICUs. The incidence density rate of hospital-onset MDR A. baumannii decreased from 22.82 cases per 1,000 patient-days to 2.68 cases per 1,000 patient-days after the interventions were implemented (odds ratio, 0.12; 95% confidence interval, 0.03 to 0.4; p baumannii in our ICUs within 1 year.
Solid-solid synthesis and structural phase transition process of SmF3
Yan, Qi-Cao; Guo, Xing-Min
2018-04-01
Mazes of contradictory conclusions have been obtained by previous researches about structural phase transition process of SmF3. In this paper, the single crystals of SmF3 (hexagonal and orthorhombic) were prepared by solid-solid synthesis, which have shown gradual changes in crystal growth modes with the increase temperature and holding time. Furthermore, we propose the phase transition process of in SmF3. Hexagonal symmetry of SmF3 (space group Pnma) was prepared firstly by heating Sm2O3 and NH4HF2 over 40 min at 270 °C. And then orthorhombic symmetry of SmF3 (space group P63mc) was obtained by heating hexagonal symmetry over 10 h at 650 °C. The reaction of SmF3 (hexagonal) = SmF3 (orthorhombic) is extremely sluggish at a low temperature (less than 650 °C), which was seen as a Mixed Grown Region.
Synthesis and photoluminescence properties of Sm3+-doped CaWO4 nanoparticles
International Nuclear Information System (INIS)
Xiao Qi; Zhou Qitao; Li Ming
2010-01-01
The Sm 3+ -doped CaWO 4 nanoparticles were synthesized by hydrothermal method. The room temperature photoluminescence (PL) spectra of Sm 3+ -doped CaWO 4 nanoparticles doped with different Sm 3+ concentrations under 405 nm excitation have been investigated. The PL spectra showed four strong emission peaks at 460, 571, 609, and 653 nm. The first emission peak at 460 nm could be due to a structural defect of the lattice, an oxygen-deficient WO 3 complex. The other three emissions at 571, 609, and 653 nm were due to the f-f forbidden transitions of the 4f electrons of Sm 3+ , corresponding to 4 G 5/2 → 6 H 5/2 (571 nm), 6 H 7/2 (609 nm), and 6 H 9/2 (653 nm), respectively. In addition, the optimum Sm 3+ concentration in CaWO 4 nanoparticles for optical emission was determined to be 1.0%. The Sm 3+4 G 5/2 → 6 H 7/2 (609 nm) emission intensity of Sm 3+ -doped CaWO 4 nanoparticles significantly increased with the increase of Sm 3+ concentration, and showed a maximum when Sm 3+ doping content was 1.0%. If Sm 3+ concentration continued to increase, namely more than 1.0%, the Sm 3+4 G 5/2 → 6 H 7/2 emission intensity would decrease. The present materials might be a promising phosphor for white-light LED applications.
Derecho, I; McCoy, K B; Vaishampayan, P; Venkateswaran, K; Mogul, R
2014-10-01
The microbiological inventory of spacecraft and the associated assembly facility surfaces represent the primary pool of forward contaminants that may impact the integrity of life-detection missions. Herein, we report on the characterization of several strains of hydrogen peroxide-resistant Acinetobacter, which were isolated during the Mars Phoenix lander assembly. All Phoenix-associated Acinetobacter strains possessed very high catalase specific activities, and the specific strain, A. gyllenbergii 2P01AA, displayed a survival against hydrogen peroxide (no loss in 100 mM H2O2 for 1 h) that is perhaps the highest known among Gram-negative and non-spore-forming bacteria. Proteomic characterizations reveal a survival mechanism inclusive of proteins coupled to peroxide degradation (catalase and alkyl hydroperoxide reductase), energy/redox management (dihydrolipoamide dehydrogenase), protein synthesis/folding (EF-G, EF-Ts, peptidyl-tRNA hydrolase, DnaK), membrane functions (OmpA-like protein and ABC transporter-related protein), and nucleotide metabolism (HIT family hydrolase). Together, these survivability and biochemical parameters support the hypothesis that oxidative tolerance and the related biochemical features are the measurable phenotypes or outcomes for microbial survival in the spacecraft assembly facilities, where the low-humidity (desiccation) and clean (low-nutrient) conditions may serve as selective pressures. Hence, the spacecraft-associated Acinetobacter, due to the conferred oxidative tolerances, may ultimately hinder efforts to reduce spacecraft bioburden when using chemical sterilants, thus suggesting that non-spore-forming bacteria may need to be included in the bioburden accounting for future life-detection missions.
Sorption of samarium in soils: influence of soil properties and Sm concentration
Energy Technology Data Exchange (ETDEWEB)
Ramirez-Guinart, Oriol; Salaberria, Aitor; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)
2014-07-01
Due to the fact that barriers of Deep Geological Repositories (DGR) may lose efficiency before the radioisotopes present in the High Level Radioactive Waste (HLRW) completely decay, it is possible that, in the long-term, radioactive leachates may escape from the DGR and reach the soil and water compartments in the biosphere. Therefore, it is required to examine the interaction and mobility of radionuclides present in the HLRW, or their chemical analogues, to predict the impact of their eventual incorporation in the biosphere and to assess the derived risk. Although relevant data have been recently obtained for a few radionuclides in soils, there are still some important gaps for some radionuclides, such us for samarium (Sm). Sm is a lanthanide that, besides being considered as a natural analogue of actinides, may also be present in HLRW in the form of the radioactive isotope {sup 151}Sm. The main objective of this work was to obtain sorption data (K{sub d}) of {sup 151}Sm gathered from a set of soil samples physicochemical fully-characterized (pH, texture, cationic exchange capacity, soil solution cationic composition, organic matter, carbonate and metallic oxides content, etc.). Additionally, as an alternative for testing sorption capacity of radionuclides in soils is the use of the corresponding stable isotope or a chemical analogue, the influence of Sm concentration was also checked. To evaluate {sup 151}Sm sorption, batch assays were carried out for each soil sample, which consisted in a pre-equilibration step of 2 g of each soil with 50 ml of double deionised water, and a subsequent equilibration step with the same solution, but labelled with {sup 151}Sm. The activity of {sup 151}Sm in initial and final solutions was measured by liquid scintillation and K{sub d} ({sup 151}Sm) data were calculated. The reversibly sorbed fraction was estimated by the application of a single extraction test, with double deionised water, to soil residues coming from the previous
Determination of the {sup 151}Sm half-life
Energy Technology Data Exchange (ETDEWEB)
Be, Marie-Martine; Cassette, Philippe [CEA, LIST, Gif sur Yvette (France). LNE-Laboratoire National Henri Becquerel; Isnard, Helene [CEA-LANIE, Gif sur Yvette (France); and others
2015-07-01
New measurements have been undertaken to determine the half-life of {sup 151}Sm. A pure {sup 151}Sm solution was obtained after chemical separation from a samarium solution resulting from the dissolution of an irradiated samarium sample. The concentration of {sup 151}Sm in the solution was measured by mass spectrometry, combined with the isotope dilution technique. The activity of the solution was measured by liquid scintillation counting by six European laboratories as part of an international comparison. These combined results lead to a half-life of T{sub 1/2} = 94.6(6)a.
Anti-skin-aging benefits of exopolymers from Aureobasidium pullulans SM2001.
Kim, Kyung Hu; Park, Soo Jin; Lee, Ji Eun; Lee, Young Joon; Song, Chang Hyun; Choi, Seong Hun; Ku, Sae Kwang; Kang, Su Jin
2014-01-01
There have been many attempts to search for affordable and effective functional cosmetic ingredients, especially from natural sources. As research into developing a functional cosmetic ingredient, we investigated whether exopolymers from Aureobasidium pullulans SM2001 (E-AP-SM2001) exert antioxidant, antiwrinkle, whitening, and skin moisturizing effects. Antioxidant effects of E-AP-SM2001 were determined by measuring free radical scavenging capacity and superoxide dismutase (SOD)-like activity. Antiwrinkle effects were assessed through the inhibition of hyaluronidase, elastase, collagenase, and matrix metalloproteinase (MMP)-1. Whitening effects were measured by tyrosinase inhibition assay, and by melanin formation test in B16/F10 melanoma cells. Skin moisturizing effects were detected by mouse skin water content test. E-AP-SM2001 showed potent DPPH radical scavenging activity and SOD-like effects. Additionally, hyaluronidase, elastase, collagenase, and MMP-1 activities were significantly inhibited by E-AP-SM2001. We also observed that E-AP-SM2001 effectively reduced melanin production by B16/F10 melanoma cells and mushroom tyrosinase activities. Furthermore, significant increases in skin water content were detected in E-AP-SM2001- treated mouse skin, as compared with vehicle-treated control skin. Notably, a mask pack containing E-AP-SM2001 showed a >twofold more extensive moisturizing effect compared with one containing Saccharomycopsis ferment filtrate. Our results suggest that E-AP-SM2001 has adequate antiaging, antiwrinkle, and whitening benefits and skin moisturizing effect. These effects involve reducing hyaluronidase, elastase, collagenase, and MMP-1 activities, as well as inhibition of melanin production and tyrosinase activities. Therefore, the antioxidant E-AP-SM2001 may serve as a predictable functional ingredient.
Electrochemical preparation of Al–Sm intermetallic compound whisker in LiCl–KCl Eutectic Melts
International Nuclear Information System (INIS)
Ji, De−Bin; Yan, Yong−De; Zhang, Mi−Lin; Li, Xing; Jing, Xiao−Yan; Han, Wei; Xue, Yun; Zhang, Zhi−Jian; Hartmann, Thomas
2015-01-01
Highlights: • The reduction process of Sm(III) was investigated in LiCl–KCl melt on an aluminum electrode at 773 K. • Al–Sm alloy with different phase structure (Al 2 Sm and Al 3 Sm) was prepared by potentiostatic electrolysis on an aluminum electrode with the change of electrolytic potentials and time in LiCl–KCl–SmCl 3 melts. • Al − Sm alloy containing whiskers (Al 4 Sm) was obtained by potentiostatic electrolysis (−2.10 V) on an aluminum electrode for 7 hours with the change of electrolytic temperature and cooling rate in LiCl–KCl–SmCl 3 (16.5 wt. %) melts. The results from micro–hardness test and potentiodynamic polarization test show the micro hardness and corrosion property are remarkably improved with the help of Al–Sm intermetallic compound whiskers. - Abstract: This work presents the electrochemical study of Sm(III) on an aluminum electrode in LiCl–KCl melts at 773 K by different electrochemical methods. Three electrochemical signals in cyclic voltammetry, square wave voltammetry, open circuit chronopotentiometry, and cathode polarization curve are attributed to different kinds of Al–Sm intermetallic compounds, Al 2 Sm, Al 3 Sm, and Al 4 Sm, respectively. Al–Sm alloy with different phase structure (Al 2 Sm and Al 3 Sm) could be obtained by the potentiostatic electrolysis with the change of electrolytic potentials and time. Al–Sm alloy containing whiskers (Al 4 Sm) was obtained by potentiostatic electrolysis (−2.10 V) on an aluminum electrode for 7 hours with the change of electrolytic temperature and cooling rate in LiCl–KCl–SmCl 3 (16.5 wt. %) melts. The XRD and SEM&EDS were employed to investigate the phase composition and microstructure of Al–Sm alloy. SEM analysis shows that lots of needle−like precipitates formed in Al–Sm alloy, and their ratios of length to diameter are found to be greater than 10 to 1. The TEM and electron diffraction pattern were performed to investigate the crystal structure of the
Prophage induction by ultraviolet light in Acinetobacter calcoaceticus
Energy Technology Data Exchange (ETDEWEB)
Berenstein, D.
1986-09-01
UV-induction of prophage P78 of Acinetobacter calcoaceticus increased with the UV-dose given to the lysogenic strain from the spontaneous induction frequency of about 0.8% to a maximal frequency of 10%. This 10- to 20-fold increase of induction frequency, as measured by the number of infective centres, was accompanied by a 1000-fold increase in the yield of free phage. This effect was probably due to an increase in burst size under the conditions of lysogenic induction. Unusually, the lysogen was more resistant to UV-irradiation than the corresponding non-lysogenic strain.
Prophage Induction by Ultraviolet Light in Acinetobacter calcoaceticus
DEFF Research Database (Denmark)
Berenstein, D.
1986-01-01
UV-induction of prophage P78 of Acinetobacter calcoaceticus increased with the UV-dose given to the lysogenic strain from the spontaneous induction frequency of about 0.8% to a maximal frequency of 10%. This 10- to 20-fold increase of induction frequency, as measured by the number of infective...... centres, was accompanied by a 1000-fold increase in the yield of free phage. This effect was probably due to an increase in burst size under the conditions of lysogenic induction. Unusually, the lysogen was more resistant to UV-irradiation than the corresponding non-lysogenic strain....
Isotope shifts and hyperfine splittings in 144-154Sm I
International Nuclear Information System (INIS)
England, J.G.; Grant, I.S.; Newton, G.W.A.; Walker, P.M.
1990-01-01
The isotope shifts and hyperfine splittings have been measured in 144-154 Sm I using the crossed-beam laser fluorescence method. Transitions at 598.98 nm and 570.68 nm were investigated for all isotopes except 146 Sm and 153 Sm, in which measurements were only obtained at 570.68 nm. Laser-induced fluorescence has not previously been reported for 145 Sm. The magnetic dipole and electric quadrupole moments of the odd isotopes and the changes in mean square radii of the even ones are shown to be consistent with the information obtained from nuclear spectroscopy. (author)
Directory of Open Access Journals (Sweden)
Chin-Soon Chee
2014-01-01
Full Text Available Glutathione transferases (GST were purified from locally isolated bacteria, Acinetobacter calcoaceticus Y1, by glutathione-affinity chromatography and anion exchange, and their substrate specificities were investigated. SDS-polyacrylamide gel electrophoresis revealed that the purified GST resolved into a single band with a molecular weight (MW of 23 kDa. 2-dimensional (2-D gel electrophoresis showed the presence of two isoforms, GST1 (pI 4.5 and GST2 (pI 6.2 with identical MW. GST1 was reactive towards ethacrynic acid, hydrogen peroxide, 1-chloro-2,4-dinitrobenzene, and trans,trans-hepta-2,4-dienal while GST2 was active towards all substrates except hydrogen peroxide. This demonstrated that GST1 possessed peroxidase activity which was absent in GST2. This study also showed that only GST2 was able to conjugate GSH to isoproturon, a herbicide. GST1 and GST2 were suggested to be similar to F0KLY9 (putative glutathione S-transferase and F0KKB0 (glutathione S-transferase III of Acinetobacter calcoaceticus strain PHEA-2, respectively.
Chee, Chin-Soon; Tan, Irene Kit-Ping; Alias, Zazali
2014-01-01
Glutathione transferases (GST) were purified from locally isolated bacteria, Acinetobacter calcoaceticus Y1, by glutathione-affinity chromatography and anion exchange, and their substrate specificities were investigated. SDS-polyacrylamide gel electrophoresis revealed that the purified GST resolved into a single band with a molecular weight (MW) of 23 kDa. 2-dimensional (2-D) gel electrophoresis showed the presence of two isoforms, GST1 (pI 4.5) and GST2 (pI 6.2) with identical MW. GST1 was reactive towards ethacrynic acid, hydrogen peroxide, 1-chloro-2,4-dinitrobenzene, and trans,trans-hepta-2,4-dienal while GST2 was active towards all substrates except hydrogen peroxide. This demonstrated that GST1 possessed peroxidase activity which was absent in GST2. This study also showed that only GST2 was able to conjugate GSH to isoproturon, a herbicide. GST1 and GST2 were suggested to be similar to F0KLY9 (putative glutathione S-transferase) and F0KKB0 (glutathione S-transferase III) of Acinetobacter calcoaceticus strain PHEA-2, respectively. PMID:24892084
Directory of Open Access Journals (Sweden)
Faegheh Teymori
2017-07-01
Full Text Available Abstract Background: Acinetobacters are aerobic gram-negative bacteria which are distributed widespread in soil and water. The bacteria are isolated from cultured skin, mucous membranes, secretions and hospital environment. Acinetobacter baumannii, is a strain that more frequently isolated. Acinetobacter strains are often resistant against antimicrobial agents. Materials and Methods: The method of this study was based on field, observation and test. On August and October 2015, samples were isolated from the soil and water of the Sadeghieh Square river in Tehran, respectively, and were transferred to the laboratory in the ice pack. 50 baumannii samples were isolated by biochemical methods (TSI, SIM, OF and gram test. November 1394, 100 clinical samples were isolated from Imam Khomeini hospital by biochemical method, and in the culture media Mueller Hinton agar plates were transferred to the laboratory. Antibiogram test for 150 baumannii samples was performed. Biofilms formation of Acinetobacter baumannii environmental and clinical samples was investigated by Congo red agar and culture plate methods. Results: In all samples (clinical and soil, most of antibiotic resistance was 92% for imipenem and the resistance of water samples to imipenem was 99.9%. Biofilm formation by Congo red agar in water, soil, and clinical samles was resprctively 44%, 40% and 1%. All isolates were negative biofilm culture plate. Conclusion: Considering Acinetobacter baumannii resistance to antibiotics and the lack of biofilm formation of in clinical and environmental isolates, it was concluded that there wasn’t any relationship between antibiotic resistance and biofilm formation.
Neurokinin-1 receptor activation in globus pallidus
Directory of Open Access Journals (Sweden)
Lei Chen
2009-10-01
Full Text Available The undecapeptide substance P has been demonstrated to modulate neuronal activity in a number of brain regions by acting on neurokinin-1 receptors. Anatomical studies revealed a moderate level of neurokinin-1 receptor in rat globus pallidus. To determine the electrophysiological effects of neurokinin-1 receptor activation in globus pallidus, whole-cell patch-clamp recordings were performed in the present study. Under current-clamp recordings, neurokinin-1 receptor agonist, [Sar9, Met(O211] substance P (SM-SP at 1 μM, depolarized globus pallidus neurons and increased their firing rate. Consistently, SM-SP induced an inward current under voltage-clamp recording. The depolarization evoked by SM-SP persisted in the presence of tetrodotoxin, glutamate and GABA receptor antagonists, indicating its direct postsynaptic effects. The neurokinin-1 receptor antagonist, SR140333B, could block SM-SP-induced depolarization. Further experiments showed that suppression of potassium conductance was the predominant ionic mechanism of SM-SP-induced depolarization. To determine if neurokinin-1 receptor activation exerts any effects on GABAergic and glutamatergic neurotransmission, the action of SM-SP on synaptic currents was studied. SM-SP significantly increased the frequency of spontaneous inhibitory postsynaptic currents, but only induced a transient increase in the frequency of miniature inhibitory postsynaptic currents. No change was observed in both spontaneous and miniature excitatory postsynaptic currents. Based on the direct excitatory effects of SM-SP on pallidal neurons, we hypothesize that neurokinin-1 receptor activation in globus pallidus may be involved in the beneficial effect of substance P in Parkinson’s disease.
Guided ion beam and theoretical studies of the bond energy of SmS+
Armentrout, P. B.; Demireva, Maria; Peterson, Kirk A.
2017-12-01
Previous work has shown that atomic samarium cations react with carbonyl sulfide to form SmS+ + CO in an exothermic and barrierless process. To characterize this reaction further, the bond energy of SmS+ is determined in the present study using guided ion beam tandem mass spectrometry. Reactions of SmS+ with Xe, CO, and O2 are examined. Results for collision-induced dissociation processes with all three molecules along with the endothermicity of the SmS+ + CO → Sm+ + COS exchange reaction are combined to yield D0(Sm+-S) = 3.37 ± 0.20 eV. The CO and O2 reactions also yield a SmSO+ product, with measured endothermicities that indicate D0(SSm+-O) = 3.73 ± 0.16 eV and D0(OSm+-S) = 1.38 ± 0.27 eV. The SmS+ bond energy is compared with theoretical values characterized at several levels of theory, including CCSD(T) complete basis set extrapolations using all-electron basis sets. Multireference configuration interaction calculations with explicit spin-orbit calculations along with composite thermochemistry using the Feller-Peterson-Dixon method and all-electron basis sets were also explored for SmS+, and for comparison, SmO, SmO+, and EuO.
Prediction of the new efficient permanent magnet SmCoNiFe3
Söderlind, P.; Landa, A.; Locht, I. L. M.; Åberg, D.; Kvashnin, Y.; Pereiro, M.; Däne, M.; Turchi, P. E. A.; Antropov, V. P.; Eriksson, O.
2017-09-01
We propose a new efficient permanent magnet, SmCoNiFe3, which is a development of the well-known SmCo5 prototype. More modern neodymium magnets of the Nd-Fe-B type have an advantage over SmCo5 because of their greater maximum energy products due to their iron-rich stoichiometry. Our new magnet, however, removes most of this disadvantage of SmCo5 while preserving its superior high-temperature efficiency over the neodymium magnets. We show by means of first-principles electronic-structure calculations that SmCoNiFe3 has very favorable magnetic properties and could therefore potentially replace SmCo5 or Nd-Fe-B types in various applications.
NCBI nr-aa BLAST: CBRC-RMAC-04-0050 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RMAC-04-0050 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-MMUS-04-0013 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-04-0013 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 99% ...
Acinetobacter Species Infections among Navy and Marine Corps Beneficiaries: 2014 Annual Report
2015-07-20
microbiology data were used to identify Acinetobacter cases. These isolates were matched to three databases. Microbiology records were matched to...Data Record (SIDR) database to determine exposure associations within the healthcare system. Microbiology records were matched to the Defense...that they could establish a community reservoir. Veterinary nosocomial spread has been described among animals, mainly in veterinary hospital intensive
Superconductivity in Sm-doped CaFe2As2 single crystals
Dong-Yun, Chen; Bin-Bin, Ruan; Jia, Yu; Qi, Guo; Xiao-Chuan, Wang; Qing-Ge, Mu; Bo-Jin, Pan; Tong, Liu; Gen-Fu, Chen; Zhi-An, Ren
2016-06-01
In this article, the Sm-doping single crystals Ca1 - x Sm x Fe2As2 (x = 0 ˜ 0.2) were prepared by the CaAs flux method, and followed by a rapid quenching treatment after the high temperature growth. The samples were characterized by structural, resistive, and magnetic measurements. The successful Sm-substitution was revealed by the reduction of the lattice parameter c, due to the smaller ionic radius of Sm3+ than Ca2+. Superconductivity was observed in all samples with onset T c varying from 27 K to 44 K upon Sm-doping. The coexistence of a collapsed phase transition and the superconducting transition was found for the lower Sm-doping samples. Zero resistivity and substantial superconducting volume fraction only happen in higher Sm-doping crystals with the nominal x > 0.10. The doping dependences of the c-axis length and onset T c were summarized. The high-T c observed in these quenched crystals may be attributed to simultaneous tuning of electron carriers doping and strain effect caused by lattice reduction of Sm-substitution. Project supported by the National Natural Science Foundation of China (Grant No. 11474339), the National Basic Research Program of China (Grant Nos. 2010CB923000 and 2011CBA00100), and the Strategic Priority Research Program of the Chinese Academy of Sciences (Grant No. XDB07020100).
Evaluation the homogenisation behaviour of Sm-Fe-Nb materials by Moessbauer spectroscopy
International Nuclear Information System (INIS)
Sinan, S. A.; Muryaed, Y.; Alhweg, F. A.
2004-01-01
The microstructure of cast and annealed Sm-Fe-Nb materials were investigated by Moessbauer spectroscopy. The aim of the present work is to study the effect of Nb additions upon the microstructure of Sm 2 Fe 17 material and evaluation the homogenisation behaviour of different Sm-Fe-Nb materials. The niobium free cast material consisting of the Sm 2 Fe 17 phase and significant amounts of the free iron (α -Fe). Therefore, the homogenisation process is necessary to eliminate the free iron and produce a single Sm 2 Fe 17 phase material. This process takes long annealing time, up to seven days. The Sm 9 .5 Fe 8 7.5 Nb 3 alloy contains the lowest amount of α-Fe among, the Sm-Fe-Nb materials. Thus the homogenisation step was carried out with treatment time (12 hours) smaller than the reported annealing time of Nb-free material (Sm 2 Fe 17 ). Therefore, the addition of at 3% Nb reduces the manufacturing cost of the Sm 2 Fe 17 and makes this based material for permanent magnets, more industrially desirable, due to elimination the free iron with lowest treatment time. Also it was found that the existence of the paramagnetic NbFe 2 phase becomes higher after the homogenisation process, which can be explained due to the diffusion of Nb from Sm 2 Fe 17 phase to paramagnetic NbFe 2 phase, during the annealing process. (authors)
The SM and MIR reactors operation experience
International Nuclear Information System (INIS)
Kuprienko, V.A.; Klinov, A.V.; Svyatkin, M.N.; Shamardin, V.K.
1995-01-01
The SM and MIR operation experience show that continuous work on the problem of ageing, in all its aspects, allows for prolongation of the research plant life cycle by several folds as compared to the initial project. The redesigned SM-3 reactor will operate for another 20 years. The similar result is expected from the MIR planned reconstruction which scope will be the topic of future presentations. (orig.)
Aligned, plasma sprayed SmCo5 deposits
International Nuclear Information System (INIS)
Kumar, K.; Das, D.
1986-01-01
Highly aligned SmCo 5 deposits were produced using plasma spraying. c-axis alignment, normal to the plane of the deposit, was achieved by depositing the Sm-Co alloys on steel substrates maintained at high temperatures. The substrates were heated by the plasma flame to obtain the high temperatures. The attainment of a range of substrate temperatures was made possible through control over the geometry of the substrate
Greene, C; Wu, J; Rickard, A H; Xi, C
2016-10-01
The human opportunistic pathogen, Acinetobacter baumannii, has the propensity to form biofilms and frequently cause medical device-related infections in hospitals. However, the physio-chemical properties of medical surfaces, in addition to bacterial surface properties, will affect colonization and biofilm development. The objective of this study was to compare the ability of A. baumannii to form biofilms on six different materials common to the hospital environment: glass, porcelain, stainless steel, rubber, polycarbonate plastic and polypropylene plastic. Biofilms were developed on material coupons in a CDC biofilm reactor. Biofilms were visualized and quantified using fluorescent staining and imaged using confocal laser scanning microscopy (CLSM) and by direct viable cell counts. Image analysis of CLSM stacks indicated that the mean biomass values for biofilms grown on glass, rubber, porcelain, polypropylene, stainless steel and polycarbonate were 0·04, 0·26, 0·62, 1·00, 2·08 and 2·70 μm(3) /μm(2) respectively. Polycarbonate developed statistically more biofilm mass than glass, rubber, porcelain and polypropylene. Viable cell counts data were in agreement with the CLSM-derived data. In conclusion, polycarbonate was the most accommodating surface for A. baumannii ATCC 17978 to form biofilms while glass was least favourable. Alternatives to polycarbonate for use in medical and dental devices may need to be considered. In the hospital environment, Acinetobacter baumannii is one of the most persistent and difficult to control opportunistic pathogens. The persistence of A. baumannii is due, in part, to its ability to colonize surfaces and form biofilms. This study demonstrates that A. baumannii can form biofilms on a variety of different surfaces and develops substantial biofilms on polycarbonate - a thermoplastic material that is often used in the construction of medical devices. The findings highlight the need to further study the in
The electrodeposition of 149Sm targets for (n,α) studies
International Nuclear Information System (INIS)
Ingelbrecht, C.; Ambeck-Madsen, J.; Teipel, K.; Robouch, P.; Arana, G.; Pomme, S.
1999-01-01
A method of electrodeposition from ethanol was developed for the production of 149 Sm targets of area 50x60 mm 2 to be used for (n,α) experiments. Targets of 60 μg cm -2 Sm were obtained with a Sm yield of 50% and a Sm mass fraction of 35% after calcination of the layers at 450 deg. C. Target substrates were 20 μm aluminium foils mounted on brass frames. A water cooling jig was constructed to protect the glue used for mounting during the calcination process. The layers were characterized by inductively coupled plasma source mass spectrometry (ICP-MS) and by neutron activation analysis (NAA)
Role of SM22 in the differential regulation of phasic vs. tonic smooth muscle
Ali, Mehboob
2015-01-01
Preliminary proteomics studies between tonic vs. phasic smooth muscles identified three distinct protein spots identified to be those of transgelin (SM22). The latter was found to be distinctly downregulated in the internal anal sphincter (IAS) vs. rectal smooth muscle (RSM) SMC. The major focus of the present studies was to examine the differential molecular control mechanisms by SM22 in the functionality of truly tonic smooth muscle of the IAS vs. the adjoining phasic smooth muscle of the RSM. We monitored SMC lengths before and after incubation with pFLAG-SM22 (for SM22 overexpression), and SM22 small-interfering RNA. pFLAG-SM22 caused concentration-dependent and significantly greater relaxation in the IAS vs. the RSM SMCs. Conversely, temporary silencing of SM22 caused contraction in both types of the SMCs. Further studies revealed a significant reverse relationship between the levels of SM22 phosphorylation and the amount of SM22-actin binding in the IAS and RSM SMC. Data showed higher phospho-SM22 levels and decreased SM22-actin binding in the IAS, and reverse to be the case in the RSM SMCs. Experiments determining the mechanism for SM22 phosphorylation in these smooth muscles revealed that Y-27632 (Rho kinase inhibitor) but not Gö-6850 (protein kinase C inhibitor) caused concentration-dependent decreased phosphorylation of SM22. We speculate that SM22 plays an important role in the regulation of basal tone via Rho kinase-induced phosphorylation of SM22. PMID:25617350
A metastable Mg11Sm phase obtained by rapid solidification
International Nuclear Information System (INIS)
Budurov, S.
1993-01-01
Molten Mg-Sm alloys with a Sm concentration of 4.93, 6.86, and 8.35 at.% were rapidly soldified with the aid of a shock wave gun device. Investigations of the obtained splats were performed with the aid of DSC, X-ray analysis, and metallography. Rapid soldification of the eutectic MgSm 8.35 alloy forms a new Im3m-type phase. (orig.)
Cholemkery, Hannah; Mojica, Laura; Rohrmann, Sonja; Gensthaler, Angelika; Freitag, Christine M.
2014-01-01
Autism spectrum disorder (ASD) as well as social phobia (SP), and selective mutism (SM) are characterised by impaired social interaction. We assessed the validity of the Social Responsiveness Scale (SRS) to differentiate between ASD, and SP/SM. Raw scores were compared in 6-18 year old individuals with ASD (N = 60), SP (N = 38), SM (N = 43), and…
Low temperature preparation and superconductivity of F-doped SmFeAsO
Energy Technology Data Exchange (ETDEWEB)
Chen, Y.L.; Cui, Y.J. [Key Laboratory of Magnetic Levitation Technologies and Maglev Trains (Ministry of Education of China), Superconductivity R and D Center (SRDC), Mail Stop 165, Southwest Jiaotong University, Chengdu, Sichuan 610031 (China); Cheng, C.H. [School of Materials Science and Engineering, University of New South Wales, Sydney, 2052 NSW (Australia); Yang, Y.; Wang, L.; Li, Y.C.; Zhang, Y. [Key Laboratory of Magnetic Levitation Technologies and Maglev Trains (Ministry of Education of China), Superconductivity R and D Center (SRDC), Mail Stop 165, Southwest Jiaotong University, Chengdu, Sichuan 610031 (China); Zhao, Y., E-mail: yzhao@swjtu.edu.c [Key Laboratory of Magnetic Levitation Technologies and Maglev Trains (Ministry of Education of China), Superconductivity R and D Center (SRDC), Mail Stop 165, Southwest Jiaotong University, Chengdu, Sichuan 610031 (China); School of Materials Science and Engineering, University of New South Wales, Sydney, 2052 NSW (Australia)
2010-11-01
A low temperature (1100 deg. C) process of preparing F-doped SmFeAsO samples has been developed using SmF{sub 3} with nanometer scale as the source of fluorine. A series of the SmFeAsO{sub 1-x}F{sub x} (x = 0, 0.05, 0.1, 0.15, 0.2, 0.25, 0.3) samples have been prepared using the present method. Compared with previous reports, the present SmF{sub 3} is more effective to introduce F into SmFeAsO system in which a transition temperature of 39 K can be observed when x = 0.05. The superconductivity is definitely enhanced with the increasing F-doping level. All the samples presented to be layered structure and the crystal particle size is about three times larger with sintering time increasing from 36 h to 48 h. Except for the nanometer scale of SmF{sub 3}, the flux effect of SmF{sub 3} is recognized to be another reason for the decrease of the sintering temperature. Further more, a relatively large amount of SmF{sub 3} was also employed in the raw materials to introduce excessive F and this has induced higher T{sub c} (55 K) in SmFeAsO{sub 0.8}F{sub 0.2+{delta}}system.
The glomerular parietal epithelial cell's responses are influenced by SM22 alpha levels.
Naito, Shokichi; Pippin, Jeffrey W; Shankland, Stuart J
2014-11-06
Studies have shown in several diseases initially affecting podocytes, that the neighboring glomerular parietal epithelial cells (PECs) are secondarily involved. The PEC response might be reparative under certain circumstances, yet injurious under others. The factors governing these are not well understood. We have shown that SM22α, an actin-binding protein considered a marker of smooth muscle differentiation, is upregulated in podocytes and PECs in several models of podocyte disease. However, the impact of SM22α levels on PECs is not known. Experimental glomerular disease, characterized by primary podocyte injury, was induced in aged-matched SM22α+/+ and SM22α-/-mice by intraperitoneal injection of sheep anti-rabbit glomeruli antibody. Immunostaining methods were employed on days 7 and 14 of disease. The number of PEC transition cells, defined as cells co-expressing a PEC protein (PAX2) and podocyte protein (Synaptopodin) was higher in diseased SM22α-/-mice compared with SM22α+/+mice. WT1 staining along Bowman's capsule is higher in diseased SM22α-/-mice. This was accompanied by increased PEC proliferation (measured by ki-67 staining), and an increase in immunostaining for the progenitor marker NCAM, in a subpopulation of PECs in diseased SM22α-/-mice. In addition, immunostaining for vimentin and alpha smooth muscle actin, markers of epithelial-to-mesenchymal transition (EMT), was lower in diseased SM22α-/-mice compared to diseased SM22α+/+mice. SM22α levels may impact how PECs respond following a primary podocyte injury in experimental glomerular disease. Absent/lower levels favor an increase in PEC transition cells and PECs expressing a progenitor marker, and a lower EMT rate compared to SM22α+/+mice, where SM22 levels are markedly increased in PECs.
Kelly, Brian; Cichocki, Ronald; Poirier, Gerald; Unruh, Karl
The SmCoO3 to nanostructured Sm2O3 and Co oxidation and reduction reaction has been studied by thermogravimetric analysis (TGA) measurements in forming gas (FG) and inert N2 atmospheres, x-ray diffraction (XRD) and vibrating sample magnetometry (VSM). The TGA measurements showed two clearly resolvable reduction processes when heating in FG, from the initial SmCoO3 phase through an intermediate nanostructured mixture of Sm2O3 and CoO when heated to 330°C for several minutes, and then the conversion of CoO to metallic Co when heated above 500°C. These phases were confirmed by XRD and VSM. Similar measurements in N2 yielded little mass change below 900°C and coupled reduction processes at higher temperatures. Isoconversional measurements of the CoO to Co reduction reaction in FG yielded activation energies above 2eV/atom in the nanostructured system. This value is several times larger than those reported in the literature or obtained by similar measurements of bulk mixtures of Sm2O3 and CoO, suggesting the nanostructuring was the source of the large increase in activation energy.
Chen, Yu; Li, Chen; Zhou, Zhengxi; Wen, Jianping; You, Xueyi; Mao, Youzhi; Lu, Chunzhe; Huo, Guangxin; Jia, Xiaoqiang
2014-04-01
In this study, two strains, Acinetobacter sp. XM-02 and Pseudomonas sp. XM-01, were isolated from soil samples polluted by crude oil at Bohai offshore. The former one could degrade alkane hydrocarbons (crude oil and diesel, 1:4 (v/v)) and crude oil efficiently; the latter one failed to grow on alkane hydrocarbons but could produce rhamnolipid (a biosurfactant) with glycerol as sole carbon source. Compared with pure culture, mixed culture of the two strains showed higher capability in degrading alkane hydrocarbons and crude oil of which degradation rate were increased from 89.35 and 74.32 ± 4.09 to 97.41 and 87.29 ± 2.41 %, respectively. In the mixed culture, Acinetobacter sp. XM-02 grew fast with sufficient carbon source and produced intermediates which were subsequently utilized for the growth of Pseudomonas sp. XM-01 and then, rhamnolipid was produced by Pseudomonas sp. XM-01. Till the end of the process, Acinetobacter sp. XM-02 was inhibited by the rapid growth of Pseudomonas sp. XM-01. In addition, alkane hydrocarbon degradation rate of the mixed culture increased by 8.06 to 97.41 % compared with 87.29 % of the pure culture. The surface tension of medium dropping from 73.2 × 10(-3) to 28.6 × 10(-3) N/m. Based on newly found cooperation between the degrader and the coworking strain, rational investigations and optimal strategies to alkane hydrocarbons biodegradation were utilized for enhancing crude oil biodegradation.
Synthesis and physicochemical analysis of Sm (II, III) acetylacetone chelate complexes
International Nuclear Information System (INIS)
Kostyuk, N.N.; Dik, T.A.; Trebnikov, A.G.
2004-01-01
Sm (II, III) acetylacetone chelate complexes were synthesized by electrochemical method. It was shown that anode dissolution of the metal samarium over acetylacetone leads to formation of the Sm (II, III) chelate complexes: xSm(acac)2 · ySm(acac)3 · zH(acac). Factors x, y and z depend on quantity of the electricity, which flew through the electrolysis cell. The compositions of the obtained substances were confirmed by the physicochemical analysis (ultimate analysis, IR-, mass spectroscopy and thermal analysis (thermogravimetric, isothermal warming-up and differential scanning colorimetry). (Authors)
Directory of Open Access Journals (Sweden)
Carlos Méndez
2012-09-01
Full Text Available Cultivation of cyanobacterium Arthrospira sp. has been developed in many countries for the production of proteins, pigments and other compounds. Outdoor mass cultures are often affected by biological contamination, drastically reducing productivity as far as bringing death. This study evaluates the control of Branchionus sp. and Amoeba sp. with two chemical compounds: urea (U and ammonium bicarbonate (AB, in laboratory conditions and outdoor mass culture of Arthrospira sp. The lethal concentration 100 (LC100 at 24 h for Branchionus sp. and Amoeba sp. determined was of 60-80 mg L-1 (U and 100-150 mg L-1 (AB. The average effective inhibition concentration for 50% of the population (IC50 in Arthrospira sp., after 72 h, was 80 mg L-1 (U and 150 mg L-1 (AB. The application of doses of 60 mg L-1 (U or 100 mg L-1 (AB in the outdoor mass culture of this contaminated microalga, completely inhibited grazing and did not affect the growth of Arthrospira sp. but rather promoted rapid recovery of algal density at levels prior to infestation. These compounds provided an economical and effective control of predators in cultures of Arthrospira sp.El cultivo de la cianobacteria Arthrospira sp. ha sido desarrollado en muchos países para la obtención de proteínas, pigmentos y otros compuestos. Cultivo que a nivel industrial se ve afectado frecuentemente por contaminación biológica, reduciendo drásticamente la productividad hasta causar la muerte. Este estudio evalúa el control de Branchionus sp. y de Amoeba sp. con dos compuestos químicos, la urea (U y bicarbonato de amonio (AB en cultivos de Arthrospira sp. La concentración letal 100 (LC100 determinada a las 24 h para Branchionus sp. y Amoeba sp. fue de 60-80 mg L-1 (U y 100-150 mg L-1 (AB. La concentración media de inhibición efectiva, después de 72 h, para el 50% de la población (IC50 en Arthrospira fue de 80 mg L-1 (U y 150 mg L-1 (AB. La aplicación de dosis de 60 mg L-1 (U ó 100 mg L-1 (AB en
2017-06-01
Infection Classifications .................................................................. 7 Section B – Antimicrobial Resistance and Use... Antimicrobial Resistance and Use Regional Multidrug Resistance In 2016, the IR of Acinetobacter species infection was 5.34 infections per 100,000 persons...et al. Antimicrobial - resistant pathogens associated with health-associated infections: annual summary of data reported to the National Healthcare
Subramaniyan, Jayanthi Siva; Sundaram, Jeya Meenakshi
2018-01-01
ICU shows increasing incidence of infection associated with the use of invasive procedures for the diagnostic purpose as well as the indiscriminate use of antibiotics. Pseudomonas aeruginosa and Acinetobacter species are "very successful" pathogen and the emergence of the Metallo-β-Lactamases (MBL) is becoming a therapeutic challenge. To isolate the Nonfermenting Gram negative bacilli from the ICU samples. To identify the metallo betalactamase producers and to detect the bla gene presence among the Pseudomonas aeruginosa and Acinetobacter baumannii . The Nonfermenting Gram negative bacilli isolates from the ICU samples were taken over for 5 years (2009-2014) in a tertiary care hospital. The isolates of Pseudomonas species and Acinetobacter species were confirmed by API analyser and processed according to standard procedures. Detection of the MBL producers were done by E strip method and subjected for bla gene detection by PCR method. In our study a total of 195 isolates of NFGNB were obtained from various ICU. Of these MBL producers, 26 % were Pseudomonas aeruginosa and 25 % were Acinetobacter baumannii . The subtypes of bla VIM MBL producing P.aeruginosa were 26%. The predominant gene coding for MBL activity in A.baumannii were found to be bla OXA gene 11.9%. The gene accession numbers were KF975367, KF975372. We have to control the development and dissemination of these superbugs among the ICU's.
Biosorption of 241Am by Candida sp
International Nuclear Information System (INIS)
Luo Shunzhong; Zhang Taiming; Liu Ning; Yang Yuanyou; Jin Jiannan; Hua Xinfeng
2003-01-01
The biosorption of radionuclide 241 Am from solutions by Candida sp., and the influences of experimental conditions on the adsorption were studied. The results showed that the adsorption equilibrium was achieved within 4h and the optimum pH=2. No significant differences on 241 Am biosorption were observed at 10-45 degree C, or challenged with Au 3+ or Ag + , even 1500 times or 4500 times over 241 Am, respectively. The adsorption rate could reach 97.8% by dry Candida sp. of 0.82 g/L in 241 Am solutions (pH=2) of 5.6-111 MBq/L (44.04-873.0 μg/L) (C 0 ), with maximum adsorption capacity (W) of 63.5 MBq/g (501.8 μg/g), implying that the removal of 241 Am by Candida sp. from solutions was feasible. The relationship between activities (C 0 ) and adsorption capacities (W) of 241 Am indicated that the biosorption process could be described by Langmuir adsorption isotherm
Su, Jun Feng; Liang, Dong Hui; Fu, Le; Wei, Li; Ma, Min
2018-06-13
The aim of this study was to identify algicidal bacteria J25 against the Microcystis aeruginosa (90.14%), Chlorella (78.75%), Scenedesmus (not inhibited), and Oscillatoria (90.12%). Meanwhile, we evaluate the SOD activity and efficiency of denitrification characteristics with Acinetobacter sp. J25. A novel hybrid bioreactor combined biological floating bed with bio-contact oxidation (BFBO) was designed for treating the landscape water, and the average removal efficiencies of nitrate-N, ammonia-N, nitrite-N, TN, TP, TOC, and algal cells were 91.14, 50, 87.86, 88.83, 33.07, 53.95, and 53.43%, respectively. A 454-pyrosequencing technology was employed to investigate the microbial communities of the BFBO reactor samples. The results showed that Acinetobacter sp. J25 was the dominant contributor for effective removal of N, algal cells, and TOC in the BFBO reactor. And the relative abundance of Acinetobacter showed increase trend with the delay of reaction time. Graphical abstract Biological floating bed and bio-contact oxidation (BFBO) as a novel hybrid bioreactor designed for simultaneous removal Microcystis aeruginosa, TOC, nitrogen, and phosphorus. And high-throughput sequencing data demonstrated that Acinetobacter sp. J25 was the dominate species in the reactor and played key roles in the removal of N, TOC, and M. aeruginosa. Proposed reaction mechanism of the BFBO.
Study on cellular survival adaptive response induced by low dose irradiation of 153Sm
International Nuclear Information System (INIS)
Zhu Shoupeng; Xiao Dong
1999-01-01
The present study engages in determining whether low dose irradiation of 153 Sm could cut down the responsiveness of cellular survival to subsequent high dose exposure of 153 Sm so as to make an inquiry into approach the protective action of adaptive response by second irradiation of 153 Sm. Experimental results indicate that for inductive low dose of radionuclide 153 Sm 3.7 kBq/ml irradiated beforehand to cells has obvious resistant effect in succession after high dose irradiation of 153 Sm 3.7 x 10 2 kBq/ml was observed. Cells exposed to low dose irradiation of 153 Sm become adapted and therefore the subsequent cellular survival rate induced by high dose of 153 Sm is sufficiently higher than high dose of 153 Sm merely. It is evident that cellular survival adaptive response could be induced by pure low dose irradiation of 153 Sm only
PVD Ti coatings on Sm-Co magnets
International Nuclear Information System (INIS)
Bovda, O.M.; Bovda, V.O.; Garkusha, I.E.; Leonov, S.O.; Onishchenko, L.V.; Tereshin, V.I.; Totrika, O.S.; Chen, C.H.
2008-01-01
The combination of conventional ion-plasma deposition (PVD) and pulsed plasma technologies (PPT) has been applied for rare-earth Sm-Co based magnets, to provide them with enhanced corrosion resistance. The influence of pulsed plasma treatment on Sm-Co magnets with deposited titanium PVD coatings has been investigated. It was revealed that thickness of modified layer significantly depends on the thickness of initial titanium film and plasma treatment regimes. As a result of plasma treatment with energy density of 30 J/cm 2 and pulse duration of ∼ 5 μs fine-grained layer with the thickness of 70 microns has been formed on the Sm-Co magnet with pure titanium film of 50 micron. According to SEM analyses considerable diffusion of titanium to the bulk of the magnet, on the depth of 20 microns, took place. Such reaction enhances strong bonding between the coating and the magnet
Magnetic anisotropies in SmCo thin films
International Nuclear Information System (INIS)
Chen, K.
1993-01-01
A systemic study of the deposition processes and magnetic properties for the Sm-Co film system has been carried out. Films of Sm-Co system with various magnetic anisotropies have been synthesized through sputter deposition in both crystalline and amorphous phases. The origins of various anisotropies have been studied. Thermalized sputter deposition process control was used to synthesize Fe enriched Sm-Co films with rhombohedral Th 2 Zn 17 type structure. The film exhibited unusually strong textures with the crystallographic c axes of the crystallites aligned in the film plane. A large anisotropy was resulted with easy axis in the film plane. A well defined and large in-the-film-plane anisotropy of exceptionally high value of 3.3 x 10 6 erg/cm 3 has been obtained in the amorphous SmCo films by applying a magnetic field in the film plane during deposition. It was found that the in-the-film-plane anisotropy depended essentially on the applied field and Sm concentration. For films not synthesized through thermallized sputtering, the easy axis of the film could reoriented. A perpendicular anisotropy was also presented in the film synthesized through thermallized sputtering deposition. A large in-plane anisotropy was obtained in films deposited above ambient temperatures. It was concluded that the surface induced short range ordering was the origin of the in-the-film-phase anisotropy observed in amorphous film deposited in the presence of a magnetic field. The formation mechanism was different from that of the short range ordering induced by field annealing. The perpendicular anisotropy was shown to be growth induced. Large in-plane anisotropy in amorphous films was resulted form partial crystallization in the film. Both the formation of growth induced structure and partial crystallization in the film prevented the formation of the pair ordering and decreased in-the-film-plane anisotropy
Mixed Messages from Garnet Lu-Hf and Sm-Nd Geochronology
Vervoort, J. D.; Wang, D.; Johnson, T. A.
2017-12-01
Garnet geochronology provides important information on the timing and conditions of metamorphism. As a major indicator mineral formed during metamorphism, its direct dating can not only help establish the timing of metamorphism, provide the "t" for P-T-t paths, but also, if the dated garnet can be placed in a textural context, can provide information on the timing of deformational features. With advances in chemistry and mass spectrometry, garnet Lu-Hf and Sm-Nd geochronology has become an important geochronological tool and we can now reliably (if not routinely) date a wide variety of garnet compositions formed under diverse conditions. In the course of dating a variety of lithologies using both Lu-Hf and Sm-Nd isotope systems, however, some intriguing results have emerged. Although there are many examples where the Lu-Hf and Sm-Nd systems give the same date within uncertainty, there are also many cases where these systems yield significantly different dates, and the differences between these dates can be considerable—many 10's of Ma of and even 100's of Ma. For example, in garnet-bearing Mesoproterozoic gneisses from across the Blue Ridge Province in Virginia, both Lu-Hf and Sm-Nd analyses (determined on the same solutions) define narrow time spans, but with the Sm-Nd dates systematically younger (for orthogneisses Lu-Hf dates are 1032 to 1019 Ma whereas Sm-Nd dates are 965 to 949 Ma—a difference of 67 to 80 Ma). There are many other examples of systematically younger Sm-Nd garnet dates in both the literature and with our ongoing research. Potential explanations for these differences include: 1) strong partitioning of Lu into garnet during growth yielding ages weighted toward the beginning of growth; 2) faster Lu diffusion from high Lu regions after garnet formation, potentially leading to isochron rotation and anomalously old Lu-Hf dates; and 3) differences in closure temperatures of the two isotope systems. We will review several examples of divergent Lu
Facial ulcerations due to Acinetobacter baumannii: Vessel thrombosis with bacterial mycelia
Directory of Open Access Journals (Sweden)
Dong Ming Li
2014-01-01
Full Text Available A 14-year-old girl presented with a 2-week history of progressive facial ulcerations that did not respond to cephalexin and topical dexamethasone. Biopsy on the ulcer showed rod-shaped bacteria and actinomycetes-like mycelia in the vessel walls and within thrombi. Tissue culture yielded Acinetobacter baumannii, which was resistant to cephalexin. A favourite outcome was achieved with minocycline treatment. This is the first case report of A. baumannii-related vasculitis.
Crystal growth of Sm0.3Tb0.7FeO3 and spin reorientation transition in Sm1−xTbxFeO3 orthoferrite
International Nuclear Information System (INIS)
Wu, Anhua; Wang, Bo; Zhao, Xiangyang; Xie, Tao; Man, Peiwen; Su, Liangbi; Kalashnikova, A.M.; Pisarev, R.V.
2017-01-01
In this work, Sm 0.3 Tb 0.7 FeO 3 single crystal was successfully grown by optical floating zone method. Sm 0.3 Tb 0.7 FeO 3 samples with a-, b-, and c-orientation were manufactured by means of Laue photograph. Magnetic properties of Sm 0.3 Tb 0.7 FeO 3 single crystals are studied over a wide temperature range from 2 to 400 K. Spin reorientation transition from Γ 2 to Γ 4 are observed by means of the temperature dependence of magnetization It indicated the reorientation transition temperature of Sm 1−x Tb x FeO 3 single crystals is lowered with the contents of Tb contents rising based on this work and our previous works, thus the spin reorientation transition temperature can be adjusted through changing the compound in orthoferrites materials, which means that we can get orthoferrites single crystals with high magnetism property in various temperature through material design. - Highlights: • Sm 0.3 Tb 0.7 FeO 3 single crystals with various compounds were successfully grown by optical floating zone method. • The relation between SRT temperature and composition in Sm 1−x Tb x FeO 3 orthoferrite was indicated. • The spin reorientation transition temperature of Sm 1−x Tb x FeO 3 single crystals can be adjusted through changing the compound in orthoferrites materials.
Minerdi, Daniela; Zgrablic, Ivan; Castrignanò, Silvia; Catucci, Gianluca; Medana, Claudio; Terlizzi, Maria Elena; Gribaudo, Giorgio; Gilardi, Gianfranco; Sadeghi, Sheila J
2016-01-01
Antimicrobial resistance is a global issue currently resulting in the deaths of hundreds of thousands of people a year worldwide. Data present in the literature illustrate the emergence of many bacterial species that display resistance to known antibiotics; Acinetobacter spp. are a good example of this. We report here that Acinetobacter radioresistens has a Baeyer-Villiger monooxygenase (Ar-BVMO) with 100% amino acid sequence identity to the ethionamide monooxygenase of multidrug-resistant (MDR) Acinetobacter baumannii. Both enzymes are only distantly phylogenetically related to other canonical bacterial BVMO proteins. Ar-BVMO not only is capable of oxidizing two anticancer drugs metabolized by human FMO3, danusertib and tozasertib, but also can oxidize other synthetic drugs, such as imipenem. The latter is a member of the carbapenems, a clinically important antibiotic family used in the treatment of MDR bacterial infections. Susceptibility tests performed by the Kirby-Bauer disk diffusion method demonstrate that imipenem-sensitive Escherichia coli BL21 cells overexpressing Ar-BVMO become resistant to this antibiotic. An agar disk diffusion assay proved that when imipenem reacts with Ar-BVMO, it loses its antibiotic property. Moreover, an NADPH consumption assay with the purified Ar-BVMO demonstrates that this antibiotic is indeed a substrate, and its product is identified by liquid chromatography-mass spectrometry to be a Baeyer-Villiger (BV) oxidation product of the carbonyl moiety of the β-lactam ring. This is the first report of an antibiotic-inactivating BVMO enzyme that, while mediating its usual BV oxidation, also operates by an unprecedented mechanism of carbapenem resistance. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
Lowman, Warren; Kalk, Thomas; Menezes, Colin N.; John, Melanie A.; Grobusch, Martin P.
2008-01-01
Acinetobacter baumannii is a prolific nosocomial pathogen renowned for its multidrug-resistant nature. We report a case of community-acquired meningitis due to A. baumannii. The case highlights the potential pathogenicity of this organism and raises concerns that this highly adaptable organism may
Magnetic anisotropy of (Sm, Y)2Fe17Ny compounds
International Nuclear Information System (INIS)
Lu, Y.; Tegus, O.; Li, Q.A.; Tang, N.; Yu, M.J.; Zhao, R.W.; Kuang, J.P.; Yang, F.M.; Zhou, G.F.; Li, X.; Boer, F.R. de
1992-01-01
A study of the crystal structure and the magnetic properties, especially the magnetocrystalline anisotropy of (Sm 1-x Y x ) 2 Fe 17 N y compounds (x = 0, 0.2, 0.4, 0.6, 0.8, and 1.0, 2 2 Zn 17 - or Th 2 Ni 17 -type structure as the original compounds. The Curie temperatures decrease from 750 to 700 K as x increases from 0 to 1. The anisotropy field decreases linearly with increasing yttrium content. The spin reorientation has been investigated by means of high field magnetization measurements, AC-susceptibility measurements and thermomagnetic analysis, combined with X-ray diffraction. The anisotropy constants K 1 , K 2 and K 3 were derived by a phenomenological analysis, using magnetization curves measured in high fields, applied perpendicular to the alignment direction of the powder samples. A tentative spin phase diagram of the series is presented. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Xu, M. L.; Yue, M., E-mail: yueming@bjut.edu.cn; Wu, Q.; Li, Y. Q.; Lu, Q. M. [College of Materials Science and Engineering, Beijing University of Technology, Beijing 100124 (China)
2016-05-15
Sm{sub 1-x}Pr{sub x}Co{sub 5} (x=0-0.6) nanoflakes with CaCu{sub 5} structure were successfully prepared by surfactant-assisted high-energy ball milling (SAHEBM). The crystal structure and magnetic properties of Sm{sub 1-x}Pr{sub x}Co{sub 5} (x=0-0.6) nanoflakes were studied by X-ray diffraction and vibrating sample magnetometer. Effects of Pr addition on the structure, magnetic properties and coercivity mechanism of Sm{sub 1-x}Pr{sub x}Co{sub 5} nanoflakes were systematically investigated. XRD results show that all the nanoflakes have a hexagonal CaCu{sub 5}-type (Sm, Pr){sub 1}Co{sub 5} main phase and the (Sm, Pr){sub 2}Co{sub 7} impurity phase, and all of the samples exhibit a strong (00l) texture after magnetic alignment. As the Pr content increases, remanence firstly increases, then slightly reduced, while anisotropy field (H{sub A}) and H{sub ci} of decrease monotonically. Maximum energy product [(BH){sub max}] of the flakes increases first, peaks at 24.4 MGOe with Pr content of x = 0.4, then drops again. Magnetization behavior analysis indicate that the coercivity mechanism is mainly controlled by inhomogeneous domain wall pinning, and the pinning strength weakens with the increased Pr content, suggesting the great influence of H{sub A} on the coercivity of flakes.
Al-Gethamy, Manal M; Faidah, Hani S; Adetunji, Hamed Ademola; Ashgar, Sami S; Mohanned, Tayeb K; Mohammed, Al-Haj; Khurram, Muhammad; Hassali, Mohamed A
2017-01-01
Objective To determine risk factors for multi-drug-resistant Acinetobacter baumannii (MDR-AB) nosocomial infections in intensive care units in a tertiary care hospital, Makkah, Saudi Arabia. Methods We performed a hospital-based, matched case–control study in patients who were admitted to Al Noor Specialist Hospital between 1 January 2012 and 31 August 2012. The study included cases of A. baumannii nosocomial infection and controls without infection. Controls were matched to cases by age and ward of admission. Results The most frequent site of infection was the respiratory tract (77.3%). Susceptibility to antimicrobial MDR-AB was 92.0% for ceftazidime and ciprofloxacin, while it was 83.3% for imipenem, 83.0% for trimethoprim, 79.0% for amikacin, and 72.7% for gentamicin. Multiple logistic regression of risk factors showed that immunosuppression (OR = 2.9; 95% CI 1.5–5.6; p = 0.002), clinical outcome (OR = 0.4; 95% CI 0.3–0.9; p = 0.01), invasive procedures (OR = 7.9; 95% CI 1.8–34.2; p = 0.002), a central venous catheter (OR = 2.9; 95% CI 1.5–5.6; p = 0.000), and an endotracheal tube (OR = 3.4; 95% CI 1.6–7.3; p = 0.001) were associated with MDR-AB. Conclusions Acinetobacter nosocomial infections are associated with admission to the ICU (Intensive care unit) and exposure to invasive procedures. PMID:28480813
Directory of Open Access Journals (Sweden)
Rodrigo Ríos
2008-06-01
Full Text Available Objective. Determinar la seroprevalencia de Leptospira sp., Rickettsia sp. y Ehrlichia sp. en trabajadores de áreas rurales del departamento de Sucre. Material y métodos. Se realizó un estudio escriptivo, prospectivo, de corte transversal, que pretendió determinar la seroprevalencia e Leptospira sp., Rickettsia sp. y Ehrlichia sp. en 90 trabajadores de áreas rurales del departamento de Sucre. Se estableció la presencia de anticuerpos séricos anti-IgM específicos anti-Leptospira por la técnica de ELISA indirecta. Para la determinación de Rickettsia sp. y Ehrlichia sp. se uso la técnica de inmunofluorescencia indirecta. Resultados. La población evaluada estaba compuesta por 27 (30% ordeñadores, 21 (23% jornaleros, 18 (20% profesionales del campo y 24 (27% que realizaban otras actividades. Ventidós (24% muestras resultaron positivas en alguna de las pruebas. De éstas, 12 (13,3% fueron positivas para Leptospira sp., 7 (7,8% para Rickettsia sp. y 3 (3,3% ara Ehrlichia sp. Conclusión. Este fue el primer estudio que se llevó a cabo en el departamento de Sucre y permitió demostrar que existe una prevalencia importante de Leptospira p.,Rickettsia sp. y Ehrlichia sp.. Los factores de riesgo ocupacional fueron factores determinantes en la seropositividad.Objective. To determine the seroprevalence of Leptospira sp., Rickettsia sp. and Ehrlichia sp. in agricultural workers of Sucre. Methods. A descriptive prospective cross-sectional study was conducted in ninety rural workers of Sucre. Presence of serum antibodies anti-IgM specific anti-Leptospira by indirect ELISA was established. For the determination of Rickettsia and Ehrlichia indirect inmunoflorescence was used. Results.The population was composed by 27 (30% milkers, 21 (23% day workers, 18 farm professionals (20% and 24 (26% workers in others activities. A total of 22 (24% samples were positive to some test. Twelve (13.3% were positive to Leptospira sp., seven (7.8% to Rickettsia sp
ORF Alignment: NC_005966 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Acinetobacter sp. ADP1] ... Length = 96 ... Query: 5 ... ALVITDNAAKKVRQLRDSEGNQDLMLRVYVTGGGCSGFSYGFNFADSPNEDDA...EFVNGDV 64 ... ALVITDNAAKKVRQLRDSEGNQDLMLRVYVTGGGCSGFSYGFNFADSPNEDDAEF...VNGDV Sbjct: 1 ... ALVITDNAAKKVRQLRDSEGNQDLMLRVYVTGGGCSGFSYGFNFADSPNEDDAEFVNGDV 60 ...
Low temperature features of the local structure of Sm1-xYxS
International Nuclear Information System (INIS)
Menushenkov, A. P.; Chernikov, R. V.; Sidorov, V. V.; Klementiev, K. V.; Alekseev, P. A.; Rybina, A. V.
2007-01-01
The particular features of the local electronic and local crystal structures of the mixed-valence compound Sm 1-x Y x S are studied by the XAFS spectroscopy methods in the temperature range 20-300 K for the yttrium concentration x = 0.17, 0.25, 0.33, and 0.45. The temperature behavior of the valence of Sm, as well as of the lengths and the Debye-Waller factors of the bonds Sm-S, Sm-Sm(Y), Y-S, and Y-Sm(Y), has been determined. The violation of the Vegard law has been observed. A model for the estimation of the energy width of the 4f level and of its position with respect to the Fermi level is proposed
Conceptual Design Plan SM-43 Replacement Project
Energy Technology Data Exchange (ETDEWEB)
University of California, Los Alamos National Laboratory, SCC Project Office
2000-11-01
The Los Alamos National Laboratory Conceptual Design Plan for the SM-43 Replacement Project outlines plans for replacing the SM-43 Administration Building. Topics include the reasons that replacement is considered a necessity; the roles of the various project sponsors; and descriptions of the proposed site and facilities. Also covered in this proposal is preliminary information on the project schedule, cost estimates, acquisition strategy, risk assessment, NEPA strategy, safety strategy, and safeguards and security. Spreadsheets provide further detail on space requirements, project schedules, and cost estimates.
Directory of Open Access Journals (Sweden)
Prashant K. Parandekar
2012-01-01
Full Text Available Background: Non-fermenters are a group of aerobic non-spore forming gram negative bacilli that are either incapable of utilizingcarbohydrates as a source of energy or degrade them via oxidative rather than fermentative pathway. These are increasingly been reported from the cases of nosocomial infections. Aims and Objectives: This study was undertaken aiming to identify, characterize all nonfermenters and further study of Acinetobacterisolates. Materials and Methods: A total 116 non-fermenters isolated from various specimens obtained from the patients in tertiarycare hospital. Gram negative bacilli which failed to produce acid on Triple Sugar Iron Agar (TSI were identified by employing battery oftests. The Acinetobacter isolates were further speciated and antimicrobial susceptibility testing done by Kirby Bauer disc diffusion technique. Results: Non-fermenters isolated were Pseudomonas aerugionsa (69.8%, Acinetobacter species (18.9%,Stenotrophomonas maltophilia (4.3%, Burkholderia cepacia (3.4%, Alcaligenes fecalis (1.7% and Pseudomonas fluorescens (1.7%. Most of the isolates showed susceptibility to imipenem (86.3% whereasnone of the isolates were sensitive to cephalexin and co-trimoxazole. Conclusion: This study highlights that, after Pseudomonas aeruginosa, Acinetobacter species is the most common non-fermenter. Majority of the isolates of Acinetobacter Species were ofnosocomial origin and were multidrug resistant, which underlines the importance of proper vigilance of these infections in hospital setting.
Energy Technology Data Exchange (ETDEWEB)
Xiao, P. [School of Textile and Material Engineering, Dalian Polytechnic University, Dalian 116034 (China); Zhang, J.J., E-mail: zhangjj@dlpu.edu.cn [School of Textile and Material Engineering, Dalian Polytechnic University, Dalian 116034 (China); Shen, L.F. [Department of Electronic Engineering and State Key Laboratory of Millimeter Waves, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China); Wang, Z.Q. [School of Textile and Material Engineering, Dalian Polytechnic University, Dalian 116034 (China); Pun, E.Y.B. [Department of Electronic Engineering and State Key Laboratory of Millimeter Waves, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China); Lin, H., E-mail: lhai8686@yahoo.com [School of Textile and Material Engineering, Dalian Polytechnic University, Dalian 116034 (China); Department of Electronic Engineering and State Key Laboratory of Millimeter Waves, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China)
2016-10-15
Sm{sup 3+} doped multicomponent antimony phosphate (MSP) luminescent glasses were prepared and tunable white fluorescence has been investigated. Broad visible emission depending on excitation wavelength is validated to be dominated by discrepant Sb{sup 3+} emitting centers. Group of narrow emissions from Sm{sup 3+} is beneficial to adding yellow and red components in Sm{sup 3+} doped MSP glasses, which is strengthened by effective energy transfer from Sb{sup 3+} to Sm{sup 3+}. Excitation wavelength selection and Sm{sup 3+} concentration adjustment are two feasible routes to optimize luminescence color in Sm{sup 3+} doped MSP glasses and the color tunability of fluorescence indicates that amorphous Sm{sup 3+} doped MSP glass phosphors possess potential for ideal white light devices.
Energy Technology Data Exchange (ETDEWEB)
Ruiz, Mariano M.; Mietta, Jose L.; Soledad Antonel, P. [Instituto de Quimica Fisica de Materiales, Ambiente y Energia (INQUIMAE), Departamento de Quimica Inorganica, Analitica y Quimica Fisica, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Av. Cantilo s/n (1428), Buenos Aires (Argentina); Perez, Oscar E. [Departamento de Industrias, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Av. Cantilo s/n (1428), Buenos Aires (Argentina); Martin Negri, R. [Instituto de Quimica Fisica de Materiales, Ambiente y Energia (INQUIMAE), Departamento de Quimica Inorganica, Analitica y Quimica Fisica, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Av. Cantilo s/n (1428), Buenos Aires (Argentina); Jorge, Guillermo, E-mail: gjorge@df.uba.ar [Instituto de Fisica de Buenos Aires, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Av. Cantilo s/n (1428), Buenos Aires (Argentina); Instituto de Ciencias, Universidad Nacional de General Sarmiento, J.M. Gutierrez 1150 (1613), Los Polvorines, Buenos Aires (Argentina)
2013-02-15
We have synthesized magnetic Fe{sub 2-x}CoSm{sub x}O{sub 4} nanoparticles (NPs) by means of the coprecipitation method, varying Sm content from x=0 to x=0.5. Energy-dispersive X-ray spectroscopy showed agreement between the metal proportion of the obtained nanoparticles and the stoichiometric mixture of cations used for the synthesis. Part of the particles were heated at 800 Degree-Sign C, and both were characterized by X-ray diffraction, scanning electron microscope imaging and magnetization measurements. Physical and magnetic properties were analyzed as a function of Sm content, before and after the heating treatment. A phase segregation is found for the calcined nanoparticles with large Sm content. The magnetic remanence, saturation and coercive field were investigated as a function of Sm content for both heated and unheated (as-prepared) particles. Polydimethylsiloxane-NPs magnetoelastomers were prepared and cured under an external uniform magnetic field, obtaining structured anisotropic composites, in which inorganic needles (columnar micrometric structures) oriented in the direction of the magnetic field are formed. Young modulus and remanent magnetic moment were measured and magnetization time relaxation experiments were performed in the directions parallel and perpendicular to the needles in order to determine the magnetic and elastic anisotropy of the composites. The elastic modulus measured parallel to the needles resulted almost twice in magnitude with respect to the perpendicular modulus. The measured magnetic anisotropy of the composites is probably due to the enhanced interparticle interaction within a needle and the freezing of an preferred easy axis distribution among the particles at the curing process. - Highlights: Black-Right-Pointing-Pointer We study magnetic and physical properties of Sm-substituted Fe{sub 2}CoO{sub 4} nanoparticles. Black-Right-Pointing-Pointer Magnetic nanoparticles were synthesized by the coprecipitation method. Black
Rock, Clare; Harris, Anthony D; Johnson, J Kristie; Bischoff, Werner E; Thom, Kerri A
2015-07-01
Using a validated air sampling method we found Acinetobacter baumannii in the air surrounding only 1 of 12 patients known to be colonized or infected with A. baumannii. Patients' closed-circuit ventilator status, frequent air exchanges in patient rooms, and short sampling time may have contributed to this low burden.
The effect of Sm-doping on optical properties of LaB6 nanoparticles
International Nuclear Information System (INIS)
Chao, Luomeng; Bao, Lihong; Shi, Junjie; Wei, Wei; Tegus, O.; Zhang, Zhidong
2015-01-01
Highlights: • Nanoparticles of Sm-doped LaB 6 have been prepared by solid state reaction. • All samples exhibit high absorbance in NIR range and UV range. • The increase of Sm-doping amount shifts the position of minimum absorptance value. • The optical properties of Sm-doped LaB 6 were interpreted by DFT theory. - Abstract: Nanocrystalline particles of LaB 6 , SmB 6 and Sm-doped LaB 6 have been prepared by a solid-state reaction in order to investigate the optical properties of ternary rare-earth hexaborides. The sizes of prepared nanoparticles range from dozens to more than 200 nm, as confirmed by XRD, SEM and TEM examinations. The optical property concerning the absorption spectra was tested with ultraviolet-visible-near infrared (UV-vis-NIR) absorption spectrum. All samples exhibit high absorbance in NIR range and UV range. The increase of Sm-doping amount shifts the position of minimum absorptance value of LaB 6 to the long-wave direction. Density functional theory (DFT) is employed to interpret the optical properties of Sm-doped LaB 6 , and results indicate that Sm 4f states change the DOS at near Fermi surface of LaB 6 after Sm doping and the reduced number of conduction electrons results into the change of absorption spectra
Electrospinning fabrication and luminescent properties of SrMoO4:Sm3+ nanofibers
International Nuclear Information System (INIS)
Du Pingfan; Song Lixin; Xiong Jie; Cao Houbao; Xi Zhenqiang; Guo Shaoyi; Wang Naiyan; Chen Jianjun
2012-01-01
Highlights: ► SrMoO 4 :Sm 3+ fluorescent nanofibers were fabricated by electrospinning. ► The properties of the SrMoO 4 :Sm 3+ nanofibers were investigated. ► The obtained nanofibers exhibit a fine orange-red fluorescent property. ► The PL intensity of the nanofibers is superior to the nanoparticles counterpart. ► The optimum doping concentration of Sm 3+ in the host lattice is 2 at.%. - Abstract: Samarium ions doped strontium molybdate (SrMoO 4 :Sm 3+ ) nanofibers (NFs) were fabricated by a simple electrospinning process. The obtained SrMoO 4 :Sm 3+ NFs are composed of scheelite-type tetragonal SrMoO 4 phase, and the NFs have an average diameter of ca. 90 nm. Under 275 nm ultraviolet (UV) excitation, the NFs show an orange-red fluorescent property symbolized by a characteristic emission (606 nm) resulting from the 4 G 5/2 → 6 H 7/2 energy level transition of Sm 3+ . And the photoluminescence (PL) emissi on intensity of the SrMoO 4 :Sm 3+ NFs is superior to that of the nanoparticles (NPs) counterpart under the same doping concentrations. The effect of Sm 3+ concentrations on the 4 G 5/2 → 6 H 7/2 emission intensity was also investigated. The result reveals that the concentration quenching will occur when the Sm 3+ content exceeds 2 at.%. In other words, the SrMoO 4 :Sm 3+ NFs have an optimal luminescent performance under such a doping concentration.
Surface coating and magnetic properties of Sm2Fe17Nx materials
International Nuclear Information System (INIS)
Noguchi, K.; Machida, K.; Nishimura, M.; Adachi, G.
1998-01-01
Surface coating for finely ground Sm 2 Fe 17 N x (x=-3) powders (diameter 2 Fe 17 N x and (Zn,In)/Cu/Sm 2 Fe 17 N x , showed good oxidation-resistivity and thermal stability compared with the samples prepared without the Cu metal pre-coating, Zn/Sm 2 Fe 17 N x . The epoxy resin- or In metal-bonded magnets produced from the above coated powders, Zn/Cu/Sm 2 Fe 17 N x and (Zn,In)/Cu/Sm 2 Fe 17 N x , under warm molding conditions provided a flux loss of around -15% after standing in air at 120 C for 1000 h, but 30-40% for the conventional injection-type resin-bonded magnets prepared from Nd-Fe-B powders. (orig.)
Yang, Ming-Yeh; Chang, Kai-Chih; Chen, Liang-Yu; Wang, Po-Ching; Chou, Chih-Chiang; Wu, Zhong-Bin; Hu, Anren
2018-03-01
Photodynamic inactivation (PDI) is a non-invasive and safe therapeutic method for microbial infections. Bacterial antibiotic resistance is caused by antibiotics abuse. Drug-resistant Acinetobacter spp. is a serious problem in hospitals around the world. These pathogens from nosocomial infections have high mortality rates in frailer people, and Acinetobacter spp. is commonly found in immunocompromised patients. Visible light is safer than ultraviolet light (UV) for PDI of nosocomial pathogens with mammalian cells. Zinc oxide nanoparticles (ZnO-NPs) were used in this study as an antimicrobial agent and a photosensitizer. ZnO is recognized as safe and has extensive usage in food additives, medical and cosmetic products. In this study, we used 0.125 mg/ml ZnO-NPs combined with 10.8 J/cm 2 blue light (BL) on Acinetobacter baumannii (A. baumannii) that could significantly reduce microbial survival. However, individual exposure to ZnO-NPs does not affect the viability of A. baumannii. BL irradiation could trigger the antimicrobial ability of ZnO nanoparticles on A. baumannii. The mechanism of photocatalytic ZnO-NPs treatment for sterilization occurs through bacterial membrane disruptions. Otherwise, the photocatalytic ZnO-NPs treatment showed high microbial eradication in nosocomial pathogens, including colistin-resistant and imipenem-resistant A. baumannii and Klebsiella pneumoniae. Based on our results, the photocatalytic ZnO-NPs treatment could support hygiene control and clinical therapies without antibiotics to nosocomial bacterial infections. Copyright © 2018. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Wenzhi Cao
2018-04-01
Full Text Available Tanshinones, one group of bioactive diterpenes, were widely used in the treatment of cardiovascular diseases. WRKYs play important roles in plant metabolism, but their regulation mechanism in Salvia miltiorrhiza remains elusive. In this study, one WRKY transcription factor SmWRKY1 was isolated and functionally characterized from S. miltiorrhiza. Multiple sequence alignment and phylogenetic tree analysis showed SmWRKY1 shared high homology with other plant WRKYs such as CrWRKY1. SmWRKY1 was found predominantly expressed in leaves and stems, and was responsive to salicylic acid (SA, methyl jasmonate (MeJA, and nitric oxide (NO treatment. Subcellular localization analysis found that SmWRKY1 was localized in the nucleus. Over-expression of SmWRKY1 significantly elevated the transcripts of genes coding for enzymes in the MEP pathway especially 1-deoxy-D-xylulose-5-phosphate synthase (SmDXS and 1-deoxy-D-xylulose-5-phosphate reductoisomerase (SmDXR, resulted in over fivefold increase in tanshinones production in transgenic lines (up to 13.7 mg/g DW compared with the control lines. A dual-luciferase (Dual-LUC assay showed that SmWRKY1 can positively regulate SmDXR expression by binding to its promoter. Our work revealed that SmWRKY1 participated in the regulation of tanshinones biosynthesis and acted as a positive regulator through activating SmDXR in the MEP pathway, thus provided a new insight to further explore the regulation mechanism of tanshinones biosynthesis.
Investigation of the oxidative processes in intermetallic Sm Co5 powder during heat treatment
International Nuclear Information System (INIS)
Talijan, Nadezda M.; Milutinovic-Nikolic, Aleksandra; Stajic-Trosic, Jasna T.; Jovanovic, Zarko D.
1996-01-01
Understanding of the thermal stability of intermetallic Sm Co 5 powder is essential for designing the working atmosphere in all phases of the technological procedure in the production of sintered Sm Co 5 magnets to obtain maximal magnetic properties. The thermal stability of the Sm Co 5 powder with defined chemical composition and particle size was investigated in the interval from 20 to 900 deg C. Commercial Sm Co 5 powder was used in this experiment. The powder was milled in anhydrous toluene in an agate mortar to fine powder of quality used in the production of sintered magnets. All the experiments were carried out with powder of an average particle size of 7.23μm, established by SEM. THe thermal stability of the Sm Co 5 powder in static air atmosphere was investigated by thermogravimetric analysis (TGA) using a DuPont Thermal Analyzer. Investigation of the behaviour of Sm Co 5 powder during heating was carried out using new samples of Sm Co 5 powder for each of the investigated temperature cycles. It was found by TGA that up to 200 deg C, the oxidation of Sm Co 5 was negligible. X-ray diffraction of the thermogravimetric experimental residue of the Sm Co 5 powder, heated at 240 deg C, yielded only the presence of the Sm Co 5 phase. By X-ray diffraction different crystal forms were identified depending on the maximal heating temperature. The following phases were identified: Sm 2 O 3 , Co, Co O, Co 3 O 4 and Sm Co O 3 . According to TG and X-ray results, for each of the investigated temperatures, the corresponding chemical reactions were established. The experimental data from both the thermal and X-ray investigations confirm that the phases of pressing and aligning the Sm Co 5 powder, in the process of producing sintered Sm Co 5 magnets, may be performed without a protective atmosphere. (author)
The biodistribution and kinetics of the 153Sm labelled avidin, streptavidin and biotin
International Nuclear Information System (INIS)
Li Guiping; Zhu Chengmo; Jiang Xufeng; Feng Guowei; Zhang Shengguo
1999-01-01
Due to the high affinity of biotin to Av or SA. The authors labelled a biotin derivative (DTPA-biotin) with 153 Sm and then bound this 153 Sm labelled DTPA-biotin to Av or SA. The in vivo kinetics and biodistribution of 153 Sm labelled Av, SA and DTPA-biotin were studied in the rat and mice. The results demonstrated that 153 Sm-Av cleared from the blood rapidly with high liver and renal uptake; 153 Sm-SA cleared from blood slowly with high retention in liver, spleen and kidney, whereas 153 Sm metabolize more fast, and excreted mainly through the kidney. Thereby, the biodistribution difference of SA and Av mentioned above provided an experimental basis for the selection of different components of A-V system in pre-targeting radio-immuno imaging and radioimmunotherapy
The microwave absorbing properties of SmCo attached single wall carbon nanotube/epoxy composites
International Nuclear Information System (INIS)
Yu, Liming; Li, Bo; Sheng, Leimei; An, Kang; Zhao, Xinluo
2013-01-01
Highlights: •The SmCo nanoparticles attached SWCNTs were prepared by dc arc discharge method. •The nano-composite prepared by a rare earth permanent magnet Sm 2 Co 17 as catalyst. •The SmCo attached SWCNT/epoxy composites have an excellent electromagnetic matching characteristics. •The reflection loss and bandwidth below −20 dB of the composite can reach −23.7 dB, 6.2 GHz, respectively. -- Abstract: The SmCo nanoparticles attached single wall carbon nanotubes (SmCo attached SWCNTs) were prepared by hydrogen dc arc discharge method using 2:17 type SmCo permanent powder as catalyst. The SmCo attached SWCNT/epoxy composites with different doping ratios were investigated in the frequency region of 2–18 GHz. The complex permittivity and permeability of the SmCo attached SWCNT/epoxy composites were calculated. The reflection loss properties were simulated by transmission line theory and the microwave absorptive mechanisms were discussed. The results indicate that, due to the better interfacial polarization absorption mechanism of SmCo attached SWCNTs and the electromagnetic (EM) matching of magnetic loss and dielectric loss, the microwave absorption properties of SmCo attached SWCNT/epoxy are evidently improved. When the SmCo attached SWCNTs is doped by 1 wt%, the composite display a larger and wider absorption peak, and the bandwidth of the reflection loss below −20 dB is larger than 6 GHz with the thickness of 3.3 mm. It is expected that the new SmCo attached SWCNT/epoxy composites will be a good microwave absorbing material for the applications in X band, Ku band, or even K band
Sm 3+-doped polymer optical waveguide amplifiers
Huang, Lihui; Tsang, Kwokchu; Pun, Edwin Yue-Bun; Xu, Shiqing
2010-04-01
Trivalent samarium ion (Sm 3+) doped SU8 polymer materials were synthesized and characterized. Intense red emission at 645 nm was observed under UV laser light excitation. Spectroscopic investigations show that the doped materials are suitable for realizing planar optical waveguide amplifiers. About 100 μm wide multimode Sm 3+-doped SU8 channel waveguides were fabricated using a simple UV exposure process. At 250 mW, 351 nm UV pump power, a signal enhancement of ˜7.4 dB at 645 nm was obtained for a 15 mm long channel waveguide.
Frey, Stefan; Reschka, Eva J; Pöggeler, Stefanie
2015-01-01
The striatin-interacting phosphatase and kinase (STRIPAK) complex is composed of striatin, protein phosphatase PP2A and protein kinases that regulate development in animals and fungi. In the filamentous ascomycete Sordaria macrospora, it is required for fruiting-body development and cell fusion. Here, we report on the presence and function of STRIPAK-associated kinases in ascomycetes. Using the mammalian germinal center kinases (GCKs) MST4, STK24, STK25 and MINK1 as query, we identified the two putative homologs SmKIN3 and SmKIN24 in S. macrospora. A BLASTP search revealed that both kinases are conserved among filamentous ascomycetes. The physical interaction of the striatin homolog PRO11 with SmKIN3 and SmKIN24 were verified by yeast two-hybrid (Y2H) interaction studies and for SmKIN3 by co-Immunoprecipitation (co-IP). In vivo localization found that both kinases were present at the septa and deletion of both Smkin3 and Smkin24 led to abnormal septum distribution. While deletion of Smkin3 caused larger distances between adjacent septa and increased aerial hyphae, deletion of Smkin24 led to closer spacing of septa and to sterility. Although phenotypically distinct, both kinases appear to function independently because the double-knockout strain ΔSmkin3/ΔSmkin24 displayed the combined phenotypes of each single-deletion strain.
Directory of Open Access Journals (Sweden)
Stefan Frey
Full Text Available The striatin-interacting phosphatase and kinase (STRIPAK complex is composed of striatin, protein phosphatase PP2A and protein kinases that regulate development in animals and fungi. In the filamentous ascomycete Sordaria macrospora, it is required for fruiting-body development and cell fusion. Here, we report on the presence and function of STRIPAK-associated kinases in ascomycetes. Using the mammalian germinal center kinases (GCKs MST4, STK24, STK25 and MINK1 as query, we identified the two putative homologs SmKIN3 and SmKIN24 in S. macrospora. A BLASTP search revealed that both kinases are conserved among filamentous ascomycetes. The physical interaction of the striatin homolog PRO11 with SmKIN3 and SmKIN24 were verified by yeast two-hybrid (Y2H interaction studies and for SmKIN3 by co-Immunoprecipitation (co-IP. In vivo localization found that both kinases were present at the septa and deletion of both Smkin3 and Smkin24 led to abnormal septum distribution. While deletion of Smkin3 caused larger distances between adjacent septa and increased aerial hyphae, deletion of Smkin24 led to closer spacing of septa and to sterility. Although phenotypically distinct, both kinases appear to function independently because the double-knockout strain ΔSmkin3/ΔSmkin24 displayed the combined phenotypes of each single-deletion strain.
Development of Novel Antibiotics for the Treatment of Acinetobacter and Related Pathogens
2012-07-07
8217]’ . [ugmL ’] Staphylococcus aureus Enterococcus faecalis JH2-2 32 ATCC 12608 2 ATCC 12608+10% serum 2 Bacillus subtilis ATCC 12608 +50% serum...March 1, 2009 to February 28, 2012 4. TITLE AND SUBTITLE Development of Novel Antibiotics for the Treatment of Acinetobacter and Related Pathogens...novel antibacterial agents. 15. SUBJECT TERMS antibiotics , compound screening, complex small molecules 16. SECURITY CLASSIFICATION OF: a. REPORT U
NCBI nr-aa BLAST: CBRC-RNOR-04-0256 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-04-0256 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal
NCBI nr-aa BLAST: CBRC-RNOR-04-0238 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-04-0238 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal
NCBI nr-aa BLAST: CBRC-RNOR-04-0259 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-04-0259 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal
Interaction mode between methylene blue-Sm(III) complex and ...
African Journals Online (AJOL)
Spectroscopic and viscosity methods were applied to investigate the interaction between methylene blue (MB)-Sm(III) complex and herring sperm DNA by using acridine orange as a spectral probe in Tris-HCl buffer (pH 7.40). By means of molar ratio method, the binding ratios between MB-Sm(III)and DNA were determined ...
Coilin phosphorylation mediates interaction with SMN and SmB′
Toyota, Cory G.; Davis, Misty D.; Cosman, Angela M.; Hebert, Michael D.
2010-01-01
Cajal bodies (CBs) are subnuclear domains that participate in spliceosomal small nuclear ribonucleoprotein (snRNP) biogenesis and play a part in the assembly of the spliceosomal complex. The CB marker protein, coilin, interacts with survival of motor neuron (SMN) and Sm proteins. Several coilin phosphoresidues have been identified by mass spectrometric analysis. Phosphorylation of coilin affects its self-interaction and localization in the nucleus. We hypothesize that coilin phosphorylation also impacts its binding to SMN and Sm proteins. In vitro binding studies with a C-terminal fragment of coilin and corresponding phosphomimics show that SMN binds preferentially to dephosphorylated analogs and that SmB′ binds preferentially to phosphomimetic constructs. Bacterially expressed full-length coilin binds more SMN and SmB′ than does the C-terminal fragment. Co-immunoprecipitation and phosphatase experiments show that SMN also binds dephosphorylated coilin in vivo. These data show that phosphorylation of coilin influences interaction with its target proteins and, thus, may be significant in managing the flow of snRNPs through the CB. PMID:19997741
Coilin phosphorylation mediates interaction with SMN and SmB'.
Toyota, Cory G; Davis, Misty D; Cosman, Angela M; Hebert, Michael D
2010-04-01
Cajal bodies (CBs) are subnuclear domains that participate in spliceosomal small nuclear ribonucleoprotein (snRNP) biogenesis and play a part in the assembly of the spliceosomal complex. The CB marker protein, coilin, interacts with survival of motor neuron (SMN) and Sm proteins. Several coilin phosphoresidues have been identified by mass spectrometric analysis. Phosphorylation of coilin affects its self-interaction and localization in the nucleus. We hypothesize that coilin phosphorylation also impacts its binding to SMN and Sm proteins. In vitro binding studies with a C-terminal fragment of coilin and corresponding phosphomimics show that SMN binds preferentially to dephosphorylated analogs and that SmB' binds preferentially to phosphomimetic constructs. Bacterially expressed full-length coilin binds more SMN and SmB' than does the C-terminal fragment. Co-immunoprecipitation and phosphatase experiments show that SMN also binds dephosphorylated coilin in vivo. These data show that phosphorylation of coilin influences interaction with its target proteins and, thus, may be significant in managing the flow of snRNPs through the CB.
Dilatometric and dielectric behaviour of Sm modified PCT ceramics
International Nuclear Information System (INIS)
Singh, Sarabjit; Thakur, O.P.; Prakash, Chandra; Raina, K.K.
2005-01-01
Samarium modified PCT ceramics with composition (Pb 0.76-x Sm x Ca 0.24 )(Ti 0.98 Mn 0.02 )O 3 ; x=0-0.08 in steps of 0.02 were prepared by conventional mixed-oxide method. Detailed dilatometric studies were carried out for green specimens in order to study sintering behaviour. Change in the dilatometric behaviour is correlated with the XRD results of powders calcined at different temperatures. Dielectric constant was observed to increase with increasing Sm concentration, which has been attributed to reduced tetragonality and better densification on Sm substitution. SEM micrographs have revealed the grain size of the samples. Ferroelectric hysteresis behaviour was studied for all the compositions
Angle-resolved photoemission investigation of SmB{sub 6}
Energy Technology Data Exchange (ETDEWEB)
Hlawenka, Peter; Rader, Oliver; Siemensmeyer, Konrad; Weschke, Eugen; Varykhalov, Andrei; Rienks, Emile [Helmholtz-Zentrum Berlin (Germany); Shitsevalova, Natalya [Institute for Problems of Material Science, Kiev (Ukraine); Gabani, Slavomir; Flachbart, Karol [IEP, Slovak Academy of Science, Kosice (Slovakia)
2015-07-01
Recently the mixed valence compound SmB{sub 6} has drawn great attention. Theoretically predicted surface states, which should result from a hybridisation of localised f-bands with conduction electrons and a band inversion, would make SmB{sub 6} the first realisation of a so called topological Kondo insulator. Conductivity and transport measurements, as well as spin-resolved photoemission spectroscopy seem to fortify the scenario of a topological nature of the conductive surface. We investigate the surface electronic structure of SmB{sub 6} by means of high resolution angle-resolved photoemission spectroscopy measurements below 1 K. We will present new insights into the surface states that determine the low temperature conductivity of this material.
Differential roles of CD14 and toll-like receptors 4 and 2 in murine Acinetobacter pneumonia
Knapp, Sylvia; Wieland, Catharina W.; Florquin, Sandrine; Pantophlet, Ralph; Dijkshoorn, Lenie; Tshimbalanga, Ntambua; Akira, Shizuo; van der Poll, Tom
2006-01-01
RATIONALE: Acinetobacter baumannii is an opportunistic bacterial pathogen that is increasingly associated with gram-negative nosocomial pneumonia, but the molecular mechanisms that play a role in innate defenses during A. baumannii infection have not been elucidated. OBJECTIVE: To gain first insight
Directory of Open Access Journals (Sweden)
Blondine Ch. P
2013-07-01
Full Text Available Abstrak Bacillus thuringiensis serotipe H-14 strain lokal adalah bakteri patogen bersifat target spesifiknya larva nyamuk, aman bagi mamalia dan lingkungan. Penelitian bertujuan menentukan efektivitas B. thuringiensis H-14 strain lokal yang dikembangbiakkan dalam buah kelapa untuk pengendalian larva Anopheles sp dan Culex sp. Rancangan eksperimental semu, terdiri dari kelompok perlakuan dan kontrol. Bacillus thuringiensis H-14 strain lokal dikembangbiakan dalam10 buah kelapa umur 6–8 bulan, dengan berat kira-kira 1 kg, telah berisi air kelapa sekitar 400-500 ml/buah kelapa yang diperoleh dari Desa Klaces, Kampung Laut, Kabupaten Cilacap. Diinkubasi selama 14 hari pada temperatur kamar dan ditebarkan di 6 kolam yang menjadi habitat perkembangbiakan larva nyamuk dengan luas berkisar 3–100 m2.Hasil yang diperoleh menunjukkan efektivitas B. thuringiensis H-14 strain lokal terhadap larva Anopheles sp dan Culex sp selama 1 hari sesudah penebaran kematian larva berturut-turut sebesar 80–100% dan 79,31–100%. Sedangkan pada hari ke-14 sebesar 69,30–76,71% dan 67,69–86,04%. Buah kelapa dapat digunakan sebagai media lokal alternatif untuk pengembangbiakan B. thuringiensis H-14 strain lokal Kata kunci: B. thuringiensis H-14, strain lokal, buah kelapa, pengendalian larva Abstract Bacillus thuringiensis serotype H-14 local strain is pathogenic bacteria which specific target to mosquito larvae. It is safe for mammals and enviroment. The aims of this study was to determine the effectivity of B. thuringiensis H-14 local strain which culturing in thecoconut wates against Anopheles sp and Culex sp mosquito larvae. This research is quasi experiment which consist of treated and control groups. Bacillus thuringiensis H-14 local strain was cultured in 10 coconuts with 6–8 months age with weight around 1 kg that contained were approximately 400-500 ml/coconut were taken from Klaces village, Kampung Laut. After that the coconuts incubated for 14
Labelling of MoAb with 153SmH1ETA: Preliminary results
International Nuclear Information System (INIS)
Ferro-Flores, G.; De, F.; Ramirez, M.; Pedraza-Lopez, M.; Tendilla, J.I.; Melendez-Alafort, L.; Murphy, C.A.
2001-01-01
A method to label MoAb with Sm-153 using 1,5,9,13-tetraazacyclohexadecane N,N',N'',N''' tetraacetic acid (H 4 ETA) as a bifunctional chelator was developed. H 4 ETA and SmH 1 ETA were synthesized in our laboratory and characterized by IR spectroscopy, TGA (thermogravimetric analysis), SEM (Scattering Electronic Microscopy), EDAX (Elemental Dispersion Analysis by X-rays) and EPR (Electron Paramagnetic Resonance) at 6 K. The 153 SmH 1 ETAMoAb was prepared by a simple incubation of the MoAb ior cea1, and the 153 SmH 1 ETA complex at neutral pH and at room temperature for 24 h. The specific activity of the labelled antibody was 111 MBq/mg (3 mCi/mg). Sm-153(III) is commercially available with specific activities up to 318.2 GBq/mg. Therefore, under the conditions described above 153 SmH 1 ETA labelled MoAb could be obtained with specific activity up to 1.14 GBq/mg (30.7 mCi/mg). (author)
Symmetries for SM Alignment in multi-Higgs Doublet Models
Pilaftsis, Apostolos
2016-01-01
We derive the complete set of maximal symmetries for Standard Model (SM) alignment that may occur in the tree-level scalar potential of multi-Higgs Doublet Models, with $n > 2$ Higgs doublets. Our results generalize the symmetries of SM alignment, without decoupling of large mass scales or fine-tuning, previously obtained in the context of two-Higgs Doublet Models.
Research of Acinetobacter Baumannii Isolation From Clinical Samples in Second Step Hospital
Directory of Open Access Journals (Sweden)
Keramettin Yanik
2015-11-01
Full Text Available Aim: Due to existing multi drug resistance and subsequently acquired resistance Acinetobacter genus bacteria continuously actual. Other characteristics are increasing treatment costs, patient hospitalization period, mortality and morbidity. Risk factors like extended hospitalization period, background immune system disorders are increasing isolation frequency of this bacteria from patients. Extended spectrum antibiotic usage is known to be a major risk factor. Aim of our study is to investigate cause of growing A.baumanii isolation rate and cross contamination between this isolates in a state hospital. Material and Method: In this study analysed increasing isolation frequency by years and specimen occurrence in level 2 hospital. At the same time detected amount of used imipenem and meropenem in hospital during last three years. A.baumanii strains isolated from respiratory and sputum specimens of patients from intensive care unit and thoracal departament during last month of 2013 year%u2019s were tested using PFGE method for genotypic similarity. Results: Acinetobacters isolation frequency in years and carbapenem usage are subsequently increased. Specimens are generally from respiratory tract. Genotypic similarity not detected on studied 6 A.baumanii strain%u2019s PFGE image. This condition interpreted like this strains origins not from cross contamination.
An update on the arsenal for multidrug-resistant Acinetobacter infections: polymyxin antibiotics.
Kassamali, Zahra; Jain, Rupali; Danziger, Larry H
2015-01-01
To review recent clinical pharmacokinetic and pharmacodynamic data to optimize dosing regimens for polymyxin B and colistin for treatment of infections due to A. baumannii. A literature search was performed using the search terms Acinetobacter, polymyxin, colistin, polymyxin B on MEDLINE. Additional references were identified from the resulting citations. Increasing the dose of polymyxin B or colistin and using either in combination with other antibiotic agents demonstrates improved antimicrobial activity against Acinetobacter spp. Polymyxin B, unlike colistin, is available as an active drug and appears to be relatively unaffected by renal function. This is advantageous both for patients with renal impairment and for those with intact renal function. Achieving therapeutic serum concentrations of colistin may be difficult for those with intact renal function due to rapid clearance of the prodrug, colistimethate sodium (CMS). Clinical data are still lacking for polymyxin B, and it remains to be seen whether advantages demonstrated in PK/PD analyses will persist in the larger scale of patient care and safety. The use of higher doses of either colistin or polymyxin B, as well as combination with other antibiotics, may prevent emerging resistance and preserve the activity of polymyxins against A. baumannii. Copyright © 2014 The Authors. Published by Elsevier Ltd.. All rights reserved.
CipA of Acinetobacter baumannii Is a Novel Plasminogen Binding and Complement Inhibitory Protein.
Koenigs, Arno; Stahl, Julia; Averhoff, Beate; Göttig, Stephan; Wichelhaus, Thomas A; Wallich, Reinhard; Zipfel, Peter F; Kraiczy, Peter
2016-05-01
Acinetobacter baumannii is an emerging opportunistic pathogen, responsible for up to 10% of gram-negative, nosocomial infections. The global increase of multidrug-resistant and pan-resistant Acinetobacter isolates presents clinicians with formidable challenges. To establish a persistent infection,A. baumannii must overcome the detrimental effects of complement as the first line of defense against invading microorganisms. However, the immune evasion principles underlying serum resistance inA. baumannii remain elusive. Here, we identified a novel plasminogen-binding protein, termed CipA. Bound plasminogen, upon conversion to active plasmin, degraded fibrinogen and complement C3b and contributed to serum resistance. Furthermore, CipA directly inhibited the alternative pathway of complement in vitro, irrespective of its ability to bind plasminogen. A CipA-deficient mutant was efficiently killed by human serum and showed a defect in the penetration of endothelial monolayers, demonstrating that CipA is a novel multifunctional protein that contributes to the pathogenesis ofA. baumannii. © The Author 2015. Published by Oxford University Press for the Infectious Diseases Society of America. All rights reserved. For permissions, e-mail journals.permissions@oup.com.
The constitution of alloys in the Al-rich corner of the Al-Si-Sm ternary system
International Nuclear Information System (INIS)
Markoli, B.; Spaic, S.; Zupanic, F.
2001-01-01
The constitution of alloys and the liquidus surface in the Al-rich corner of the Al-Si-Sm ternary system were determined by the examination of controlled heated and cooled specimens, as well as heat-treated specimens by means of optical and scanning electron microscopy, energy-dispersive X-ray spectroscopy, differential thermal analysis and X-ray diffraction. The Al-rich corner of the Al-Si-Sm ternary system comprises five regions of primary crystallisation (α Al , β Si , Al 3 Sm, Al 2 Si 2 Sm and AlSiSm) with following characteristic invariant reaction sequences: ternary eutectic reaction L → α Al + β Si + Al 2 Si 2 Sm, and two liquidus transition reactions, i. e., L + Al 3 Sm → α Al + AlSiSm, and L + AlSiSm → α Al + Al 2 Si 2 Sm. Along with the position of ternary eutectic and both interstitial points in the Al-rich corner of the Al-Si-Sm ternary system, the temperatures for each reaction were determined. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Hu, Zijun; Chen, Da, E-mail: dchen_80@hotmail.com; Wang, Sen; Zhang, Ning; Qin, Laishun, E-mail: qinlaishun@cjlu.edu.cn; Huang, Yuexiang
2017-06-15
Highlights: • Effective Sm doping into BiFeO{sub 3} nanoparticles was obtained by a facile sol-gel route. • Band gap of Sm-doped BiFeO{sub 3} nanoparticles was regulated by the dopant concentration. • Sm-doped BiFeO{sub 3} nanoparticles exhibited superior photocatalytic activities. • The possible photocatalytic mechanism of Sm-doped BiFeO{sub 3} nanospheres was discussed. - Abstract: In this work, the effect of Sm doping on the structural and photocatalytic properties of BiFeO{sub 3} (BFO) was investigated. A series of Sm doped BFO nanoparticles containing different Sm dopant contents (Bi{sub (1−x)}Sm{sub x}FeO{sub 3}, x = 0.00, 0.01, 0.03, 0.05, 0.07, 0.10) were synthesized via a simple sol-gel route. It was revealed that Sm{sup 3+} ions were successfully doped into BFO nanoparticles, and the band gap value was gradually decreased when increasing Sm dopant concentration. The photocatalytic activity of Sm-doped BFO photocatalyst was significantly affected by the Sm doping content. Compared to pure BFO, the Sm-doped BFO samples exhibited much higher photocatalytic activity. The improved photocatalytic activity of Sm-doped BFO could be attributed to the enhanced visible light absorption and the efficient separation of photogenerated electrons and holes derived from Sm dopant trapping level in the Sm-doped BFO samples. In addition, the possible photocatalytic mechanism of Sm-doped BFO photocatalyst was also proposed.
Investigation of cellular microstructure and enhanced coercivity in sputtered Sm2(CoCuFeZr)17 film
International Nuclear Information System (INIS)
Bhatt, Ranu; Schütz, G.; Bhatt, Pramod
2014-01-01
We have investigated the effect of annealing temperature on the microstructure and magnetic properties of Sm 2 (CoCuFeZr) 17 films prepared using ion beam sputtering at room temperature. The as-deposited film shows randomly oriented polycrystalline grains and exhibits small coercivity (H C ) of 0.04 T at room temperature. Post annealing of these films at 700 °C under Ar atmosphere shows significant changes in the microstructure transforming it to the development of cellular growth, concomitant with enhanced coercivity up to 1.3 T. The enhanced coercivity is explained using the domain wall pinning mechanism
New pteridophyte species and combinations from the Marquesas Islands, French Polynesia
Directory of Open Access Journals (Sweden)
David Lorence
2011-07-01
Full Text Available Intensive botanical exploration of the Marquesas Islands (French Polynesia for the Vascular Flora of the Marquesas Islands and Flore de la Polynésie française projects has resulted in numerous additional new collections from these islands. Study of these collections has brought to light 11 new species of pteridophytes (ferns and lycophytes which are described herein: Blechnum pacificum Lorence & A. R. Sm., sp. nov., Cyclosorus castaneus A. R. Sm. & Lorence, sp. nov., Cyclosorus florencei A. R. Sm. & Lorence, sp. nov., Dryopteris macropholis Lorence & W. L. Wagner, sp. nov., Dryopteris sweetorum Lorence & W. L. Wagner, sp. nov., Polystichum kenwoodii Lorence & W. L. Wagner, sp. nov., Polystichum uahukaense Lorence & W. L. Wagner, sp. nov., Pteris hivaoaensis Lorence & K. Wood, sp. nov., Pteris marquesensis Lorence & K. R. Wood, sp. nov., Pteris tahuataensis Lorence & K. R. Wood, sp. nov., and Thelypteris marquesensis Lorence & K. R. Wood, sp. nov. One new combination is made: Cyclosorus marquesicus (Holttum Lorence & A. R. Sm., comb. nov. (based on Plesioneuron marquesicum Holttum. An analysis of the conservation status of these new Marquesas Islands taxa reveals they are in need of inclusion in the IUCN Red List with conservation status ranging from vulnerable (one species, and endangered (four species, to critically endangered (five species.
Lifetime measurements of the excited states in {sup 145} Sm
Energy Technology Data Exchange (ETDEWEB)
El-Badry, A M; Abdel Samie, Sh; Ahmad, A A [Depatment of Physics, Faculty of Science, ElMinia University, ElMinia, (Egypt); Kuroyanagi, T; Odahara, A; Gono, Y; Morinobu, S [Tandem Accelerator Laboratory, Department of Physics, Kyushu University, (Japan)
1997-12-31
Lifetime of the excited levels in {sup 145} Sm has been measured through the {sup 139} La ({sup 10} B, 4 n){sup 145} Sm nuclear reaction. The optimal beam energy of 49 MeV was determined from the measurements of the excitation function and Cascade program. With the possibility of studying lifetime of this nucleus a conventional plunger system have been designed and constructed at kyushu University tandem accelerator laboratory. A La target of 0.22 mg/cm{sup 2} thickness which was evaporated onto a Au foil of 2 mg/cm{sup 2} thickness was used. Since the recoil velocity was estimated to be 1.76 mm/ns (beta 0.00585), the measurable time range resulted in the range from 5 Ps to 5 ns. The single spectra measurements were performed at the 20 plunger positions in the range from 10 {mu} to 10 mm. Analyses of the data were carried using hypermet and/or GF2 program to obtain the lifetimes. A new list of lifetimes for 12 excited states up to 3.922 MeV excitations for {sup 145} Sm were determined for the first time. Decay curves of the these transitions are discussed. The new lifetimes of excited states in {sup 145} Sm enabled us to understand the electromagnetic properties. The deduced transition probabilities were established and compared with that of N = 83 isotones and the closed shell nucleus {sup 144} Sm. In addition, a nuclear structure of {sup 145} Sm have been discussed and proposed in framework of the shell model. 4 figs., 1 tab.
SM*A*S*H (Standard Model*Axion*Seesaw*Higgs portal inflation)
International Nuclear Information System (INIS)
Ringwald, Andreas
2016-10-01
We present a minimal model for particle physics and cosmology. The Standard Model (SM) particle content is extended by three right-handed SM-singlet neutrinos N_i and a vector-like quark Q, all of them being charged under a global lepton number and Peccei-Quinn (PQ) U(1) symmetry which is spontaneously broken by the vacuum expectation value υ_σ∝10"1"1 GeV of a SM-singlet complex scalar field σ. Five fundamental problems - neutrino oscillations, baryogenesis, dark matter, inflation, strong CP problem - are solved at one stroke in this model, dubbed ''SM*A*S*H'' (Standard Model*Axion*Seesaw*Higgs portal inflation). It can be probed decisively by upcoming cosmic microwave background and axion dark matter experiments.
Pandey, Tribhuwan; Du, Mao-Hua; Parker, David S.
2018-03-01
Designing a permanent magnet with reduced critical rare-earth content is of paramount importance in the development of cost-effective modern technologies. By performing comprehensive first-principles calculations, we investigate the potential avenues for reducing the critical rare-earth content in Sm2Fe17N3 and Sm2Fe17C3 by making a La or Ce substitution for Sm. The calculated magnetic properties of base compounds are in good agreement with the previous low-temperature (4.2-K) experimental measurements, and they show a large axial anisotropy. Although La or Ce substitution results in a slight reduction of magnetic anisotropy, the magnetic moments of Fe atoms mostly remain unchanged. Specifically, large axial anisotropies of 7.2 and 4.1 MJ /m3 are obtained for SmCeFe17 N3 and SmLaFe17 N3 , respectively. These values of anisotropies are comparable to the state-of-the-art permanent magnet Nd2 Fe14 B . The foremost limitation of Sm2 Fe17X3 magnets for practical application is the formation nitrogen or carbon vacancies at high temperatures. By calculating the N- (C)- vacancy formation energy, we show that La or Ce substitution enhances the vacancy formation energy. This enhanced vacancy formation energy will likely improve the thermodynamic stability of these alloys at high temperatures. Therefore, La- or Ce-substituted Sm2Fe17C3 and Sm2Fe17N3 compounds are promising candidates for high-performance permanent magnets with substantially reduced rare-earth content.
Renckens, Rosemarijn; Roelofs, Joris J. T. H.; Knapp, Sylvia; de Vos, Alex F.; Florquin, Sandrine; van der Poll, Tom
2006-01-01
BACKGROUND: Acinetobacter baumannii is an emerging pathogen in nosocomial pneumonia. Trauma and postsurgical patients display a profound acute-phase protein response and are susceptible to pneumonia. METHODS: To study the way in which the acute-phase response induced by sterile tissue injury
NCBI nr-aa BLAST: CBRC-MMUS-04-0013 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-04-0013 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
NCBI nr-aa BLAST: CBRC-RMAC-04-0050 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RMAC-04-0050 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
NCBI nr-aa BLAST: CBRC-MMUS-04-0074 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-04-0074 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-PABE-04-0003 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PABE-04-0003 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa
NCBI nr-aa BLAST: CBRC-RNOR-04-0241 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-04-0241 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa
NCBI nr-aa BLAST: CBRC-MMUS-04-0078 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-04-0078 ref|NP_000862.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo... sapiens] sp|P50406|5HT6R_HUMAN 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin receptor 6) gb|AAA92622.1| 5-HT6 serotonin... receptor gb|AAR07900.1| 5-hydroxytryptamine/serotonin receptor 6 [Homo sapiens] gb|AAH7499...6.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo sapiens] gb|AAH74995.1| 5-hydroxytryptamine (seroton...in) receptor 6 [Homo sapiens] emb|CAI19020.1| 5-hydroxytryptamine (serotonin) recep
Propagation of Nd magnetic phases in Nd/Sm(001) superlattices
International Nuclear Information System (INIS)
Soriano, S; Dufour, C; Dumesnil, K; Stunault, A
2006-01-01
The propagation of Nd long range magnetic order in the hexagonal and cubic sublattices has been investigated in double hexagonal compact Nd/Sm(001) superlattices by resonant x-ray magnetic scattering at the Nd L 2 absorption edge. For a superlattice with 3.7 nm thick Sm layers, the magnetic structure of the hexagonal sublattice propagates coherently through several bilayers, whereas the order in the cubic sublattice remains confined to single Nd blocks. For a superlattice with 1.4 nm thick Sm layers, the magnetic structures of both sublattices appear to propagate coherently through the superlattice. This is the first observation (i) of the long range coherent propagation of Nd order on the cubic sites between Nd blocks and (ii) of a different thickness dependence of the propagation of the Nd magnetic phases associated with the hexagonal and cubic sublattices. The propagation of the Nd magnetic order through Sm is interpreted in terms of generalized susceptibility of the Nd conduction electrons
The simultaneous mass and energy evaporation (SM2E) model.
Choudhary, Rehan; Klauda, Jeffery B
2016-01-01
In this article, the Simultaneous Mass and Energy Evaporation (SM2E) model is presented. The SM2E model is based on theoretical models for mass and energy transfer. The theoretical models systematically under or over predicted at various flow conditions: laminar, transition, and turbulent. These models were harmonized with experimental measurements to eliminate systematic under or over predictions; a total of 113 measured evaporation rates were used. The SM2E model can be used to estimate evaporation rates for pure liquids as well as liquid mixtures at laminar, transition, and turbulent flow conditions. However, due to limited availability of evaporation data, the model has so far only been tested against data for pure liquids and binary mixtures. The model can take evaporative cooling into account and when the temperature of the evaporating liquid or liquid mixture is known (e.g., isothermal evaporation), the SM2E model reduces to a mass transfer-only model.
Energy Technology Data Exchange (ETDEWEB)
Vahedi, Shahrzad; Okada, Go; Morrell, Brian; Muzar, Edward; Koughia, Cyril; Kasap, Safa [Department of Electrical and Computer Engineering, University of Saskatchewan, Saskatoon, Saskatchewan S7N 5A9 (Canada); Edgar, Andy; Varoy, Chris [School of Chemical and Physical Sciences and MacDiarmid Institute, Victoria University of Wellington, Kelburn Parade (New Zealand); Belev, George; Wysokinski, Tomasz [Canadian Light Source, Inc., University of Saskatchewan, Saskatoon, Saskatchewan S7N 0X4 (Canada); Chapman, Dean [Department of Anatomy and Cell Biology, University of Saskatchewan, Saskatoon, Saskatchewan S7N 5E5 (Canada)
2012-10-01
Fluorophosphate and fluoroaluminate glasses doped with trivalent samarium were evaluated as sensors of x-ray radiation for microbeam radiation therapy at the Canadian Light Source using the conversion of trivalent Sm{sup 3+} to the divalent form Sm{sup 2+}. Both types of glasses show similar conversion rates and may be used as a linear sensor up to {approx}150 Gy and as a nonlinear sensor up to {approx}2400 Gy, where saturation is reached. Experiments with a multi-slit collimator show high spatial resolution of the conversion pattern; the pattern was acquired by a confocal fluorescence microscopy technique. The effects of previous x-ray exposure may be erased by annealing at temperatures exceeding the glass transition temperature T{sub g} while annealing at T{sub A} < T{sub g} enhances the Sm conversion. This enhancement is explained by a thermally stimulated relaxation of host glass ionic matrix surrounding x-ray induced Sm{sup 2+} ions. In addition, some of the Sm{sup 3+}-doped glasses were codoped with Eu{sup 2+}-ions but the results show that there is no marked improvement in the conversion efficiency by the introduction of Eu{sup 2+}.
The constitution of alloys in the Al-rich corner of the Al-Si-Sm ternary system
Energy Technology Data Exchange (ETDEWEB)
Markoli, B.; Spaic, S. [Ljubljana Univ. (Slovenia). Faculty of Natural Science and Engineering; Zupanic, F. [Maribor Univ. (Slovenia). Faculty of Mechanical Engineering
2001-09-01
The constitution of alloys and the liquidus surface in the Al-rich corner of the Al-Si-Sm ternary system were determined by the examination of controlled heated and cooled specimens, as well as heat-treated specimens by means of optical and scanning electron microscopy, energy-dispersive X-ray spectroscopy, differential thermal analysis and X-ray diffraction. The Al-rich corner of the Al-Si-Sm ternary system comprises five regions of primary crystallisation ({alpha}{sub Al}, {beta}{sub Si}, Al{sub 3}Sm, Al{sub 2}Si{sub 2}Sm and AlSiSm) with following characteristic invariant reaction sequences: ternary eutectic reaction L {yields} {alpha}{sub Al} + {beta}{sub Si} + Al{sub 2}Si{sub 2}Sm, and two liquidus transition reactions, i. e., L + Al{sub 3}Sm {yields} {alpha}{sub Al} + AlSiSm, and L + AlSiSm {yields} {alpha}{sub Al} + Al{sub 2}Si{sub 2}Sm. Along with the position of ternary eutectic and both interstitial points in the Al-rich corner of the Al-Si-Sm ternary system, the temperatures for each reaction were determined. (orig.)
In vivo efficacy of SM-8668 (Sch 39304), a new oral triazole antifungal agent.
Tanio, T; Ichise, K; Nakajima, T; Okuda, T
1990-06-01
SM-8668 (Sch 39304) is a new oral antifungal agent which we evaluated in comparison with fluconazole in various fungal infection models. The prophylactic effect of SM-8668 was excellent against systemic candidiasis, aspergillosis, and cryptococcosis in mice. The 50% effective dose for SM-8668 was assessed at 10 days after infection and was 0.18, 3.7, and 5.9 mg/kg (body weight), respectively, for the above-mentioned fungal diseases. Fluconazole was about four times less effective than SM-8668 against systemic candidiasis and was only slightly effective at doses of 80 and 25 mg/kg against systemic aspergilosis and cryptococcosis, respectively. SM-8668 was also about four to eight times more active than fluconazole against vaginal candidiasis in rats and against dermatophytic infection in guinea pigs. In addition, topical SM-8668 was as effective as topical miconazole or tioconazole against skin mycosis in guinea pigs. After oral administration, SM-8668 showed a maximum concentration in serum similar to that of fluconazole in both mice and rats, but the elimination half-life and area under the serum concentration-time curve for SM-8668 were twice those for fluconazole.
Combustion synthesis of micron-sized Sm2Co17 particles via mechanochemical processing
International Nuclear Information System (INIS)
Liu, W.; McCormick, P.G.
1998-01-01
Full text: The spontaneous formation of Sm 2 Co 17 micron-sized particles via a mechanically induced combustion reaction has been investigated. Sm 2 Co 17 alloy particles of 0.1--2 μm in size embedded in a CaO matrix formed directly via a combustion reaction induced by milling the powder mixture of Sm 2 O 3 , CoO, CaO and Ca over a critical time. The micron-sized Sm 2 Co 17 particles were found to have the TbCu 7 -type structure and characterized by a coercivity value of 7.8 kOe while embedded in the CaO matrix. The effect of subsequent heat treatment on the structure and magnetic properties of as-milled samples was also investigated. Removal of the CaO by a carefully controlled washing process yielded micron-sized Sm 2 Co 17 particles without significant oxidation of the particles. These fine Sm 2 Co 17 particles can be used to produce anisotropic bulk or bonded magnets
Ahmed, S.S.; Alp, E.; Ulu-Kilic, A.; Dinc, G.; Aktas, Z.; Ada, B.; Bagirova, F.; Baran, I.; Ersoy, Y.; Esen, S.; Guven, T.G.; Hopman, J.; Hosoglu, S.; Koksal, F.; Parlak, E.; Yalcin, A.N.; Yilmaz, G.; Voss, A.; Melchers, W.J.
2016-01-01
Epidemic clones of Acinetobacter baumannii, described as European clones I, II, and III, are associated with hospital epidemics throughout the world. We aimed to determine the molecular characteristics and genetic diversity between European clones I, II, and III from Turkey and Azerbaijan. In this
Structural and magnetic properties of SmCo-based magnetic films grown by electron-beam evaporation
Energy Technology Data Exchange (ETDEWEB)
Saravanan, P., E-mail: psdrdo@gmail.com [Defence Metallurgical Research Laboratory, Hyderabad 500058 (India); Vinod, V.T.P.; Černík, Miroslav [Institute for Nanomaterials, Advanced Technologies and Innovation, Department of Natural Sciences, Technical University of Liberec, Studentská 1402/2, Liberec 1, 461 17 (Czech Republic); Vishnuraj, R.; Arout Chelvane, J.; Kamat, S.V. [Defence Metallurgical Research Laboratory, Hyderabad 500058 (India); Hsu, Jen-Hwa, E-mail: jhhsu@phys.ntu.edu.tw [Department of Physics, National Taiwan University, Taipei 106, Taiwan (China)
2015-07-01
Sub-micron thick Sm–Co films (200 and 300 nm) with selective phase composition are grown on Si (100) substrates by electron-beam evaporation using Sm-lean alloy targets such as Sm{sub 4}Co{sub 96} and Sm{sub 8}Co{sub 92}. The structural and magnetic properties of Sm–Co films are characterized by x-ray diffraction (XRD), field-emission scanning electron microscopy (FESEM) and super-conducting quantum interference device (SQUID) magnetometer. The Sm–Co films obtained with the Sm{sub 4}Co{sub 96} target exhibit Sm{sub 2}Co{sub 17} as a prominent phase; while the films produced with the Sm{sub 8}Co{sub 92} target show Sm{sub 2}Co{sub 7} as a major phase. Both the Sm–Co films reveal granular morphology; however, the estimated grain size values are slightly lower in the case of Sm{sub 2}Co{sub 7} films, irrespective of their thicknesses. Coercivity (H{sub c}) values of 1.48 and 0.9 kOe are achieved for the as-grown 200-nm thick Sm{sub 2}Co{sub 17} and Sm{sub 2}Co{sub 7}-films. Temperature-dependent magnetization studies confirm that the demagnetization behaviors of these films are consistent with respect to the identified phase composition. Upon rapid thermal annealing, maximum H{sub c} value of 8.4 kOe is achieved for the 200 nm thick Sm{sub 2}Co{sub 17}-films. As far as e-beam evaporated Sm–Co films are concerned, this H{sub c} value is one of the best values reported so far. - Highlights: • Electron-beam evaporation was exploited to grow sub-μm thick Sm–Co films. • Sm{sub 2}Co{sub 7} and Sm{sub 2}Co{sub 17} magnetic phases were crystallized using Sm-lean alloy targets. • Both 200 and 300-nm thick Sm–Co films revealed distinct granular morphology. • Sm–Co films of lower thickness exhibited high H{sub c} and low M{sub s} and vice-versa. • Coercivity value of 8.4 kOe achieved for the 200-nm thick Sm{sub 2}Co{sub 17}-films after RTA.
The Pathology of Infection in the Department of Radiology
Energy Technology Data Exchange (ETDEWEB)
Shin, Seong Gyu [Dept. of Radiology, Dong a University Medical Center, Pusan (Korea, Republic of); Lee, Hyo Yeong [Dept. of Nuclear Medicine, Pusan National University Hospital, Pusan (Korea, Republic of)
2012-09-15
This study was performed to understand the bacteriologic contamination level of radiological equipment which have frequent contacts with patients in the Department of Radiology of an university hospital in Busan area. Before sterilizing in-patient of the radiology rooms, MRSA, VRE, acinetobacter baumannii, candida albicans, and enterococcus sp. were detected. After sterilization, all the bacteria were not found. As examine times become longer, more bacteria were detected and after 7 hours, bacillus sp.(GPR), CNS, acinetobacter baumannii, and Enterococcus sp. were detected. After examining infected patients, bacillus sp.(GPR), VRE, enterococcus sp. CNS, and micrococcus sp. were detected and on the hands of radiological technologists, CNS, enterococcus sp. escherichia coli, and enterobacter sp. were detected. Similar species of bacteria were detected from each radiology room, but pseudomonas aeruginosa was detected on the handles of portable radiological equipment and the chair in the waiting room. Therefore, it is the most important to regularly sterilize radiological equipment and devices which have frequent contacts with patients and to sterilize them right after the use of infected patients in order to prevent the spread of infection. Also, thorough hand washing, education on infection and management for the characteristics of Department of Radiology should be performed for the systematic prevention of infection.
The Pathology of Infection in the Department of Radiology
International Nuclear Information System (INIS)
Shin, Seong Gyu; Lee, Hyo Yeong
2012-01-01
This study was performed to understand the bacteriologic contamination level of radiological equipment which have frequent contacts with patients in the Department of Radiology of an university hospital in Busan area. Before sterilizing in-patient of the radiology rooms, MRSA, VRE, acinetobacter baumannii, candida albicans, and enterococcus sp. were detected. After sterilization, all the bacteria were not found. As examine times become longer, more bacteria were detected and after 7 hours, bacillus sp.(GPR), CNS, acinetobacter baumannii, and Enterococcus sp. were detected. After examining infected patients, bacillus sp.(GPR), VRE, enterococcus sp. CNS, and micrococcus sp. were detected and on the hands of radiological technologists, CNS, enterococcus sp. escherichia coli, and enterobacter sp. were detected. Similar species of bacteria were detected from each radiology room, but pseudomonas aeruginosa was detected on the handles of portable radiological equipment and the chair in the waiting room. Therefore, it is the most important to regularly sterilize radiological equipment and devices which have frequent contacts with patients and to sterilize them right after the use of infected patients in order to prevent the spread of infection. Also, thorough hand washing, education on infection and management for the characteristics of Department of Radiology should be performed for the systematic prevention of infection.
Blue-green and red photoluminescence in CaTiO3:Sm
International Nuclear Information System (INIS)
Figueiredo, Alberthmeiry T. de; Longo, Valeria M.; Lazaro, Sergio de; Mastelaro, Valmor R.; De Vicente, Fabio S.; Hernandes, Antonio C.; Siu Li, Maximo; Varela, Jose A.; Longo, Elson
2007-01-01
Blue-green and red photoluminescence (PL) emission in structurally disordered CaTiO 3 :Sm (CT:Sm) powders was observed at room temperature with laser excitation at 350.7 nm. The perovskite-like titanate CT:Sm powders prepared by a soft chemical processing at different temperatures of annealing were structurally characterized by X-ray diffraction (XRD) and X-ray absorption near-edge structure (XANES). The results indicate that the generation of the broad PL band is related to order-disorder degree in the perovskite-like structure
Young, Brennan J.; Bunnell, Brian E.; Beidel, Deborah C.
2012-01-01
Although children with social phobia (SP) and selective mutism (SM) present similarly in a clinical setting, it remains unclear whether children with SM are unable to speak due to overwhelming anxiety, or whether withholding speech functions as an avoidance mechanism. A total of 35 children (ages 5-12 years) with either SM (n = 10), SP (n = 11),…
Comparative analysis of Acinetobacters: three genomes for three lifestyles.
Directory of Open Access Journals (Sweden)
David Vallenet
Full Text Available Acinetobacter baumannii is the source of numerous nosocomial infections in humans and therefore deserves close attention as multidrug or even pandrug resistant strains are increasingly being identified worldwide. Here we report the comparison of two newly sequenced genomes of A. baumannii. The human isolate A. baumannii AYE is multidrug resistant whereas strain SDF, which was isolated from body lice, is antibiotic susceptible. As reference for comparison in this analysis, the genome of the soil-living bacterium A. baylyi strain ADP1 was used. The most interesting dissimilarities we observed were that i whereas strain AYE and A. baylyi genomes harbored very few Insertion Sequence elements which could promote expression of downstream genes, strain SDF sequence contains several hundred of them that have played a crucial role in its genome reduction (gene disruptions and simple DNA loss; ii strain SDF has low catabolic capacities compared to strain AYE. Interestingly, the latter has even higher catabolic capacities than A. baylyi which has already been reported as a very nutritionally versatile organism. This metabolic performance could explain the persistence of A. baumannii nosocomial strains in environments where nutrients are scarce; iii several processes known to play a key role during host infection (biofilm formation, iron uptake, quorum sensing, virulence factors were either different or absent, the best example of which is iron uptake. Indeed, strain AYE and A. baylyi use siderophore-based systems to scavenge iron from the environment whereas strain SDF uses an alternate system similar to the Haem Acquisition System (HAS. Taken together, all these observations suggest that the genome contents of the 3 Acinetobacters compared are partly shaped by life in distinct ecological niches: human (and more largely hospital environment, louse, soil.
ORF Alignment: NC_005966 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ochrome ... b(562) (CybC) [Acinetobacter sp. ADP1] ... Length = 106 ... Query: 32 ... ASLQNNMISIATAYSDFSKSSNVKDAETALNKMKLAAID...SQKSKPSKLANKPDNSAEVMD 91 ... ASLQNNMISIATAYSDFSKSSNVKDAETALNKMKLAAIDS...QKSKPSKLANKPDNSAEVMD Sbjct: 1 ... ASLQNNMISIATAYSDFSKSSNVKDAETALNKMKLAAIDSQKSKPSKLANKPDNSAEVMD 60 ...
Energy Technology Data Exchange (ETDEWEB)
Li, Minhong; Wang, LiLi; Ran, Weiguang; Ren, Chunyan; Song, Zeling; Shi, Jinsheng, E-mail: jsshiqn@aliyun.com
2017-04-15
Currently, the key change for white-LED is to improve the luminescence efficiency of red phosphor. Sm{sup 3+} activated phosphor was considered due to suitable emission position of red light. However, the luminescence intensity in the red region is weak. For enhancing red-emitting of Sm{sup 3+}, Bi{sup 3+} and Tb{sup 3+} ions were introduced into Ca{sub 2}Al{sub 2}SiO{sub 7}:Sm{sup 3+} phosphors based on the concept of energy transfer. For Ca{sub 2}Al{sub 2}SiO{sub 7}:Bi{sup 3+}, Sm{sup 3+} samples, it can be observed that the energy transfer process was blocked. Hence, Tb{sup 3+} was introduced into Ca{sub 2}Al{sub 2}SiO{sub 7}:Bi{sup 3+}, Sm{sup 3+} samples to increase Sm{sup 3+} luminescence intensity based on Bi{sup 3+}→Tb{sup 3+}→Sm{sup 3+} energy transfer process. Compared with Sm{sup 3+} single-doped Ca{sub 2}Al{sub 2}SiO{sub 7} phosphor, the luminescence intensity of Sm{sup 3+} was enhanced by 2.6 times. It can be found that Tb{sup 3+} ions play a role of storing the energy or transfer bridge from Bi{sup 3+}→ Sm{sup 3+} by investigating the Ca{sub 2}Al{sub 2}SiO{sub 7}:Bi{sup 3+}, Tb{sup 3+} and Ca{sub 2}Al{sub 2}SiO{sub 7}:Tb{sup 3+}, Sm{sup 3+} energy transfer mechanism. All these results suggest that terbium branch mechanism plays an important role on enhancing activators luminescence intensity.
Structure of smAKAP and its regulation by PKA-mediated phosphorylation
Burgers, Pepijn P.; Bruystens, Jessica; Burnley, Rebecca J.; Nikolaev, Viacheslav O.; Keshwani, Malik; Wu, Jian; Janssen, Bert J. C.; Taylor, Susan S.; Heck, Albert J. R.; Scholten, Arjen
2016-01-01
The A-kinase anchoring protein (AKAP) smAKAP has three extraordinary features; it is very small, it is anchored directly to membranes by acyl motifs, and it interacts almost exclusively with the type I regulatory subunits (RI) of cAMP-dependent kinase (PKA). Here, we determined the crystal structure of smAKAP’s A-kinase binding domain (smAKAP-AKB) in complex with the dimerization/docking (D/D) domain of RIα which reveals an extended hydrophobic interface with unique interaction pockets that drive smAKAP’s high specificity for RI subunits. We also identify a conserved PKA phosphorylation site at Ser66 in the AKB domain which we predict would cause steric clashes and disrupt binding. This correlates with in vivo colocalization and fluorescence polarization studies, where Ser66 AKB phosphorylation ablates RI binding. Hydrogen/deuterium exchange studies confirm that the AKB helix is accessible and dynamic. Furthermore, full-length smAKAP as well as the unbound AKB is predicted to contain a break at the phosphorylation site, and circular dichroism measurements confirm that the AKB domain loses its helicity following phosphorylation. As the active site of PKA’s catalytic subunit does not accommodate α-helices, we predict that the inherent flexibility of the AKB domain enables its phosphorylation by PKA. This represents a novel mechanism, whereby activation of anchored PKA can terminate its binding to smAKAP affecting the regulation of localized cAMP signaling events. PMID:27028580
Ganjo, A.R. (Aryann R.); D.M. Maghdid (Delshad); Mansoor, I.Y. (Isam Y.); Kok, D.J. (Dik J.); J.A. Severin (Juliëtte); H.A. Verbrugh (Henri); D. Kreft; Fatah, M.H.; Alnakshabandi, A.A.; Dlnya, A. (Asad); Hammerum, A.M. (Anette M.); Ng, K. (Kim); W.H.F. Goessens (Wil)
2016-01-01
markdownabstractIn addition to intrinsic resistance in Acinetobacter baumannii, many different types of acquired resistance mechanisms have been reported, including the presence of VIM and IMP metallo β-lactamases and also of blaOXA-23-like and blaOXA-58-like enzymes. In the Kurdistan region of
Hydrogen stability of SmCo5 permanent magnet
International Nuclear Information System (INIS)
Lukin, A.; Rabinovich, Y.; Bala, H.
2001-01-01
The present work has been performed with purpose to determine the level of hydrogen stability of sintered SmCo 5 permanent magnets by means of accelerated tests, to study the effect of hydrogen on the magnetic and mechanical properties of the permanent magnets and to establish the criteria of hydrogenation level and the activation energy of this process. In addition, the effect of hydrogen on the properties of sintered SmCo 5 permanent magnets in specific conditions of exploitation and storage durability of instruments was studied
Sun, Xiaoyu; Liu, Bin; Chen, Yan; Huang, Honglan; Wang, Guoqing; Li, Fan; Ni, Zhaohui
2016-12-01
The prevalence of various Ambler class A to D β-lactamases, ISAba1, and class 1 and 2 integrons as well as the clonal relatedness in 105 Acinetobacter spp. isolates found in northeastern China was investigated. All 105 Acinetobacter spp. isolates were determined to be multidrug resistant (MDR), and the resistance rates to carbapenem agents were approximately 50%. PER, IMP, AmpC, and OXA-23 were found to be dominant β-lactamases belonging to different classes, respectively. This is the first report of the coexistence of bla PER , bla IMP , bla AmpC , and bla OXA-23-like genes in Acinetobacter spp. isolates from northeastern China. ISAba1 was found upstream of the bla OXA-23-like gene in 87.8% (36/41) strains and upstream of the bla OXA-51-like gene in 26.5% (13/49) strains. ISAba3-like element was found upstream of the bla OXA-58-like gene in one bla OXA-58-like -positive strain. The presence of IntI1 was detected in 63.8% (67/105) of the isolates and the most prevalent gene cassettes were aacA4, aadA1, and catB8. The highly prevalent isolates belong to international clonal lineage (ICL)-II. These results indicate that the wide horizontal and clonal spread of MDR Acinetobacter spp. isolates harbouring multiple β-lactamase genes has become a serious problem in northeastern China.
Simplified syntheses of the water-soluble chiral shift reagents Sm-(R)-pdta and Sm-(S)-pdta
Czech Academy of Sciences Publication Activity Database
Hrubá, L.; Buděšínský, Miloš; Pícha, Jan; Jiráček, Jiří; Vaněk, Václav
2013-01-01
Roč. 54, č. 47 (2013), s. 6296-6297 ISSN 0040-4039 Institutional support: RVO:61388963 Keywords : NMR * chiral shift reagents * Sm-pdta * PDTA * samarium * 1,2-diaminopropane Subject RIV: CC - Organic Chemistry Impact factor: 2.391, year: 2013
Standard enthalpy of formation of Sm6UO12 acid dissolution calorimetry
International Nuclear Information System (INIS)
Venkata Krishnan, R.; Jogeswararao, G.; Ananthasivan, K.
2016-01-01
The standard molar enthalpies of formation of Δ f (298 K) of Sm 6 UO 12 have been determined by using an indigenously developed isoperibol acid solution calorimeter. The water equivalent of this calorimeter was determined by electrical calibration. The accuracy of measurement were determined by using standard materials KCl and tris(hydroxyl methyl) amino-methane (TRIS) and was found to be within ±2%. The enthalpies of solution at 298 K of Sm 2 O 3 , UO 3 and Sm 6 UO 12 were measured by using this calorimeter. From these experimental results the enthalpies of formation of Sm 6 UO 12 at 298 K were computed by using Hess's law of summation. (author)
Raharimalala, Fara Nantenaina; Boukraa, S; Bawin, T; Boyer, S; Francis, F
2016-04-01
Actually, the use of symbiotic bacteria is one of alternative solution to avoid vector resistance to pesticides. In Belgium, among 31 identified mosquito species, 10 were considered as potential vectors. Given to introduction risks of arbovirosis, the purpose of this study was to investigate the presence of symbiosis bacteria in potential mosquito vectors. Eleven species caught from 12 sites in Belgium were used: Culex pipiens s.l., Culex torrentium, Culex hortensis, Anopheles claviger, Anopheles maculipennis s.l., Anopheles plumbeus, Culiseta annulata, Ochlerotatus geniculatus, Ochlerotatus dorsalis, Aedes albopictus, and Coquillettidia richiardii. Six genera of symbiotic bacteria were screened: Wolbachia sp., Comamonas sp, Delftia sp., Pseudomonas sp., Acinetobacter sp., and Asaia sp. A total of 173 mosquito individuals (144 larvae and 29 adults) were used for the polymerase chain reaction screening. Wolbachia was not found in any Anopheles species nor Cx. torrentium. A total absence of Comamonas and Delftia was observed in all species. Acinetobacter, Pseudomonas, and Asaia were found in most of species with a high prevalence for Pseudomonas. These results were discussed to develop potential strategy and exploit the variable occurrence of symbiotic bacteria to focus on them to propose biological ways of mosquito control.
Sm-Nd and Ar-Ar Studies of DHO 908 and 489: Implications for Lunar Crustal History
Nyquist, L. E.; Shih, C. Y.; Reese, Y. D.; Park, J.; Bogard, D. D.; Garrison, D. H.; Yamaguchi, A.
2011-01-01
It is widely assumed that ferroan anorthosites (FANs) formed as flotation cumulates on a global lunar magma ocean (LMO). A corollary is that all FANs are approximately contemporaneous and formed with the same initial Nd-143/Nd-144 ratio. Indeed, a whole rock isochron for selected FANs (and An93 anorthosite) yields an isochron age of 4.42 +/- 0.13 Ga and initial Nd-143/Nd-144, expressed in epsilon-units, of epsilon(sub Nd,CHUR) = 0.3+/-0.3 relative to the CHondritic Uniform Reservoir , or epsilon(sub Nd,HEDPB)=-0.6+/-0.3 relative to the HED Parent Body. These values are in good agreement with the age (T) = 4.47+/-0.07 Ga, and epsilon(sub Nd,HEDPB) =-0.6 +/- 0.5 for FAN 67075. We also have studied anorthositic clasts in the Dhofar 908 and 489 lunar highland meteorites containing clasts of magnesian anorthosites (MAN) with Mg# approximately 75. Because of their relatively high Mg#, magnesian anorthosites should have preceded most FANs in crystallization from the LMO if both are LMO products. Thus, it is important to determine whether the Nd-isotopic data of MAN and FAN are consistent with a co-magmatic origin. We previously reported Sm-Nd data for white clast Dho 908 WC. Mafic minerals in this clast were too small to be physically separated for an isochron. However, we estimated initial Nd-143/Nd-144 for the clast by combining its bulk ("whole rock") Sm-Nd data with an Ar-39-Ar-40 age of 4.42+/-.04 Ga. Here we report additional Sm-Nd data for bulk samples of Dho 908 and its pair Dho 489.
Enhanced protective efficacy of a chimeric form of the schistosomiasis vaccine antigen Sm-TSP-2.
Directory of Open Access Journals (Sweden)
Mark S Pearson
Full Text Available The large extracellular loop of the Schistosoma mansoni tetraspanin, Sm-TSP-2, when fused to a thioredoxin partner and formulated with Freund's adjuvants, has been shown to be an efficacious vaccine against murine schistosomiasis. Moreover, Sm-TSP-2 is uniquely recognised by IgG(1 and IgG(3 from putatively resistant individuals resident in S. mansoni endemic areas in Brazil. In the present study, we expressed Sm-TSP-2 at high yield and in soluble form in E. coli without the need for a solubility enhancing fusion partner. We also expressed in E. coli a chimera called Sm-TSP-2/5B, which consisted of Sm-TSP-2 fused to the immunogenic 5B region of the hookworm aspartic protease and vaccine antigen, Na-APR-1. Sm-TSP-2 formulated with alum/CpG showed significant reductions in adult worm and liver egg burdens in two separate murine schistosomiasis challenge studies. Sm-TSP-2/5B afforded significantly greater protection than Sm-TSP-2 alone when both antigens were formulated with alum/CpG. The enhanced protection obtained with the chimeric fusion protein was associated with increased production of anti-Sm-TSP-2 antibodies and IL-4, IL-10 and IFN-γ from spleen cells of vaccinated animals. Sera from 666 individuals from Brazil who were infected with S. mansoni were screened for potentially deleterious IgE responses to Sm-TSP-2. Anti-Sm-TSP-2 IgE to this protein was not detected (also shown previously for Na-APR-1, suggesting that the chimeric antigen Sm-TSP-2/5B could be used to safely and effectively vaccinate people in areas where schistosomes and hookworms are endemic.
Djordjevic, Z M; Folic, M M; Jankovic, S M
2017-10-01
Regular surveillance of antimicrobial resistance is an important component of multifaceted interventions directed at the problem with resistance of bacteria causing healthcare-associated infections (HAIs) in intensive care units (ICUs). Our aim was to analyse antimicrobial consumption and resistance among isolates of Pseudomonas aeruginosa and Acinetobacter spp. causing HAIs, before and after the introduction of mandatory reporting of resistance patterns to prescribers. A retrospective observational study was conducted between January 2011 and December 2015, at an interdisciplinary ICU of the Clinical Centre Kragujevac, Serbia. The intervention consisted of continuous resistance monitoring of all bacterial isolates from ICU patients and biannual reporting of results per isolate to prescribers across the hospital. Both utilization of antibiotics and density of resistant isolates of P. aeruginosa and Acinetobacter spp. were followed within the ICU. Resistance densities of P. aeruginosa to all tested antimicrobials were lower in 2015, in comparison with 2011. Although isolates of Acinetobacter spp. had lower resistance density in 2015 than in 2011 to the majority of investigated antibiotics, a statistically significant decrease was noted only for piperacillin/tazobactam. Statistically significant decreasing trends of consumption were recorded for third-generation cephalosporins, aminoglycosides and fluoroquinolones, whereas for the piperacillin/tazobactam, ampicillin/sulbactam and carbapenems, utilization trends were decreasing, but without statistical significance. In the same period, increasing trends of consumption were observed for tigecycline and colistin. Regular monitoring of resistance of bacterial isolates in ICUs and reporting of summary results to prescribers may lead to a significant decrease in utilization of some antibiotics and slow restoration of P. aeruginosa and Acinetobacter spp. susceptibility. © 2017 John Wiley & Sons Ltd.
Brillouin spectroscopy with surface acoustic waves on intermediate valent, doped SmS
International Nuclear Information System (INIS)
Schaerer, U.; Jung, A.; Wachter, P.
1998-01-01
Brillouin scattering on surface acoustic waves is a very powerful tool to determine the elastic constants of intermediate valent crystals, since the method is non-destructive and no mechanical contact is needed. A strong evidence for intermediate valence is a negative value of Poisson's ratio, which describes the behavior of the volume under uniaxial pressure. SmS by itself makes a semiconductor-metal transition at a pressure of more than 6.5 kbar. When substituting the divalent Sm by a trivalent cation, like Y, La or Tm, SmS can become - depending on the doping concentration - intermediate valent without any applied, external pressure. In this work, we will present measurements of the velocities of the surface acoustic waves and the calculation of the elastic constants of La- and Tm-doped SmS compounds. We found a clear dependence of Poisson's ratio on the doping concentration and on the valence of the materials. Furthermore, we will discuss the mechanism leading to intermediate valence when substituting Sm. Besides the internal, chemical pressure, which is produced by the built in trivalent cations with their smaller ionic radii, we have clear evidence, that the free electrons in the 5d band, induced by the substituting atoms, also play an important role in making doped SmS intermediate valent. (orig.)
Isolated centres versus defect associates in Sm3+-doped CeO2: a spectroscopic investigation
International Nuclear Information System (INIS)
Tiseanu, Carmen; Avram, Daniel; Cojocaru, Bogdan; Parvulescu, Vasile I; Vela-Gonzalez, Andrea V; Sanchez-Dominguez, Margarita
2013-01-01
The interactions between Sm 3+ and oxygen vacancies in CeO 2 are probed by the use of tuneable laser excited time-resolved photoluminescence and Raman spectroscopies. It is found that Sm 3+ (with doping concentrations of 0.1, 0.3, 1 and 5 wt%) substitutes largely for Ce 4+ in sites with cubic symmetry and the corresponding emission is sensitized via the Ce 4+ –O 2− charge-transfer band of CeO 2 . It is established from the photoluminescence spectra measured at long delay after the laser pulse that the local environment around cubic Sm 3+ centres is not changed with concentration and ceria size. In addition to cubic symmetry Sm 3+ centres, low-symmetry Sm 3+ centres tentatively assigned to the Sm 3+ –oxygen vacancy associates of nearest-neighbour type are also observed. Their emission is preferentially excited via the weak f–f absorption transitions of Sm 3+ . A relatively strong concentration-induced quenching of Sm 3+ emission was inferred from the decrease in the average emission lifetimes from 2.1 ms (0.1 wt%) to 0.87 ms (5 wt%). The local environments of Sm 3+ and Eu 3+ in CeO 2 are also compared on the basis of their emission spectra and decays. (paper)
Directory of Open Access Journals (Sweden)
Weimei Ou
Full Text Available The study aimed to investigate the prevalence and epidemiological characteristics of blaNDM-1 (encoding New Delhi metallo-β-lactamase 1 in Enterobacteriaceae and the Acinetobacter calcoaceticus-Acinetobacter baumannii complex (ABC in China from July 2011 to June 2012.PCR was used to screen for the presence of blaNDM-1 in all organisms studied. For blaNDM-1-positive strains, 16S rRNA analysis and Analytical Profile Index (API strips were used to identify the bacterial genus and species. The ABCs were reconfirmed by PCR detection of blaOXA-51-like. Antibiotic susceptibilities of the bacteria were assessed by determining minimum inhibitory concentration (MIC of them using two-fold agar dilution test, as recommended by the Clinical and Laboratory Standards Institute (CLSI. Molecular typing was performed using pulsed-field gel electrophoresis (PFGE. S1 nuclease-pulsed-field gel electrophoresis (S1-PFGE and Southern blot hybridization were conducted to ascertain the gene location of blaNDM-1. Conjugation experiments were conducted to determine the transmission of blaNDM-1-positive strains.Among 2,170 Enterobacteriaceae and 600 ABCs, seven Enterobacteriaceae strains and two A. calcoaceticus isolates from five different cities carried the blaNDM-1 gene. The seven Enterobacteriaceae strains comprised four Klebsiella pneumoniae, one Enterobacter cloacae, one Enterobacter aerogen and one Citrobacter freundii. All seven were non-susceptible to imipenem, meropenem or ertapenem. Two A. calcoaceticus species were resistant to imipenem and meropenem. Three K. pneumoniae showed the same PFGE profiles. The blaNDM-1 genes of eight strains were localized on plasmids, while one was chromosomal.Compared with previous reports, the numbers and species containing the blaNDM-1 in Enterobacteriaceae have significantly increased in China. Most of them are able to disseminate the gene, which is cause for concern. Consecutive surveillance should be implemented and should
Directory of Open Access Journals (Sweden)
Elkin V Lemos
2011-10-01
Full Text Available OBJETIVO: Comparar la mortalidad en pacientes infectados por Acinetobacter baumannii multisensibles con pacientes infectados por A. baumannii multirresistentes hospitalizados en unidades de cuidados intensivos (UCI de Colombia. MÉTODOS: Estudio prospectivo, observacional y multicéntrico. Se incluyó a 165 pacientes ingresados en las UCIs participantes entre abril de 2006 y abril de 2010. Se comparó la mortalidad de los pacientes con aislamientos clínicos de A. baumannii multirresistentes frente a aquellos multisensibles al día 14 y 30 de hospitalización. RESULTADOS: De los 165 pacientes adultos que presentaron infecciones asociadas al cuidado en salud (IACS por A. baumannii, en 62 se encontraron bacterias multisensibles y en 103, multirresistentes. No se hallaron diferencias estadísticamente significativas en la mortalidad al día 14 de hospitalización en UCI. Sí se observaron en cambio diferencias significativas (P OBJECTIVE: Compare mortality in multidrug-susceptible Acinetobacter baumannii infected patients and multidrug-resistant A. baumannii-infected patients hospitalized in intensive care units (ICUs in Colombia. METHODS: A prospective, observational, and multicenter study. A total of 165 patients admitted to the participating ICUs from April 2006 to April 2010 were included. On day 14 and day 30 of hospitalization, mortality in multidrug-resistant patients with clinical isolates of A. baumannii was compared with that in multidrug-susceptible patients. RESULTS: Of the 165 adult patients who had health care-associated infections (HAI caused by A. baumannii, multidrug-susceptible bacteria were found in 62 patients and multidrug-resistant bacteria in 103. Statistically significant differences in mortality on day 14 of hospitalization in the ICU were not found. On the other hand, significant differences (P < 0.05 in mortality on day 30 of hospitalization were observed between patients with multidrug-resistant isolates and those with
Directory of Open Access Journals (Sweden)
Venous Akhavan
2016-09-01
Full Text Available Because of inappropriate use of antibiotics and prevalence of resistant bacteria, there is urgent need for antibacterial drugs that have fewer side effects than antibiotics. Myrtus communis is a medicinal plant which had many uses in traditional medicine. In this study, ethanol leave extract of this plant is tested on Acinetobacter baumannii. In the case of antimicrobial evaluation of plants, one of the effecting factors on effectiveness of the microbial inhibition is extraction techniques. In the presents study, the antibacterial activity of the Ethanol, Methanol, and Ethyl acetate extracts of M. communis plant was evaluated at seven different concentrations by broth microdilution method. The results of this study showed that the antimicrobial effect of M. communis extract is concentration dependent. Different extracts were obtained by the maceration method. Extracts of the plant exhibited antibacterial activity at varied levels against A. baumannii. Obtained results from our antibacterial experiments showed that all extracts have anti-bacterial activity against tested bacterial isolates According to the results, the ethyl acetate extracted fraction showed the highest level of activity at a MIC 400 mg/ml for A. baumannii. The results of this study indicate that, different extracts had growth inhibitory effect on A. baumannii. Therefore this plant has the potential to be evaluated as an alternative or adjunct to antibiotics to treat Acinetobacter infections.
Chilean experience in production of therapeutic radiopharmaceuticals labelled with 153Sm and 166Ho
International Nuclear Information System (INIS)
Chandia, M.; Gil, M.G.; Tomicic, M.; Araya, G.; Olea, E.; Chong, G.
1998-01-01
153 Samarium ( 153 Sm) and 166 Holmium ( 166 Ho) were produced at the Nuclear Center of La Reina Research Reactor, Chilean Nuclear Energy Commission. 153 Sm-EDTMP (Ethylenediaminetetramethylene Phosphonate) used for clinical trial of therapy for painful skeletal metastases and labeled particles such as 166 Ho-FHMA (ferric hydroxide macroagregattes) and 153 Sm-HAP (hydroxiapatite particles) used for radiation synevectomy, were labeled. Radionuclide purity of both radionuclides was analyzed by gamma spectrometry using a multichannel gamma spectrometer. Radiochemical labeled reaction parameters of 153 Sm-EDTMP such as: Sm/EDTMP molar ratio, 153 Sm specific activity, labeled pH and temperature, were determined in order to get high radiolabeling yields. Radiochemical Quality Controls of 153 Sm-EDTMP using different chromatographic systems were carried out in order to determine labeling yields. Bodistribution studies were achieved in mice by dissection of animals and by autoradiography of histological slices in rats, after 2h post injection. 153 Sm-HAP and 166 Ho-FHMA labeled particles were prepared using the methods described. Radiochemical purity, in case of radiolabeled particles was carried out by centrifugation, measuring activity in the supernatant and in particles pellet. Physical parameters, such as particle size and range of the radiopharmaceuticals based on particles labeling were evaluated in order to determine the ideal conditions to obtain particles size range between 10 - 40μ. In vitro labeling stability for over seven days and wash out activity by incubation in human synovial fluid after 6 and 24h post labeling, was also studied. 153 Sm-EDTMP was easily labeled with a Radiochemical purity over 99.5% and stable for over 7 days. Biodistribution studies in mice give more than 50% of ID uptake in bone and less than 0,1% in liver this was correlated by autoradiographic image. 153 Sm-HAP and 166 Ho-FHMA were also labeling obtaining radiochemical purity over 95
Czech Academy of Sciences Publication Activity Database
Sun, J.L.; Huang, Y.B.; Cheng, L.; Yao, X.; Lai, Y.J.; Jirsa, Miloš
2009-01-01
Roč. 9, č. 2 (2009), 898-902 ISSN 1528-7483 R&D Projects: GA ČR GA202/08/0722 Institutional research plan: CEZ:AV0Z10100520 Keywords : high-temperature optical microscopy * growth and orientation of Sm-Ba-Cu-O phases * Sm-211 whisker substrate Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.162, year: 2009
Wang, Xia; Chen, Yong; Zhao, Wei; Wang, Yan; Song, Qing; Liu, Hui; Zhao, Jingya; Han, Xuelin; Hu, Xiaohua; Grundmann, Hajo; Xiao, Yanni; Han, Li
2015-01-01
Major challenges remain when attempting to quantify and evaluate the impacts of contaminated environments and heterogeneity in the cohorting of health care workers (HCWs) on hospital infections. Data on the detection rate of multidrug-resistant Acinetobacter baumannii (MRAB) in a Chinese intensive
Coercive force changes in Sm(CoFeCuZr)z during step-like heat treatments
International Nuclear Information System (INIS)
Puzanova, T.Z.; Shchegoleva, N.N.; Sakhnova, L.V.; Majkov, V.G.; Shur, Ya.S.; Nikolaeva, N.V.
1987-01-01
Sm(Co 0.67 Fe 0.22 Cu 0.08 Zr 0.03 ) 8.35 alloy, contaning two homogeneous solid solutions SmM 6.85 and SmM 7.75 (M=Co, Fe, Cu, Zr) after high-temperature treatment, is investigated. It is shown, that after isothermal tempering at 800 deg C, SmM 6.85 and SmM 7.75 are close by microstructure and their coercive forces change in a different way during step-like cooling within 700-400 deg C interval. Possibility of producing material, single-phase in magnetic relation, is discussed
Akça, Gülin
2015-01-01
Hospitals are the places where, either the patients or other health workers can encounter with dangerous problem of several bacterial, fungal, viral, parasitic infectious agents, especially the emerging and life threatening ones such as, methicillin-resistant Staphylococcus aureus (MRSA), vancomycin resistant Enterococcus faecalis (VRE), Stenotrophomonas sp., and multi drug resistant Acinetobacter sp., Pseudomonas sp.. The reasons of these resistant microorganisms that can threaten the life o...
Energy Technology Data Exchange (ETDEWEB)
Silva, Marcia Augusta da
2001-07-01
The {sup 153}Sm-EDTMP is a radiopharmaceutical used in nuclear medicine with promising results for the relief of metastatic pain. Therefore, there are few knowledge about the effects of {sup 153}Sm-EDTMP at cellular level. The present study was conduced with the aim of evaluating the cytogenetic effects of {sup 153}Sm-EDTMP in peripheral lymphocytes from patients with bone metastasis (with and without previous radio and/or chemotherapy) by the chromosome aberration technique, either in vivo or in vitro. For that, the blood samples were collected before and one hour after the endovenous administration of {sup 153}Sm-EDTMP (mean activity of 42.53+/-5.31 MBq/kg body weight), taking into account the rapid blood clearance. The principal types of structural chromosome aberrations found gaps and breaks, acentric fragments centric rings, double minutes and dicentrics. The statistical analysis showed that the group submitted to previous radio and chemotherapy before {sup 153}Sm-EDTMP administration showed significant difference in chromosome aberrations frequency one hour after the treatment. The analysis of the chromosome modal number and the kinetics of cellular cycle showed no statistical difference among the groups, suggesting that the treatment with {sup 153}Sm-EDTMP, did not influence these parameters. The carrier molecule, EDTMP, did not influence the induction of chromosome aberration. In relation to the in vitro assays, the obtained data of peripheral lymphocytes of healthy donors and patients with no previous treatment exposed to different radioactive concentration of {sup 153}Sm-EDTMP (0.046 - 1.110 MBq/mL) were better adjusted by linear regression model (Y=A+BX). The chromosome damage induced by {sup 153}Sm-EDTMP observed in vitro was about 2 fold higher than that found in vivo for the group of patients with no previous treatment. The obtained data showed that the therapy with {sup 153}Sm-EDTMP induced a few quantity of cytogenetic damages in peripheral
Directory of Open Access Journals (Sweden)
Marion Morel
Full Text Available Venus kinase receptors (VKRs are invertebrate receptor tyrosine kinases (RTKs formed by an extracellular Venus Fly Trap (VFT ligand binding domain associated via a transmembrane domain with an intracellular tyrosine kinase (TK domain. Schistosoma mansoni VKRs, SmVKR1 and SmVKR2, are both implicated in reproductive activities of the parasite. In this work, we show that the SH2 domain-containing protein SmShb is a partner of the phosphorylated form of SmVKR1. Expression of these proteins in Xenopus oocytes allowed us to demonstrate that the SH2 domain of SmShb interacts with the phosphotyrosine residue (pY979 located in the juxtamembrane region of SmVKR1. This interaction leads to phosphorylation of SmShb on tyrosines and promotes SmVKR1 signaling towards the JNK pathway. SmShb transcripts are expressed in all parasite stages and they were found in ovary and testes of adult worms, suggesting a possible colocalization of SmShb and SmVKR1 proteins. Silencing of SmShb in adult S. mansoni resulted in an accumulation of mature sperm in testes, indicating a possible role of SmShb in gametogenesis.
Morel, Marion; Vanderstraete, Mathieu; Cailliau, Katia; Hahnel, Steffen; Grevelding, Christoph G; Dissous, Colette
2016-01-01
Venus kinase receptors (VKRs) are invertebrate receptor tyrosine kinases (RTKs) formed by an extracellular Venus Fly Trap (VFT) ligand binding domain associated via a transmembrane domain with an intracellular tyrosine kinase (TK) domain. Schistosoma mansoni VKRs, SmVKR1 and SmVKR2, are both implicated in reproductive activities of the parasite. In this work, we show that the SH2 domain-containing protein SmShb is a partner of the phosphorylated form of SmVKR1. Expression of these proteins in Xenopus oocytes allowed us to demonstrate that the SH2 domain of SmShb interacts with the phosphotyrosine residue (pY979) located in the juxtamembrane region of SmVKR1. This interaction leads to phosphorylation of SmShb on tyrosines and promotes SmVKR1 signaling towards the JNK pathway. SmShb transcripts are expressed in all parasite stages and they were found in ovary and testes of adult worms, suggesting a possible colocalization of SmShb and SmVKR1 proteins. Silencing of SmShb in adult S. mansoni resulted in an accumulation of mature sperm in testes, indicating a possible role of SmShb in gametogenesis.
Directory of Open Access Journals (Sweden)
Mohsen S. Asker
2011-04-01
Full Text Available Four new complexes [V(NTA(H2O 2]H2O (1, H[Sn(NTA] (2, H[Sm(NTA]H2O (3, and [Sm(NTA(H2O 2]H2O (4 were obtained during the reactions of metal salts (VCl3, SnCl22H2O, SnCl4, Sm(NO326H2O and SmCl36H2O with nitrilotriacetic acid, H3NTA. The infrared and 1H-NMR spectra of the solid complexes have been obtained and assigned. Thermogravimetric analyses were also carried out. The data obtained agree with the proposed structures and show that the complexes decomposed to the corresponding metal oxide. The ligand and their metal complexes were screened for their antimicrobial activities by the agar-well diffusion technique using DMSO as a solvent against the following bacterial species: Bacillus subtilis, Staphylococcus aureus, Escherichia coli and Pseudomonas aeruginosa and antifungal activity against Aspergillus niger, Aspergillus flavus, Saccharomyces cerevisiae and Candida albicans. The obtained results were compared with some types of known antibiotics. The minimum inhibitory concentration (MIC values were calculated at 30 °C for 24−48 h. The activity data show that the complexes are more potent antimicrobials than the parent ligand.
Luminescence and energy transfer of Sm3+ and Eu3+ in Ca2PO4Cl
International Nuclear Information System (INIS)
Wang, Zhijun; Li, Panlai; Yang, Zhiping; Guo, Qinglin
2014-01-01
Sm 3+ , Eu 3+ , and Sm 3+ –Eu 3+ doped Ca 2 PO 4 Cl phosphors are synthesized by a solid-state method. Ca 2 PO 4 Cl:Sm 3+ can produce red emission under the 400 nm radiation excitation, and the emission peak is located at 601 nm, which is assigned to the 4 G 5/2 → 6 H 7/2 transition of Sm 3+ . Ca 2 PO 4 Cl:Eu 3+ can create red emission under the 392 nm radiation excitation, and the strongest peak is located at 620 nm, which is attributed to the 5 D 0 → 7 F 2 transition of Eu 3+ . The energy transfer from Sm 3+ to Eu 3+ in Ca 2 PO 4 Cl has been validated and the critical distance (R c ) of Sm 3+ to Eu 3+ in Ca 2 PO 4 Cl is calculated to be 1.14 nm. With increasing Eu 3+ doping concentration, the energy transfer efficiency (Sm 3+ →Eu 3+ ) gradually increases to 53.7%. The luminescence property of Ca 2 PO 4 Cl:Sm 3+ , Eu 3+ can be tuned by properly tuning the relative ratio of Sm 3+ –Eu 3+ , and the emission intensity of Ca 2 PO 4 Cl:Eu 3+ can be greatly enhanced by codoped Sm 3+ . - Highlights: • Ca 2 PO 4 Cl:Sm 3+ , Eu 3+ can produce red emission under the 400 nm radiation excitation. • The energy transfer from Sm 3+ to Eu 3+ in Ca 2 PO 4 Cl has been validated. • The critical distance of Sm 3+ to Eu 3+ in Ca 2 PO 4 Cl is calculated to be 1.14 nm
NCBI nr-aa BLAST: CBRC-GGAL-04-0044 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-04-0044 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic
Synthesis and DNA interaction of a Sm(III) complex of a Schiff base ...
African Journals Online (AJOL)
The interaction between the Sm(III) complex of an ionic Schiff base [HL]-, derived from vanillin and L-tryptophan, and herring sperm DNA at physiological pH (7.40) has been studied by UV-Vis absorption, fluorescence and viscosity methods. The binding ratios nSm(III) : nK[HL] = 1:1 and nSm(III)L: nDNA =5:1 were confirmed ...
International Nuclear Information System (INIS)
Cambier, Linda; Pomies, Pascal
2011-01-01
Highlights: → The cytoskeleton-associated protein, smALP, is expressed in differentiated skeletal muscle. → smALP is translocated from the cytoplasm to the nucleus of C2C12 myoblasts upon induction of myogenesis. → The differentiation-dependent nuclear translocation of smALP occurs in parallel with the nuclear accumulation of myogenin. → The LIM domain of smALP is essential for the nuclear accumulation of the protein. → smALP might act in the nucleus to control some critical aspect of the muscle differentiation process. -- Abstract: The skALP isoform has been shown to play a critical role in actin organization and anchorage within the Z-discs of skeletal muscles, but no data is available on the function of the smALP isoform in skeletal muscle cells. Here, we show that upon induction of differentiation a nuclear translocation of smALP from the cytoplasm to the nucleus of C2C12 myoblasts, concomitant to an up-regulation of the protein expression, occurs in parallel with the nuclear accumulation of myogenin. Moreover, we demonstrate that the LIM domain of smALP is essential for the nuclear translocation of the protein.
2016-12-01
attack or Anti-Ship Cruise Missiles in flight. The SM-6 ERAM program is an evolutionary, capabilities based acquisition program that will use spiral ...Prior SAR Total O&S Estimates - Dec 2014 SAR 460.3 Programmatic/Planning Factors 0.0 Cost Estimating Methodology 0.0 Cost Data Update 0.0 Labor Rate
Influences of the amount of ligand on the biochemical properties of 153Sm-HEDTMP
International Nuclear Information System (INIS)
Yang Yuqing; Luo Shunzhong; Wang Guanquan; He Jiaheng; Pu Manfei; Bing Wenzeng
2002-01-01
The Effect of the amount of ligand HEDTMP on biochemical properties of 153 Sm-HEDTMP is studied. The biochemical properties include partition coefficient of 153 Sm-HEDTMP in n-octanol-water which is measured by shake-flask method, combination characteristic with BSA (bovine serum albumin) which is measured through precipitation by TCA (trichloroacetic acid) and adsorption characteristic on HA (hydroxyapatite) which is measured with the same method used in 153 Sm-EDTMP. It is found that, with the increasing in the amount of ligand, partition coefficient of 153 Sm-HEDTMP. It is found that, with the increase in the amount of ligand, partition coefficient of 153 Sm-HEDTMP in n-octanol-water decreases, so does combination percentage with BSA, but the adsorption percentage on HA shows a little and unremarkable decrease. Considering the relationships between these three biochemical properties and in vivo metabolism of 153 Sm-HEDTMP this study supports the view that an appropriate high amount of ligand should be applied in practical use
External exposure in radionuclide therapy with 153 Sm
Energy Technology Data Exchange (ETDEWEB)
Rezio, M.T.; Vieira, M.R. [Instituto Portugues Oncologia de Francisco Gentil, CROL, Lisboa (Portugal)
2006-07-01
Full text of publication follows: Aim: The radiopharmaceutical 153 Sm is an beta emitter used in metastatic bone pain palliation. The prescribed activity is 37 MBq/kg body weight.. The aim of this study is to measure the dose rate of the patients during 4 to 6 hours after 153 Sm - E.D.T.M.P. administration in order to prevent external exposure of nursing staff, family members and general public. Material and Methods: Twelve patients were treated with 153 Sm in our department. External exposure rates( {mu}Sv/h) at different times and at one meter were measured, with a Geiger-Muller detector. Results: The mean dose rate at one meter was 12 {mu}Sv/h, one hour after injection and 3{mu} Sv/h, 6 hours after injection. Conclusion: The policy in our department is to keep the patient in the hospital 4-6 h, due to the risk of contamination. Based on our results, the external exposure of the nursing staff, family members and the general public is very low, in agreement with other studies. (authors)
External exposure in radionuclide therapy with 153 Sm
International Nuclear Information System (INIS)
Rezio, M.T.; Vieira, M.R.
2006-01-01
Full text of publication follows: Aim: The radiopharmaceutical 153 Sm is an beta emitter used in metastatic bone pain palliation. The prescribed activity is 37 MBq/kg body weight.. The aim of this study is to measure the dose rate of the patients during 4 to 6 hours after 153 Sm - E.D.T.M.P. administration in order to prevent external exposure of nursing staff, family members and general public. Material and Methods: Twelve patients were treated with 153 Sm in our department. External exposure rates( μSv/h) at different times and at one meter were measured, with a Geiger-Muller detector. Results: The mean dose rate at one meter was 12 μSv/h, one hour after injection and 3μ Sv/h, 6 hours after injection. Conclusion: The policy in our department is to keep the patient in the hospital 4-6 h, due to the risk of contamination. Based on our results, the external exposure of the nursing staff, family members and the general public is very low, in agreement with other studies. (authors)
International Nuclear Information System (INIS)
Saiki, M.; Oliveira Lellis, L. de.
1988-07-01
This paper describes a method for trace analysis in high purity rare earth oxides. This method is an application of instrumental neutron activation analysis. The results of analysis obtained in La 2 O 3 , CeO 2 , Pr 6 O 11 Nd 2 O 3 , Sm 2 O 3 and Gd 2 O 3 produced at IPEN-CNEN/SP are presented. A detailed study of the possible interference found in the neutron activation of these materials is also made. The sensitivity of the method is determined for impurities not detected in each sample. (author) [pt
Directory of Open Access Journals (Sweden)
Simit H Kumar
2012-01-01
Full Text Available Introduction: The production of Metallo-β-lactamases (MBLs is one of the resistance mechanisms of Pseudomonas aeruginosa and Acinetobacter species. There is not much Indian data on the prevalence of MBLs in burns and surgical wards. Materials and Methods: A total of 145 non-duplicate isolates of carbapenem-resistant Pseudomonas aeruginosa and Acinetobacter species, isolated from pus/wound swabs and endotracheal secretions from burns and surgical wards, were tested for MBL production by modified ethylene diamine tetra acetic acid (EDTA disc synergy and double disc synergy tests. Results: Prevalence of MBLs was 26.9% by both the above tests. All MBL-positive isolates were multidrug resistant. Only 6.06% (2/33 P.aeruginosa and 16.67% (1/06 Acinetobacter species were susceptible to piperacillin-tazobactam and netilmycin, respectively. These patients had multiple risk factors like >8 days hospital stay, catheterization, IV lines, previous antibiotic use, mechanical ventilation, etc. Graft application and surgical intervention were significant risk factors in MBL-positive patients. Overall mortality in MBL-positive patients was 34.21%. Conclusion: Emergence of MBL-producing Pseudomonas aeruginosa and Acinetobacter species in this hospital is alarming, which reflect excessive use of carbapenems and at the same time, pose a therapeutic challenge to clinicians as well as to microbiologists. Therefore, a strict antibiotic policy and implementation of proper infection control practices will go a long way to prevent further spread of MBLs. Detection of MBLs should also become mandatory in all hospitals.
Lv, Yuguang; Shi, Qi; Jin, Yuling; Ren, Hengxin; Qin, Yushan; Wang, Bo; Song, Shanshan
2018-03-01
In this paper, the La3+-doped Sm3+ hydroxyapatite (La/Sm/HAP) complexes were prepared by a precipitation method. The sample was defined by IR spectra, fluorescence spectra and X ray diffraction analysis et al. The structure of complexes were discussed. The emission wavelength of heat treatment of Sm3+ do not change, but will affect the intensity of the peak Sm3+ luminescence properties and the occupy hydroxyapatite in the lattice Ca( II )and Ca( I ) loci with Sm3+ doped concentration and the proportion of the sintering temperature change and change: The nano hydroxyapatite complex of the La3+ doped samarium obtain the good fluorescence intensity, by La3+ doping content of Sm3+ were hydroxyapatite 6% (La3+, Sm3+ mole ratio) device. The complex of La3+ doped samarium HAP have Stable chemical property, fluorescence property and excellent biological activity. The ligand HAP absorbs energy or captures an electron-hole pair and then transfers it to the lanthanide ions. The catalytic activity influence of the La3+-doped Sm3+hydroxyapatite was discussed, the La/Sm/HAP had excellent antibacterial property, which used as potential biological antibacterial material.
Epidemiology of Multiresistant Acinetobacter Infections in Bulgaria
International Nuclear Information System (INIS)
Savov, E.; Borisova, M.; Michailova, G.
2007-01-01
Evolution of bacteria towards resistance to antimicrobial drugs, including these with multidrug resistance, is very important issue for hospital epidemiology in all over the world. There are many papers about an increasing number of Acinetobacter baumannii blood stream and other type of infections in patients at military medical facilities in the Iraq / Kuwait region and in Afghanistan during Operation Enduring Freedom /OEF /. It has now become also a one of the major cause of hospital acquired infections in Bulgaria which due to its remarkable propensity to rapidly acquire resistance determinants to a wide range of antimicrobial drugs. According to the data obtained in Bulgaria, it can be concluded that the majority of the A.baumannii isolates was strikingly resistant, including the 3rd generation of cephalosporins, quinolones and also carbapenems, in the last years. Different methods / phenotypical and molecular methods, including PCR/ for a multidrug A.baumannii investigation and its clonality determination are needed, especially when the strains are not epidemiological related.(author)
Three-loop SM beta-functions for matrix Yukawa couplings
Directory of Open Access Journals (Sweden)
A.V. Bednyakov
2014-10-01
Full Text Available We present the extension of our previous results for three-loop Yukawa coupling beta-functions to the case of complex Yukawa matrices describing the flavour structure of the SM. The calculation is carried out in the context of unbroken phase of the SM with the help of the MINCER program in a general linear gauge and cross-checked by means of MATAD/BAMBA codes. In addition, ambiguities in Yukawa matrix beta-functions are studied.
Optical imaging of the transport properties of S-Sm-S junctions
International Nuclear Information System (INIS)
Tsumura, K; Nomura, S; Akazaki, T; Takayanagi, H
2009-01-01
We study the optical effects on superconductor-normal metal superconductor (S-Sm-S) junctions composed of two-dimensional electron gas (2DEG) in a GaAs/AlGaAs heterostructure and NbN superconducting electrodes. When the whole junction area was illuminated at λ = 800 nm, we observe a reduction in the normal resistance due to an increase in the sheet carrier density of the 2DEG, and the enhancement of the Andreev reflection probability. To reveal its origin, we performed scanning photo-voltage measurement by employing an optical microscope. The obtained image plots show maxima and minima of the photo-voltage change along the S-Sm interfaces. Those structures are considered to reflect the modulation of the barrier height at S-Sm interface and the increase in the scattering by photo-generated carriers. It is demonstrated that the scanning photo-voltage measurement is one of the most powerful tools as a local probe of the transport properties of S-Sm-S junctions.
The direct limit on the Higgs Mass and the SM Fit
International Nuclear Information System (INIS)
Chanowitz, Michael S.
2003-01-01
Because of two 3σ anomalies, the Standard Model (SM) fit of the precision electroweak data has a poor confidence level, CL = 0.02. Since both anomalies involve challenging systematic issues, it might appear that the SM could still be valid if the anomalies resulted from underestimated systematic error. Indeed the CL of the global fit could then increase to 0.71, but that fit predicts a small Higgs boson mass, m H = 45 GeV, that is inconsistent at 95% CL with the lower limit, m H > 114 GeV, established by direct searches. The data then favor new physics whether the anomalous measurements are excluded from the fit or not, and the Higgs boson mass cannot be predicted until the new physics is understood. Some measure of statistical fluctuation would be needed to maintain the validity of the SM. New physics is favored, but the SM is not definitively excluded
Subcoulomb fusion of 16O in odd Sm isotopes
International Nuclear Information System (INIS)
Pacheco, A.J.
1989-01-01
Cross sections for the formation of evaporation residues were measured for the reaction of 16 O with the odd 147 Sm and 149 Sm nuclei at near barrier energies. The results are well described by statistical model calculations. Fusion cross sections as a function of energy do not show any unusual behaviour that could be attributed to the presence of unpaired nucleons. An analysis based on a one-dimensional penetration model that includes the effect of permanent quadrupolar deformations shows that the extracted values of the parameter β 2 follow the systematics established by the rest of the even samarium isotopes. The dependence of β 2 on the mass of the target nucleus indicates that the influence exerted by collective aspects upon the subbarrier fusion process increases rapidly as a function of the number of neutrons added to the spherical semimagic 144 Sm nucleus. (Author) [es
Energy Technology Data Exchange (ETDEWEB)
Bhatt, Ranu, E-mail: rbhatt@barc.gov.in; Schütz, G. [Max Planck Institute for Intelligent Systems (formerly Max Planck Institute for Metals Research), Heisenbergstr. 3, 70569 Stuttgart (Germany); Bhatt, Pramod [Solid State Physics Division, Bhabha Atomic Research Centre, Mumbai 400 085 (India)
2014-03-14
We have investigated the effect of annealing temperature on the microstructure and magnetic properties of Sm{sub 2}(CoCuFeZr){sub 17} films prepared using ion beam sputtering at room temperature. The as-deposited film shows randomly oriented polycrystalline grains and exhibits small coercivity (H{sub C}) of 0.04 T at room temperature. Post annealing of these films at 700 °C under Ar atmosphere shows significant changes in the microstructure transforming it to the development of cellular growth, concomitant with enhanced coercivity up to 1.3 T. The enhanced coercivity is explained using the domain wall pinning mechanism.
Sahoo, R K; Subudhi, E; Kumar, M
2014-06-01
Proliferation of the inoculated Pseudomonas sp. S1 is quantitatively evaluated using ERIC-PCR during the production of lipase in nonsterile solid state fermentation an approach to reduce the cost of enzyme production. Under nonsterile solid state fermentation with olive oil cake, Pseudomonas sp. S1 produced 57·9 IU g(-1) of lipase. DNA fingerprints of unknown bacterial isolates obtained on Bushnell Haas agar (BHA) + tributyrin exactly matched with that of Pseudomonas sp. S1. Using PCR-based enumeration, population of Pseudomonas sp. S1 was proliferated from 7·6 × 10(4) CFU g(-1) after 24 h to 4·6 × 10(8) CFU g(-1) after 96 h, which tallied with the maximum lipase activity as compared to control. Under submerged fermentation (SmF), Pseudomonas sp. S1 produced maximum lipase (49 IU ml(-1) ) using olive oil as substrate, while lipase production was 9·754 IU ml(-1) when Pseudomonas sp. S1 was grown on tributyrin. Optimum pH and temperature of the crude lipase was 7·0 and 50°C. Crude enzyme activity was 71·2% stable at 50°C for 360 min. Pseudomonas sp. S1 lipase was also stable in methanol showing 91·6% activity in the presence of 15% methanol, whereas 75·5 and 51·1% of activity were retained in the presence of 20 and 30% methanol, respectively. Thus, lipase produced by Pseudomonas sp. S1 is suitable for the production of biodiesel as well as treatment of oily waste water. This study presents the first report on the production of thermophilic organic solvent tolerant lipase using agro-industry waste in nonsterile solid state fermentation. Positive correlation between survival of Pseudomonas sp. S1 and lipase production under nonsterile solid state fermentation was established, which may emphasize the need to combine molecular tools and solid state fermentation in future studies. Our study brings new insights into the lipase production in cost-effective manner, which is an industrially relevant approach. © 2014 The Society for Applied Microbiology.
Modified chemical synthesis of porous α-Sm{sub 2}S{sub 3} thin films
Energy Technology Data Exchange (ETDEWEB)
Kumbhar, V.S.; Jagadale, A.D. [Thin Film Physics Laboratory, Department of Physics, Shivaji University, Kolhapur, (M.S.) 416004 (India); Gaikwad, N.S. [Rayat Shikshan Sanstha, Satara, (M.S.) 415 001 (India); Lokhande, C.D., E-mail: l_chandrakant@yahoo.com [Thin Film Physics Laboratory, Department of Physics, Shivaji University, Kolhapur, (M.S.) 416004 (India)
2014-08-15
Highlights: • A novel chemical route to prepare α-Sm{sub 2}S{sub 3} thin films. • A porous honeycomb like morphology of the α-Sm{sub 2}S{sub 3} thin film. • An application of α-Sm{sub 2}S{sub 3} thin film toward its supercapacitive behaviour. - Abstract: The paper reports synthesis of porous α-Sm{sub 2}S{sub 3} thin films using modified chemical synthesis, also known as successive ionic layer adsorption and reaction (SILAR) method. The X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), scanning electron microscopy (SEM), atomic force microscopy (AFM), wettability and ultraviolet–visible spectroscopy (UV–vis) techniques are used for the study of structural, elemental, morphological and optical properties of α-Sm{sub 2}S{sub 3} films. An orthorhombic crystal structure of α-Sm{sub 2}S{sub 3} is resulted from XRD study. The SEM and AFM observations showed highly porous α-Sm{sub 2}S{sub 3} film surface. An optical band gap of 2.50 eV is estimated from optical absorption spectrum. The porous α-Sm{sub 2}S{sub 3} thin film tuned for supercapacitive behaviour using cyclic voltammetry and galvanostatic charge discharge showed a specific capacitance and energy density of 294 Fg{sup –1} and 48.9 kW kg{sup –1}, respectively in 1 M LiClO{sub 4}–propylene carbonate electrolyte.
Formation of SmFe5(0001) ordered alloy thin films on Cu(111) single-crystal underlayers
International Nuclear Information System (INIS)
Yabuhara, Osamu; Ohtake, Mitsuru; Nukaga, Yuri; Futamoto, Masaaki; Kirino, Fumiyoshi
2010-01-01
SmFe 5 (0001) single-crystal thin films are prepared by molecular beam epitaxy employing Cu(111) single-crystal underlayers on MgO(111) substrates. The Cu atoms diffuse into the Sm-Fe layer and substitute the Fe sites in SmFe 5 structure forming an alloy compound of Sm(Fe,Cu) 5 . The Sm(Fe,Cu) 5 film is more Cu enriched with increasing the substrate temperature. The Cu underlayer plays an important role in assisting the formation of the ordered phase.
First measurement of 153Sm in the SIR
International Nuclear Information System (INIS)
Michotte, C.; Ratel, G.; Lucas, L.
1999-01-01
In June 1998, the NIST sent to the International Reference System (SIR) a solution of 153 Sm standardized in a 4π ionization chamber. As this radionuclide had not previously been measured in the SIR, the resulting equivalent activity A e,NIST is compared with the value calculated from the efficiency curve of the SIR. However, problems occurred owing to the presence of 154 Eu and 156 Eu impurities in the solution. The manner in which the final equivalent activity value for this solution of 153 Sm has been deduced is described in this report. (authors)
The neutron EDM in the SM: a review
International Nuclear Information System (INIS)
Dar, Shahida
2000-08-01
We review the status of the electric dipole moment (EDM) of neutron in the Standard Model (SM). The contributions of the strong and electroweak interactions are discussed separately. In each case the structure of Lagrangian and the sources of CP violation are specified, and subsequently calculational details are given. These two contributions to the neutron EDM exist in any extension of the SM including supersymmetry, two-doublet models as well as models with more than three generations of fermions. We briefly discuss the status of the neutron EDM in such extensions and give the relevant literature. (author)
Nutman, A; Lerner, A; Schwartz, D; Carmeli, Y
2016-11-01
We evaluated the sensitivity of surveillance cultures for carbapenem-resistant Acinetobacter baumannii (CRAB) in patients and in their environment. Patients with a CRAB-positive clinical culture were sampled within 7 days; the buccal mucosa and rectum were sampled using swabs, and skin was sampled using pre-moistened sterile sponges. Sponges were also used to sample the surrounding environment. Specimens were inoculated onto CHROMagar MDR Acinetobacter plates both directly and after overnight enrichment. CRAB load was scored semi-quantitatively and composite scores for patient colonization and environmental contamination were calculated. Thirty-four patients were included. Screening sensitivity was 28/34 (82%) for buccal mucosa, 30/34 (88%) for skin, and 25/34 (74%) for rectum. Combined sensitivity was 32/34 (94%). Among patients with CRAB-positive respiratory cultures, sensitivity for buccal mucosa was 20/20 (100%). Direct inoculation had excellent sensitivity: 25/28 (89%) for all three sites combined. In the subgroup of patients who did not have a respiratory source for CRAB, direct inoculation sensitivity was lower than among patients with CRAB-positive respiratory cultures: 5/8 (63%) versus 20/20 (100%). The environment of all patients was contaminated with CRAB. There was a positive correlation between the patient colonization score and the environmental contamination score (r = 0.63, p Environmental contamination is common and can be monitored. Implementing screening may facilitate infection control efforts to limit the spread of CRAB. Copyright © 2016 European Society of Clinical Microbiology and Infectious Diseases. Published by Elsevier Ltd. All rights reserved.
Explorando el plegamiento metallo-beta-lactamasa en el genoma de Acinetobacter baumanni
Rodríguez Calviño, Fabiola
2012-01-01
Acinetobacter baumannii fue considerado siempre como un patógeno de relativa baja virulencia, pero durante las dos últimas décadas, este microorganismo oportunista ha emergido como uno de los mayores problemas encarados por el sistema clínico en hospitales de todo el mundo. Como consecuencia inevitable de la presión selectiva impuesta por el uso abusivo de antibióticos en el tratamiento de infecciones, se han descrito cepas clínicas multirresistentes de A. baumannii, con una alta capacidad...
Directory of Open Access Journals (Sweden)
de Gouvêa Erika
2012-12-01
Full Text Available Abstract Background Infection with carbapenem-resistant Acinetobacter baumannii has been associated with high morbidity and mortality in solid organ transplant recipients. The main objective of this study was to assess the influence of carbapenem resistance and other potential risk factors on the outcome of A. baumannii infection after kidney and liver transplantation. Methods Retrospective study of a case series of A. baumannii infection among liver and renal transplant recipients. The primary outcome was death associated with A. baumannii infection. Multivariate logistic regression was used to assess the influence of carbapenem resistance and other covariates on the outcome. Results Forty-nine cases of A. baumannii infection affecting 24 kidney and 25 liver transplant recipients were studied. Eighteen cases (37% were caused by carbapenem-resistant isolates. There were 17 (35% deaths associated with A. baumannii infection. In unadjusted analysis, liver transplantation (p = 0.003, acquisition in intensive care unit (p = 0.001, extra-urinary site of infection (p A. baumannii infection. The number of deaths associated with A. baumannii infection was higher among patients infected with carbapenem-resistant isolates, but the difference was not significant (p = 0.28. In multivariate analysis, the risk of A. baumannii-associated mortality was higher in patients with infection acquired in the intensive care unit (odds ratio [OR] = 34.8, p = 0.01 and on mechanical ventilation (OR = 15.2, p = 0.04. Appropriate empiric antimicrobial therapy was associated with significantly lower mortality (OR = 0.04, p = 0.03, but carbapenem resistance had no impact on it (OR = 0.73, p = 0.70. Conclusion These findings suggest that A. baumannii-associated mortality among liver and kidney transplant recipients is influenced by baseline clinical severity and by the early start of appropriate therapy, but not by carbapenem
Sm-Nd isotope system of oldest granulites of Anabar Shield
International Nuclear Information System (INIS)
Spiridonov, V.G.; Sukhanov, M.K.; Karpenko, S.F.; Lyalikov, A.V.; AN SSSR, Moscow
1991-01-01
The first results of applying Sm-Nd method for dating the oldest basic and ultrabasic rocks of the Anabar Shield are presented. The content and isotopic composition of Sm and Nd were determined by the methods of mass-spectroscopy with isotopic dilution. The obtained values of metamorphic ages (3063 ± 80 million years) are in good agreement with U-Pb method data for zircon
Microstructure and corrosion resistance of Sm-containing Al-Mn-Si-Fe-Cu alloy
Directory of Open Access Journals (Sweden)
Han Yuyin
2017-12-01
Full Text Available Optimizing alloy composition is an effective way to improve physical and chemical properties of automobile heat exchanger materials.A Sm-containing Al-Mn-Si-Fe-Cu alloy was investigated through transmission electron microscopy,scanning electron microscopy,and electrochemical measurement.Experimental results indicated that main phases distributed in the alloy wereα-Al(Mn,FeSi,Al2Sm and Al10Cu7Sm2.Alloying with Sm element could refine the precipitated α-Al(Mn,FeSi phase.Polarization testing results indicated that the corrosion surfacewas mainly composed of pitting pits and corrosion products.Sea water acetic acid test(SWAAT showed that corrosion loss increased first and then slowed downwith increase of the corrosion time.