Experimental study on the drying of natural latex medical gloves
Chankrachang, Mano; Yongyingsakthavorn, Pisit; Tohsan, Atitaya; Nontakaew, Udomkiat
2018-01-01
The purpose of this research was to study latex film drying at 70 °C using a laboratory drying oven. Two different total solid content (TSC) latex compounds, which 45% TSC and 35% TSC were used. The undried latex films were prepared according to the common procedures used in latex gloves manufacturers, that is, by dry coagulant dipping process. The experimental results such as initial moisture content, the amount of moisture and drying time of latex films in each latex compound formula were determined. After that, the results were projected to calculate on the production capacity expand by 1 million piece/day of natural latex medical gloves. Finally, the rate of moisture entering the latex drying oven and the energy consumption of the drying oven were estimated. The results indicated that when the 35% TSC of latex compound was used. The initial moisture content of latex film was higher than 45% TSC of latex compound about 7%. The drying time of 35% TSC was longer than 45% TSC for 2.5 min and consume more energy about 10%. As a result, the 45% TSC latex compound was the better way to saving energy and managing humidity in the production line. Therefore, it was found to very useful to an approximate design length and size of actual of latex drying oven and the rate of moisture entering the oven as well.
Drying of latex films and coatings: Reconsidering the fundamental mechanisms
DEFF Research Database (Denmark)
Kiil, Søren
2006-01-01
The two existing theories describing drying of latex films or coatings are reconsidered. Subsequently, a novel mathematical drying model is presented, the simulations of which can match and explain experimental drying rate data of two previous investigations with latex films. In contrast to previ......The two existing theories describing drying of latex films or coatings are reconsidered. Subsequently, a novel mathematical drying model is presented, the simulations of which can match and explain experimental drying rate data of two previous investigations with latex films. In contrast...... to previous model studies, but in agreement with observations, simulations suggest that during the falling rate period of the drying process of a latex film, a porous skin of partly coalesced latex particles is indeed formed, which limits transport of water vapour from the receding air-liquid interphase...... to the surface of the film. The value of the effective diffusion coefficient of water vapour in the dry and partly coalesced layer (7 x 10(-7) m(2)/s at 19-24 degrees C), the adjustable parameter of the model for the falling rate period, was found to be independent of initial wet film thickness (89-1322 mu m...
Directory of Open Access Journals (Sweden)
Keslarek Amauri José
2004-01-01
Full Text Available Styrene-butyl acrylate-acrylic acid latex submonolayers prepared using a non-reactive phosphate surfactant together with a reactive sulfonate surfactant were examined in a transmission microscope using electron energy loss spectroscopy imaging (ESI-TEM. Phosphorus is nearly absent from the particles core but it is detected in a thick shell and in unusual, strongly scattering structures with a low carbon content, and largely made out of inorganic phosphate. P is also dispersed outside the particles, while S is uniformly distributed within then. The Na and N elemental maps show that the respective monovalent ions (Na+ and NH4+ have different distributions, in the latex: Na signal within the particles is stronger than in the background, while N is accumulated at the particle borders. The distributions of surfactant and counter-ions are thus different from some current assumptions, but they support recent results on the distribution of ionic constituents in latex films, by scanning electric potential microscopy.
Syntheses of crosslinked latex nanoparticles using differential microemulsion polymerization
Hassmoro, N. F.; Rusop, M.; Abdullah, S.
2013-06-01
The differential microemulsion polymerization was used to synthesize latex nanoparticles. In this paper, 1, 3-butylene glycol dimethacrylate (1, 3-BGDMA) was used as a crosslinker respectively 1-5 weight% of monomer total. Butyl acrylate (BA), butyl methacrylate (BMA), and methacrylic acid (MAA) was used as the monomer. The thin film of latex nanoparticles were prepared by using spin coating method and have been dried at 100°C for 5 minutes. The amount of the crosslinker added in the polymerization was optimized and we found that the particle sizes fall in the range of 30-60 nm. The structural morphology of the uncrosslinked latex represented the most homogeneous image compared to the crosslinked latex. The effect of the amount of crosslinker on the particle sizes investigated by the Zeta-sizer Nano series while Atomic Force microscopy (AFM) was used to study the structural properties of latex nanoparticles.
Syntheses of crosslinked latex nanoparticles using differential microemulsion polymerization
International Nuclear Information System (INIS)
Hassmoro, N F; Abdullah, S; Rusop, M
2013-01-01
The differential microemulsion polymerization was used to synthesize latex nanoparticles. In this paper, 1, 3-butylene glycol dimethacrylate (1, 3-BGDMA) was used as a crosslinker respectively 1–5 weight% of monomer total. Butyl acrylate (BA), butyl methacrylate (BMA), and methacrylic acid (MAA) was used as the monomer. The thin film of latex nanoparticles were prepared by using spin coating method and have been dried at 100°C for 5 minutes. The amount of the crosslinker added in the polymerization was optimized and we found that the particle sizes fall in the range of 30–60 nm. The structural morphology of the uncrosslinked latex represented the most homogeneous image compared to the crosslinked latex. The effect of the amount of crosslinker on the particle sizes investigated by the Zeta-sizer Nano series while Atomic Force microscopy (AFM) was used to study the structural properties of latex nanoparticles.
Cryo-SEM studies of latex/ceramic nanoparticle coating microstructure development.
Luo, Hui; Scriven, L E; Francis, Lorraine F
2007-12-15
Cryogenic scanning electron microscopy (cryo-SEM) was used to investigate microstructure development of composite coatings prepared from dispersions of antimony-doped tin oxide (ATO) nanoparticles (approximately 30 nm) or indium tin oxide (ITO) nanoparticles (approximately 40 nm) and latex particles (polydisperse, D(v): approximately 300 nm). Cryo-SEM images of ATO/latex dispersions as-frozen show small clusters of ATO and individual latex particles homogeneously distribute in a frozen water matrix. In contrast, cryo-SEM images of ITO/latex dispersions as-frozen show ITO particles adsorb onto latex particle surfaces. Electrostatic repulsion between negatively charged ATO and negatively charged latex particles stabilizes the ATO/latex dispersion, whereas in ITO/latex dispersion, positively charged ITO particles are attracted onto surfaces of negatively charged latex particles. These results are consistent with calculations of interaction potentials from past research. Cryo-SEM images of frozen and fractured coatings reveal that both ceramic nanoparticles and latex become more concentrated as drying proceeds; larger latex particles consolidate with ceramic nanoparticles in the interstitial spaces. With more drying, compaction flattens the latex-latex particle contacts and shrinks the voids between them. Thus, ceramic nanoparticles are forced to pack closely in the interstitial spaces, forming an interconnected network. Finally, latex particles partially coalesce at their flattened contacts, thereby yielding a coherent coating. The research reveals how nanoparticles segregate and interconnect among latex particles during drying.
Müller, Marco; Hogg, Melanie; Ulms, Kerstin; Vetter, Walter
2017-09-13
Because of their antioxidant properties, furan fatty acids (furan-FAs) are valuable minor compounds with a widespread occurrence in all living matter. Unfortunately, pure standards are not readily available, because they usually contribute only 1% to the lipid fraction. A known exception of this is the milky fluid of Hevea brasiliensis, commonly known as latex, in which the furan-FA 9-(3-methyl-5-pentylfuran-2-yl)-nonanoic acid (9M5) contributes about 90% to the triacylglycerides. In this study, we investigated the content of 9M5 in 30 different disposable latex gloves, which ranged from 0.7 to 8.2 mg/g of glove. The light degradability of 9M5 in latex gloves was investigated, and different amounts of 9M5 in disposable latex gloves were attributed to varying exposure time to light. Additionally, over 100 mg of the methyl or ethyl ester of 9M5 (purity of >98%) could be extracted from disposable latex gloves, employing cold extraction and silver ion chromatography. With this method, standards for the quantitation of furan-FAs are obtained easily and rapidly in all laboratories.
Directory of Open Access Journals (Sweden)
Ahmed M. Diab
2013-03-01
Full Text Available Numerous researches were performed on latex modified concretes and associated properties, however; some vital factors were not given attention in previous works. This study focus on new factor which significantly affects the properties of latex modified cement paste, mortar or concrete. This factor is termed as ‘latex solid/water ratio’ which is defined herein as the ratio of weight of solid latex to weight of total water content of cement composite including the water in latex itself. The effect of this factor on some properties of cement paste, mortar and concrete were experimentally evaluated. Properties of cement paste include the produced calcium hydroxide and ettringite content during hydration process, while those of cement mortar take account of absorption and effect of temperature on compressive strength. Furthermore, the effect of this factor on the compressive and flexural strengths, modulus of elasticity, water penetration depth and drying shrinkage of concrete were explored. Based on experimental evidences, and spite of using different cement contents, sources of latex, water–cement ratios and slump values, it can be generally concluded that the latex solid/water ratio is a dominant factor affecting different properties of latex modified mortars and concrete.
Cream concentrated latex for foam rubber products
Suksup, R.; Imkaew, C.; Smitthipong, W.
2017-12-01
Fresh natural latex (around 40% rubber and 60% water) can be transformed to concentrated natural latex (around 60% rubber and 40% water) in order to realise economical transportation and easier latex product’s preparation. The concentrated natural latex is an extremely valuable material. It can be applied for many types of products, for example, foam rubber as pillow and mattress, elastic band, etc. Industrially, the concentrated natural latex can be prepared by centrifugation which requires an enormous expensive machine. From the eco-friendly products point of view, most of rubber entrepreneurs in the world try to develop a green rubber product. So, the main objective of this study is to prepare the cream concentrated latex without any sophisticated machine. Thus, we work on a simple, cheap and green method that does not use any expensive machine but uses water-based chemical as sodium alginate to prepare the cream concentrated latex. The optimal amount of sodium alginate in the latex was studied. The main characteristics of the cream concentrated latex were tested by various technics, such as alkalinity, total solid content (TSC), dry rubber content (DRC), etc. We found that there are no significant differences of results between fresh natural latex and cream concentrated latex, except for the TSC and DRC. The TSC and DRC of cream latex are higher than those of fresh natural latex. Finally, we propose a model of natural rubber particle and sodium alginate to form the cream concentrated latex.
Siti Nor Qamarina, M.; Fatimah Rubaizah, M. R.; Nurul Suhaira, A.; Norhanifah, M. Y.
2017-12-01
Epoxidized natural rubber latex (ENRL) is a chemically modified natural rubber latex produced from epoxidation process that involves usage of organic peracids. Conversion of the ENRL into dry rubber products has been known to exhibit many beneficial properties, however limited published works were found on diversifiying the ENRL latex-based products applications. In this preliminary work, different source of raw materials and neutralization systems were investigated. The objective was to explore possibilities in producing distinctive ENRL. Findings have demonstrated that different source of raw materials and neutralization systems influenced the typical ENRL specifications, stability behavior and particle size distribution. Morphological observations performed on these ENRL systems appeared to agree with the ENRL characteristics achieved. Since experimenting these two main factors resulted in encouraging ENRL findings, detailed work shall be further scrutinized to search for an optimum condition in producing marketable ENRL specifically for latex-based products applications.
Formation of Defect-Free Latex Films on Porous Fiber Supports
Lively, Ryan P.
2011-09-28
We present here the creation of a defect-free polyvinylidene chloride barrier layer on the lumen-side of a hollow fiber sorbent. Hollow fiber sorbents have previously been shown to be promising materials for enabling low-cost CO 2 capture, provided a defect-free lumen-side barrier layer can be created. Film experiments examined the effect of drying rate, latex age, substrate porosity (porous vs nonporous), and substrate hydrophobicity/ hydrophilicity. Film studies show that in ideal conditions (i.e., slow drying, fresh latex, and smooth nonporous substrate), a defect-free film can be formed, whereas the other permutations of the variables investigated led to defective films. These results were extended to hollow fiber sorbents, and despite using fresh latex and relatively slow drying conditions, a defective lumen-side layer resulted. XRD and DSC indicate that polyvinylidene chloride latex develops crystallinity over time, thereby inhibiting proper film formation as confirmed by SEM and gas permeation. This and other key additional challenges associated with the porous hollow fiber substrate vs the nonporous flat substrate were overcome. By employing a toluene-vapor saturated drying gas (a swelling solvent for polyvinylidene chloride) a defect-free lumen-side barrier layer was created, as investigated by gas and water vapor permeation. © 2011 American Chemical Society.
Effect of Amphiphilic Alkyl Chain Length Upon Purified LATEX Stability
International Nuclear Information System (INIS)
Amira Amir Hassan; Amir Hashim Mohd Yatim
2015-01-01
Rubber particles in purified latex (PL) are stabilized by a film of protein and fatty acid soap (surfactant). Saturated straight-chain fatty acid soaps can assist an enhancement of latex stability. However, whether the alkyl chain length plays an important role in increasing the stability is still an issue. The aim of this study is to investigate the effect of alkyl chain length of anionic surfactant on the stability of purified latex. The fatty acid soap of decanoate (9), laurate (11), sodium dodecyl sulphate (SDS) (12) and palmitate (15) were used. The numbers in parentheses indicating the number of carbon present in alkyl chain of the soap. The results showed that the impact of alkyl chain length on the stability of latex is in the order of laurate > decanoate > SDS > palmitate > purified latex accordingly. The alkyl chain length does giving a significant effect on latex stability after longer stirring time. The particle size of latex with the presence of surfactant is greater compare to a single particle itself due to extension of particles diameter. Thus suitable interaction of the nonpolar tail of surfactant with the hydrophobic regions of latex surface played a major role in maintaining a stable latex system. (author)
Jackfruit anaphylaxis in a latex allergic patient.
Wongrakpanich, Supakanya; Klaewsongkram, Jettanong; Chantaphakul, Hiroshi; Ruxrungtham, Kiat
2015-03-01
Several fruits have been reported to crossreact with latex antigen in latex allergy patients but little is known regarding tropical fruits in particular. Here we report the case of a 34-year old nurse who developed anaphylaxis following the ingestion of dried jackfruit (Artocarpus heterophyllus). The patient had a history of chronic eczema on both hands resulting from a regular wear of latex gloves. She and her family also had a history of atopy (allergic rhinitis and/or atopic dermatitis). The results of skin prick tests were positive for jackfruit, latex glove, kiwi and papaya, but the test was negative for banana. While we are reporting the first case of jackfruit anaphylaxis, further research needs to be conducted to identify the mechanisms underlying it. In particular, in-vitro studies need to be designed to understand if the anaphylaxis we describe is due to a cross reactivity between latex and jackfruit or a coincidence of allergy to these 2 antigens.
Rapid latex agglutination test for the serodiagnosis of human brucellosis
Abdoel, Theresia H.; Smits, Henk L.
2007-01-01
We developed and evaluated a user-friendly latex agglutination assay for the serodiagnosis of human brucellosis. The assay was obtained by coating colored latex beads with Brucella lipopolysaccharides and drying of the activated beads onto white agglutination cards. Individual cards were sealed in a
Energy Technology Data Exchange (ETDEWEB)
Piskorska, M. [Univ. of South Carolina, Aiken, SC (United States); Soule, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Gosse, J. L. [North Carolina State Univ., Raleigh, NC (United States); Milliken, C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Flickinger, M. C. [North Carolina State Univ., Raleigh, NC (United States); Smith, G. W. [Univ. of South Carolina, Aiken, SC (United States); Yeager, C. M. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2013-01-21
To assess the applicability of latex cell coatings as an ‘off-the-shelf’ biocatalyst, the effect of osmoprotectants, temperature, humidity and O2 on preservation of H2 production in Rhodopseudomonas palustris coatings was evaluated. Immediately following latex coating coalescence (24 h) and for up to 2 weeks of dry storage, rehydrated coatings containing different osmoprotectants displayed similar rates of H2 production. Beyond 2 weeks of storage, sorbitol-treated coatings lost all H2 production activity, whereas considerable H2 production was still detected in sucrose- and trehalose-stabilized coatings. The relative humidity level at which the coatings were stored had a significant impact on the recovery and subsequent rates of H2 production. After 4 weeks storage under air at 60% humidity, coatings produced only trace amounts of H2 (0–0.1% headspace accumulation), whereas those stored at < 5% humidity retained 27–53% of their H2 production activity after 8 weeks of storage. In conWhen stored in argon at < 5% humidity and room temperature, R. palustris coatings retained full H2 production activity for 3 months, implicating oxidative damage as a key factor limiting coating storage. Overall, the results demonstrate that biocatalytic latex coatings are an attractive cell immobilization platform for preservation of bioactivity in the dry state.
Miksa, B; Wilczynska, M; Cierniewski, C; Basinska, T; Slomkowski, S
1995-01-01
Poly(methyl methacrylate-methacrylic acid-2-hydroxyethyl methacrylate) latex (ACRYLAT) was synthesized by radical precipitation polymerization. The mass median diameter (MMD) and the geometrical standard deviation (GSD) of the ACRYLAT particles were 138 nm and 1.2, respectively. The concentration of the titrable carboxylic groups in the surface layer of latex particles was equal to 8.41 x 10(-6) mol m-2. Latex was able to bind up to 2.82 x 10(-7) mol of 1-aminopyrene per 1 m2 of the surface of the latex particles due to the ionic interactions between carboxylate anions and ammonium cations of protonated 1-aminopyrene. ACRYLAT was able to immobilize covalently human serum albumin in amounts up to 0.23 mg m-2. Aggregation of ACRYLAT with immobilized HSA, induced with specific antibodies (anti-HSA), was investigated turbidimetrically. The results indicated that in the model turbidimetric immunoassay, ACRYLAT coated with HSA can be used for the detection of anti-HSA in the goat anti-HSA serum diluted from 50 to 7000-fold. Immobilization of rabbit antibodies to plasminogen (anti-Plg) to ACRYLAT via the epsilon-aminocaproic acid linkers provided particles which were used for the development of the turbidimetric immunoassay for plasminogen. In this assay plasminogen could be detected in concentration ranging from 0.75 to 75 micrograms ml-1 in the blood plasma.
Fiber Bragg Grating Sensor to Monitor Stress Kinetics in Drying Process of Commercial Latex Paints
Directory of Open Access Journals (Sweden)
Ivo de Lourenço
2010-05-01
Full Text Available In this paper, we report a study about the application of packaged fiber Bragg gratings used as strain sensors to monitor the stress kinetics during the drying process of commercial latex paints. Three stages of drying with distinct mechanical deformation and temporal behaviors were identified for the samples, with mechanical deformation from 15 μm to 21 μm in the longitudinal film dimension on time intervals from 370 to 600 minutes. Drying time tests based on human sense technique described by the Brazilian Technical Standards NBR 9558 were also done. The results obtained shows that human sense technique has a limited perception of the drying process and that the optical measurement system proposed can be used to characterize correctly the dry-through stage of paint. The influence of solvent (water addition in the drying process was also investigated. The paint was diluted with four parts paint and one part water (80% paint, and one part paint and one part water (50% paint. It was observed that the increase of the water ratio mixed into the paint decreases both the mechanical deformation magnitude and the paint dry-through time. Contraction of 5.2 μm and 10.4 μm were measured for concentrations of 50% and 80% of paint in the mixture, respectively. For both diluted paints the dry-through time was approximately 170 minutes less than undiluted paint. The optical technique proposed in this work can contribute to the development of new standards to specify the drying time of paint coatings.
Soybean oil in water-borne coatings and latex film formation study by AC impedance
Jiratumnukul, Nantana
Conventional coalescing agents such as butyl cellosolve, butyl carbitol, and TexanolRTM are widely use in the latex coatings industry to facilitate film formation at ambient temperature. Coalescent aids are composed of solvents with low evaporation rates. After water evaporates, coalescent aids would help soften polymer molecules and form continuous films, then gradually evaporates from the film. Coalescent aids, therefore, are considered as volatile organic compounds (VOC), which are of environmental concern. The main purpose of this research project was to prepare a fatty acid glycol ester from soybean oil and glycol (polyols). The soybean oil glycol ester can be used as a coalescent aid in latex paint formulation. The soybean oil glycol ester not only lowered the minimum film formation temperature of latex polymers and continuous film formed at ambient temperature, but also after it has facilitated film formation, does not substantially evaporate, but becomes part of the film. Soybean oil glycol esters, therefore, can reduce the VOC levels and facilitate film formation of latex paints. In the second part of this research AC-Impedance was used to investigate the efficiency of soybean oil coalescent aid in latex film formation relative to the conventional ones. The coating resistance showed that the efficiency of film formation was increased as a function of dry time. The coating resistance also exhibited the effect of soybean oil ester in latex film formation in the same fashion as a conventional coalescent aid, TexanolRTM.
Extractable protein content of radiation vulcanized natural rubber latex films
International Nuclear Information System (INIS)
Ma'zam Md Said; Wan Manshol Wan Zin
1996-01-01
The effects of processing conditions on extractable protein content of coagulant dipped radiation vulcanized natural rubber latex films have been investigated. Drying of wet-gel of radiation vulcanized latex films even at a relatively low temperature of 70 degree C resulted in increases of extractable protein content of the films. The extractable protein content is dependent upon both the temperature and time of drying of wet-gel deposit. Wet-gel leaching of film alone is not adequate to reduce the extractable protein content of films to low levels. Combination of wet-gel leaching, post-leaching, a dip in corn starch slurry, followed by drying at a low temperature of 70 degree C reduces the extractable protein content of films to very low levels
Radioactive iodine (125I) labeling of latex particles
International Nuclear Information System (INIS)
Parikh, G.C.; Ho, C.K.
1977-01-01
The invention disclosed in this application is directed towards developing a radioiodination method which is applicable to the labeling of 2.02 micrometer (μm) and 0.37 micrometer (μm) diameter polyvinyltoluene latex particles that have been used as an immunoadsorbent. More particularly the overall method includes using an oxidation-reduction chemical reaction for tagging latex particles. Two methods are described. One, the hydrochloric acid method; and two, the nitric acid method
pH dependence of the properties of waterborne pressure-sensitive adhesives containing acrylic acid.
Wang, Tao; Canetta, Elisabetta; Weerakkody, Tecla G; Keddie, Joseph L; Rivas, Urko
2009-03-01
Polymer colloids are often copolymerized with acrylic acid monomers in order to impart colloidal stability. Here, the effects of the pH on the nanoscale and macroscopic adhesive properties of waterborne poly(butyl acrylate-co-acrylic acid) films are reported. In films cast from acidic colloidal dispersions, hydrogen bonding between carboxylic acid groups dominates the particle-particle interactions, whereas ionic dipolar interactions are dominant in films cast from basic dispersions. Force spectroscopy using an atomic force microscope and macroscale mechanical measurements show that latex films with hydrogen-bonding interactions have lower elastic moduli and are more deformable. They yield higher adhesion energies. On the other hand, in basic latex, ionic dipolar interactions increase the moduli of the dried films. These materials are stiffer and less deformable and, consequently, exhibit lower adhesion energies. The rate of water loss from acidic latex is slower, perhaps because of hydrogen bonding with the water. Therefore, although acid latex offers greater adhesion, there is a limitation in the film formation.
International Nuclear Information System (INIS)
Healy, Jan; Brennan, Patrick C.; Bowden, Julie Anne
2003-01-01
The use of latex gloves has risen dramatically among healthcare workers resulting in an increase in the number of workers experiencing reactions to gloves. Little evidence of reactions among Irish healthcare workers is available. The current, self-reporting study investigated the prevalence to latex gloves amongst four professional groups within three Diagnostic Imaging Departments. Prevalence is similar to that demonstrated elsewhere with 18.3% of individuals expressing latex associated symptoms. Symptoms included itching and redness of hands, dry cracked skin, soreness of eyes and upper respiratory tract complaints. These results indicate that latex hypersensitivity is a real problem amongst Irish healthcare workers. This preliminary work provides the basis of a much larger controlled study currently being planned
The preparation of RVNRL using Malaysian-produced latexes
International Nuclear Information System (INIS)
Zin, W.M. bin W.; Mohid, N. bte; Hasan, J. bin; Noor, W.K.A. bte W.M.; Jaafar, Zulkifli
1993-01-01
This research project was carried out using latexes supplied by three of the suppliers in Malaysia. From the results of studies carried out in search of the best sensitiser for RVNRL preparation, the use of n-butyl acrylate (n-BA) as a sensitiser gave the most promising results. However, its use as a sensitiser is not universal to all latexes available in the country. The problem was overcome by using different formulations for different latexes. For the latex supplied by Golden Hope (Hytex), a combination of sensitisers i.e. n-BA plus 2-ethyl hexyl acrylate (2-EHA) with a 10% potassium hydroxide solution as the stabilizer, was required. Latex supplied by MARDEC (Matex), seemed to need only n-BA as the sensitiser. However, a stabilizer was still required and the use of a 10% KOH solution was found to be suitable. A large range of stabilizers and sensitisers were applicable to Guthrie latex. The use of n-BA as the sensitiser and potassium laurylic acid as the stabilizer seemed the most favourable formulation. All the results are discussed in the form of a correlation between dose and the tensile properties of RVNRL vulcanizates, equilibrium swelling ratio and standing time of the latex formulation. (author)
Triterpenoid biosynthesis in Euphorbia lathyris latex
International Nuclear Information System (INIS)
Hawkins, D.R.
1987-11-01
The structures of triterpenols, not previously been known, from Euphorbia lathyris latex are reported. A method for quantifying very small amounts of these compounds was developed. Concerning the biochemistry of the latex, no exogenous cofactors were required for the biosynthesis and the addition of compounds such as NADPAH and ATP do not stimulate the biosynthesis. The addition of DTE or a similar anti-oxidant was found to help reduce the oxidation of the latex, thus increasing the length of time that the latex remains active. The requirement of a divalent cation and the preference for Mn in the pellet was observed. The effect of several inhibitors on the biosynthesis of the triterpenoids was examined. Mevinolin was found to inhibit the biosynthesis of the triterpenoids from acetate, but not mevalonate. A dixon plot of the inhibition of acetate incorporation showed an I 50 concentration of 3.2 μM. Fenpropimorph was found to have little or no effect on the biosynthesis. Tridemorph was found to inhibit the biosynthesis of all of the triterpenoids with an I 50 of 4 μM. It was also observed that the cyclopropyl containing triterpenols, cycloartenol and 24-methylenecycloartenol were inhibited much more strongly than those containing an 8-9 double bond, lanosterol and 24-methylenelanosterol. The evidence indicates, but does not definetely prove, that lanosterol and 24-methylenelanosterol are not made from cycloartenol and 24-methylenecycloartenol via a ring-opening enzyme such as cycloeucalenol-obtusifoliol isomerase. The possibilty that cycloartenol is made via lanosterol was investigated by synthesizing 4-R-4- 3 H-mevalonic acid and incubating latex with a mixture of this and 14 C-mevalonic acid. From the 3 H/ 14 C ratio it was shown that cycloartenol and 24-methylenecycloartenol are not made via an intermediate containing as 8-9 double bond. 88 refs., 15 figs., 30 tabs
Formation of Defect-Free Latex Films on Porous Fiber Supports
Lively, Ryan P.; Mysona, Joshua A.; Chance, Ronald R.; Koros, William J.
2011-01-01
a defect-free lumen-side barrier layer can be created. Film experiments examined the effect of drying rate, latex age, substrate porosity (porous vs nonporous), and substrate hydrophobicity/ hydrophilicity. Film studies show that in ideal conditions
Study of Antibacterial Activity and Bacteriology of Latex from Asclepias syriaca L
McCay, Steven; Mahlberg, Paul
1973-01-01
Whole and fractionated latex of Asclepias syriaca was tested for antimicrobial or growth-promoting activity with 16 genera and species of bacteria. Latex and extracted fractions (distilled water, acetic acid, sodium bicarbonate, sulfuric acid, and ethyl ether) possessed no detectable antimicrobial activity. Comparison of growth curves of selected bacteria incubated with serum and rubber fractions, as well as controls, revealed no detectable inhibition of growth, except for a slight inhibitory response to autoclaved serum. Most bacteria were capable of utilizing latex for a substrate as indicated by the increased growth rate in the exponential phase. The stationary phase was entered simultaneously by both the treated cultures and the controls. Various bacteria cultured in a litmus latex mixture yielded populations which ranged from <104 organisms/ml for Lactobacillus casei, Staphylococcus aureus and Micrococcus lysodeikticus to 1.1 × 1010 organisms/ml for Clostridium acetobutylicum. Whole latex, as well as the serum and rubber fractions, support the growth of various bacteria, but under field conditions there is no evidence for systemic infection of this type of cell by bacteria. PMID:4790590
Effect of irradiation on the prevulcanized latex/low nitrosamines latex blends
Energy Technology Data Exchange (ETDEWEB)
Ibrahim, Pairu; Zin, Wan Manshol Wan [Malaysian Nuclear Agency, 43000 kajang, Selangor (Malaysia); Daik, Rusli [Faculty of Science and Technology, Universiti Kebangsaan Malaysia,43600 bangi, Selangor (Malaysia)
2015-09-25
Radiation Prevulcanized Natural Rubber Latex (RVNRL) was blended with Low Nitrosamines Latex (LNL) at different composition ratio. Methyl Metachrylate (MMA) was added for grafting onto the blended latex. Blended latex was subjected to gamma irradiation at various doses up to 8kGy. The mechanical properties and FTIR analysis were investigated as a function of the blended composition and irradiation dose. It was found that blending at specific ratio and gamma irradiation at specific dose led to significant improvement on the properties of the latex. The optimum mechanical properties was attained at a total blending ratio of 70% RVNRL and 30% of LNL.
Wang, Yong-Xin; Xue, Dan-Ting; Liu, Meng; Zhou, Zheng-Min; Shang, Jing
2016-03-01
The present study aimed at developing a natural compound with anti-allergic effect and stability under latex glove manufacturing conditions and investigating whether its anti-allergic effect is maintained after its addition into the latex. The effects of nine natural compounds on growth of the RBL-2H3 cells and mouse primary spleen lymphocytes were determined using MTT assay. The compounds included glycyrrhizin, osthole, tetrandrine, tea polyphenol, catechin, arctigenin, oleanolic acid, baicalin and oxymatrine. An ELISA assay was used for the in vitro anti-type I/IV allergy screening; in this process β-hexosaminidase, histamine, and IL-4 released from RBL-2H3 cell lines and IFN-γ and IL-2 released from mouse primary spleen lymphocytes were taken as screening indices. The physical stability of eight natural compounds and the dissolubility of arctigenin, selected based on the in vitro pharnacodynamaic screening and the stability evaluation, were detected by HPLC. The in vivo pharmacodynamic confirmation of arctigenin and final latex product was evaluated with a passive cutaneous anaphylaxis (PCA) model and an allergen-specific skin response model. Nine natural compounds showed minor growth inhibition on RBL-2H3 cells and mouse primary spleen lymphocytes. Baicalin and arctigenin had the best anti-type I and IV allergic effects among the natural compounds based on the in vitro pharmacodynamic screening. Arctigenin and catechin had the best physical stability under different manufacturing conditions. Arctigenin was the selected for further evaluation and proven to have anti-type I and IV allergic effects in vivo in a dose-dependent manner. The final product of the arctigenin-containing latex glove had anti-type I and IV allergic effects in vivo which were mainly attributed to arctigenin as proved from the dissolubility results. Arctigenin showed anti-type I and IV allergic effects in vitro and in vivo, with a good stability under latex glove manufacturing conditions
Triterpenoid biosynthesis in Euphorbia lathyris latex
Energy Technology Data Exchange (ETDEWEB)
Hawkins, D.R.
1987-11-01
The structures of triterpenols, not previously been known, from Euphorbia lathyris latex are reported. A method for quantifying very small amounts of these compounds was developed. Concerning the biochemistry of the latex, no exogenous cofactors were required for the biosynthesis and the addition of compounds such as NADPAH and ATP do not stimulate the biosynthesis. The addition of DTE or a similar anti-oxidant was found to help reduce the oxidation of the latex, thus increasing the length of time that the latex remains active. The requirement of a divalent cation and the preference for Mn in the pellet was observed. The effect of several inhibitors on the biosynthesis of the triterpenoids was examined. Mevinolin was found to inhibit the biosynthesis of the triterpenoids from acetate, but not mevalonate. A dixon plot of the inhibition of acetate incorporation showed an I/sub 50/ concentration of 3.2 ..mu..M. Fenpropimorph was found to have little or no effect on the biosynthesis. Tridemorph was found to inhibit the biosynthesis of all of the triterpenoids with an I/sub 50/ of 4 ..mu..M. It was also observed that the cyclopropyl containing triterpenols, cycloartenol and 24-methylenecycloartenol were inhibited much more strongly than those containing an 8-9 double bond, lanosterol and 24-methylenelanosterol. The evidence indicates, but does not definetely prove, that lanosterol and 24-methylenelanosterol are not made from cycloartenol and 24-methylenecycloartenol via a ring-opening enzyme such as cycloeucalenol-obtusifoliol isomerase. The possibilty that cycloartenol is made via lanosterol was investigated by synthesizing 4-R-4-/sup 3/H-mevalonic acid and incubating latex with a mixture of this and /sup 14/C-mevalonic acid. From the /sup 3/H//sup 14/C ratio it was shown that cycloartenol and 24-methylenecycloartenol are not made via an intermediate containing as 8-9 double bond. 88 refs., 15 figs., 30 tabs.
Natural rubber latex: determination and interpretation of flow curves
Directory of Open Access Journals (Sweden)
Harrison Lourenço Corrêa
2015-08-01
Full Text Available AbstractAs consumers become more demanding, the importance grows of guaranteeing the quality of products. The employment of reliable testing techniques that assure the origin and characteristics of the inputs used by industry is a key factor in this respect. In the rubber processing industry, the most commonly used characterization tests include determination of the total solids and dry rubber content, mechanical stability, odor, color and presence of volatile compounds, among others. For the most part, these tests are sufficient for the latex transformation industry. However, in situations where there is a need to know the behavior of latex in reaction to the mechanical forces of machines (mixers, pumps, etc., other tests must be used. Rheological tests to determine viscoelastic data by means of plotting flow curves combined with the application of theoretical models can provide important details for characterization of different types of latex. This article presents the protocol employed by the Rheology and Image Laboratory of Rio de Janeiro State University (UERJ for the rheological study of Brazilian latex. The samples analyzed came from the state of São Paulo.
Oil-Acrylic hybrid latexes as binders for waterborne coatings
Hamersveld, E.M.S.; Es, van J.J.G.S.; German, A.L.; Cuperus, F.P.; Weissenborn, P.; Hellgren, A.C.
1999-01-01
The combination of the characteristics of oil, or alkyd, emulsions and acrylic latexes in a waterborne binder has been the object of various studies in the past. Strategies for combining the positive properties of alkyds, e.g. autoxidative curing, gloss and penetration in wood, with the fast drying
Oil-acrylic hybrid latexes as binders for waterborne coatings
Hamersveld, van E.M.S.; Es, van J.; German, A.L.; Cuperus, F.P.; Weissenborn, P.; Hellgren, A.C.
1999-01-01
The combination of the characteristics of oil, or alkyd, emulsions and acrylic latexes in a waterborne binder has been the object of various studies in the past. Strategies for combining the positive properties of alkyds, e.g. autoxidative curing, gloss and penetration in wood, with the fast drying
Directory of Open Access Journals (Sweden)
Sureeporn Narongwongwattana
2015-09-01
Full Text Available Volatile Fatty Acid number (VFA no. is one of the parameters indicating the state of quality of Para rubber latex at that particular time. Most factories analyze this parameter using standard analytical method as in ISO 506:1992(E. Nevertheless, this procedure is complicated, chemical and time consuming, as well as skilled analyst required. Therefore, near infrared (NIR spectroscopy which is rapid, accurate and nonchemicals method was applied to determine the VFA no. in field latex and concentrated latex based on quantification and discriminant model. The best calibration equation was obtained from standard normal variate (SNV spectra in the region of 6109.7–5770.3, 4613.1–4242.9 cm-1 with R = 0.832, SECV = 0.036 and no bias. From the performance check, statistically it was found that SECV and bias were low enough for practical acceptance and the predicted VFA no. was not different significantly from actual VFA no. at 95% confidence intervals. In addition, discriminant model was developed to separate good quality latex from the deteriorated latex using VFA no. at 0.06 as standard as in ISO 2004:2010(E. The discriminant model can be used to screen the latex with overall accuracy of 91.86% in validation set.
Directory of Open Access Journals (Sweden)
Tina Virtič
2012-11-01
Full Text Available The increasing use of natural rubber latex medical gloves in the last three decades has caused an increase in latex allergy. The majority of risk groups for allergy development include health care workers, workers in the rubber industry, atopic individuals and children with congenital malformations. Three types of pathological reactions can occur in people using latex medical gloves: irritant contact dermatitis, allergic contact dermatitis and immediate hypersensitivity. The latex allergy is caused by constituent components of latex gloves and added powders; there are also numerous latex allergens involved in cross-reactivity between latex and fruits and vegetables, the so-called latex-fruit syndrome. The diagnosis is based on an accurate history of exposure, clinical presentation and confirmatory in vivo and in vitro tests. Prevention is the easiest, most effective and least expensive way to avoid latex allergy. Powder-free latex gloves with reduced levels of proteins and chemicals, and synthetic gloves for allergic workers must be provided in the work environment. There are already many health care institutions around the world where all latex products have been replaced by synthetic material products.
Fabrication of polyacrylate core–shell nanoparticles via spray drying method
Energy Technology Data Exchange (ETDEWEB)
Chen, Pengpeng, E-mail: chenpp@ahu.edu.cn [Anhui University, College of Chemistry and Chemical Engineering (China); Cheng, Zenghui; Chu, Fuxiang; Xu, Yuzhi; Wang, Chunpeng, E-mail: wangcpg@163.com [Chinese Academy of Forestry, Institute of Chemical Industry of Forest Products (China)
2016-05-15
Fine polyacrylate particles are thought to be environmental plastisols for car industry. However, these particles are mainly dried through demulsification of the latexes, which is not reproducible and hard to be scaled up. In this work, a spray drying method had been applied to the plastisols-used acrylate latex. By adjusting the core/shell ratio, spray drying process of the latex was fully studied. Scanning electronic microscopy observation of the nanoparticles before and after spray drying indicated that the core–shell structures could be well preserved and particles were well separated by spray drying if the shell was thick enough. Otherwise, the particles fused into each other and core–shell structures were destroyed. Polyacrylate plastisols were developed using diisononylphthalate as a plasticizer, and plastigels were obtained after heat treatment of the sols. Results showed that the shell thickness also had a great influence on the storage stability of the plastisols and mechanical properties of the plastigels.Graphical Abstract.
Fabrication of polyacrylate core–shell nanoparticles via spray drying method
International Nuclear Information System (INIS)
Chen, Pengpeng; Cheng, Zenghui; Chu, Fuxiang; Xu, Yuzhi; Wang, Chunpeng
2016-01-01
Fine polyacrylate particles are thought to be environmental plastisols for car industry. However, these particles are mainly dried through demulsification of the latexes, which is not reproducible and hard to be scaled up. In this work, a spray drying method had been applied to the plastisols-used acrylate latex. By adjusting the core/shell ratio, spray drying process of the latex was fully studied. Scanning electronic microscopy observation of the nanoparticles before and after spray drying indicated that the core–shell structures could be well preserved and particles were well separated by spray drying if the shell was thick enough. Otherwise, the particles fused into each other and core–shell structures were destroyed. Polyacrylate plastisols were developed using diisononylphthalate as a plasticizer, and plastigels were obtained after heat treatment of the sols. Results showed that the shell thickness also had a great influence on the storage stability of the plastisols and mechanical properties of the plastigels.Graphical Abstract
The effect of emulsifier on the stability of irradiated LA-TZ latex
International Nuclear Information System (INIS)
Made Sumarti K; Utama, Marga; Puspitasari, Tita
1998-01-01
The effect of six kinds of stabilizer on the stability of the concentrated LA-TZ latex which contains n-BA have been studied. The six stabilizers are: 1. Naphthalene sulfonic acid formaldehyde condensate, 2. Sodium dialkyl sulfosuccinate, 3. Triethanol amine lauryl sulfate, 4. Sodium polyoxyethylene alkyl phenol ether sulfate, 5. Dodecyl benzene sulfonic acid (Neopelex FS), and 6. Ammonium laurat. The concentrations of the stabilizers are in the range of 0,1 to 0,3% and of the n-BA is 5phr (per hundred rubber). The field natural rubber latex was stabilized by Tetramethyl tiuram disulfide - Zine oxide (TMTD-ZnO) and ammonium gas, and was concentrated by centrifuge. The obtain concentrated LA-TZ latex was added by the n-BA and was kept with various storage time i.e. o, 2, 4, 6, 18, and 24 hours. It was found that the stable latex was irradiated by 15 kGy dose and the physical properties was tested, then the maximum tensile strength of 223,3 kg/cm 2 was found on Neopelex FS concentrate at 0,1%. (authors)
Application of recombinant latex allergens in diagnostics of occupational latex allergy
Directory of Open Access Journals (Sweden)
Ewa Nowakowska-Świrta
2015-02-01
Full Text Available Over many years, allergy to natural rubber latex has been a major problem among health care workers (HCW. The diagnosis of occupational allergy requires methods of high diagnostic accuracy in view of certification implications (e.g., a sick worker quits a job. With the development of molecular methods, the frequency of application of recombinant allergens in the diagnostics of allergic diseases continues to increase. This paper reviews the applicability of laboratory tests which use recombinant allergens in the diagnostics of occupational allergy. The diagnosis of latex allergy is based on the presence of clinical symptoms linked with exposure to latex allergens, positive skin prick tests and detection of specific IgE antibodies to latex in serum. Moreover, in some cases specific challenge tests are conducted. The analysis of literature indicates that applying the panel of recombinant latex allergens in diagnostic tests, cross-reactivity can very likely be excluded and/or sensitization can be confirmed without the need for specific challenge tests, which in case of latex allergens carries a potential risk of generalized reactions. Med Pr 2015;66(1:85–97
Latex in the Hospital Environment
LATEX in the Hospital Environment Updated Fall 2015 This list provides a guide to some of the most common objects containing latex and offers some ... remover–Sepha Pharm) 1 LATEX in the Hospital Environment (continued) Frequently contains LATEX OR/Infection Control masks, ...
Grätzer, George
2014-01-01
Accessible at 200+ pages to all who want to learn the practical usages of LaTeX Avoids technical subjects like font usage Friendly and easy to read, with many examples included Extra source materials include sample LaTeX files and suggestions for further reading
Latex allergy in the workplace.
Toraason, M; Sussman, G; Biagini, R; Meade, J; Beezhold, D; Germolec, D
2000-11-01
While less than 1% of the general population is sensitized to latex, the U.S. Occupational Safety and Health Administration estimates that 8-12% of health-care workers are sensitized. The major source of workplace exposure is powdered natural rubber latex (NRL) gloves. NRL is harvested from HEVEA: brasiliensis trees and ammoniated to prevent coagulation resulting in the hydrolysis of the latex proteins. Prior to use in manufacturing, the latex is formulated by the addition of multiple chemicals. Thus, human exposure is to a mixture of residual chemicals and hydrolyzed latex peptides. Clinical manifestations include irritant contact dermatitis, allergic contact dermatitis (type IV), and type I immediate hypersensitivity response. Type I (IgE-mediated) NRL allergy includes contact urticaria, systemic urticaria, angioedema, rhinitis, conjunctivitis, bronchospasm, and anaphylaxis. Taking an accurate history, including questions on atopic status, food allergy, and possible reactions to latex devices makes diagnosis of type-I latex allergy possible. To confirm a diagnosis, either in vivo skin prick testing (SPT) or in vitro assays for latex-specific IgE are performed. While the SPT is regarded as a primary confirmatory test for IgE-mediated disease, the absence of a U.S. Food and Drug Administration-licensed HEVEA: brasiliensis latex extract has restricted its use in diagnosis. Serological tests have, therefore, become critically important as alternative diagnostic tests. Three manufacturers currently have FDA clearance for in vitro tests, to detect NRL-specific IgE. The commercially available assays may disagree on the antibody status of an individual serum, which may be due to the assay's detecting anti-NRL IgEs to different allergenic NRL proteins. Sensitized individuals produce specific IgE antibody to at least 10 potent HEVEA: allergens, Hev b 1-Hev b 10, each of which differs in its structure, size, and net charge. The relative content and ratios of Hevs in the
Bonalumi, Sabrina; Barbonaglia, Patrizia; Bertocchi, Carmen
2006-01-01
In 2001 the General Health Direction of Region Lombardia approved (decree n. 22303) a guideline for the prevention of latex allergic reactions in patients and health care workers. This document provides general recommendations in order to standardize behaviors in regional health care facilities. The reason is due to a rise in the incident of reactions to latex products in the last 20 years. Nowadays the prevalence is higher in certain risk groups (subjected to frequent and repeated exposures) rather than the general population. The aim of the project was to organize a latex safe operating theatre in the Ospedale Maggiore Policlinico, Mangiagalli e Regina Elena of Milan (Fondazione) and to standardize behaviors in order to prevent adverse effects in latex allergic patients. Thanks to the literature review and the creation of a multidisciplinar team, we produced a protocol. Therefore, we requested manufacturers the certification of the latex content of their products. Results and conclusion. When latex allergic patients need to undergone surgery in our hospital, a latex safe operating theatre is organized by personnel following a multidisciplinar protocol. No allergic reactions were experienced during surgical procedures after the creation of an environment as free as possible from latex contamination. The project will involve an emergency room, one room or more of a ward and of the outpatients department.
Pilot scale experiments on radiation vulcanization of NR latex
Ridwan, M.
The potential of irradiated latex as raw material of commercial use is under testing on pilot plant scale in Indonesia which has 225 kCi Co-60 irradiation facility and can irradiate 1000 tonnes of centrifuged latex per annum. The facility was jointly designed by BATAN of Indonesia and JAERI of Japan and was jointly financed by UNDP/IAEA, Government of Japan and Government of Indonesia under UNDP/IAEA Regional Cooperative Agreement Project on Industrial Application of Isotopes and Radiation Technology. The facility is a water pool type and can accomodate 400 kCi Co-60. The Co-60 rack has two shapes, plate and cylindrical shapes. The plate shape source is used for natural rubber latex irradiation and the cylindrical one is used for other irradiation services. The vulcanization system consists of three major components : emulsification unit ( height : 650 mm, diameter 500 mm ), mixing unit ( height : 1900mm, diameter 1200 mm ) and vulcanization reactor ( height : 1800 mm, diameter 1300 mm ). The first two components are located outside shielded room while the third one-in irradiation room. The radiation vulcanization process is a much simpler energy saving process comparedto the conventional thermal process which has two vulcanization steps before and after dipping. The physical and mechanical properties of irradiated NR Latex are comparable to those of sulfur vulcanized, and depend on many factors such as irradiation dose, sensitizer content, dry rubber content and storage time.
CHEMICAL EXAMINATION OF JACK TREE LATEX AND
Indian Academy of Sciences (India)
and on Saponification yielded fatty acids, Volatile as well as non-volatile. The unsaponifiable portion on repeated crystallisation provided a crystal- line, sharp melting compound which was identified as artostenone? from a. Latex (200 c.c.). ത്ത min- pe. Coagulum (A) Aqueous alcoholic solution (B). Acetone or ethyl acetate ...
Transcript Profiling of Hevea brasiliensis during Latex Flow
Directory of Open Access Journals (Sweden)
Jinquan Chao
2017-11-01
Full Text Available Latex exploitation enhances latex regeneration in rubber trees. The latex exploitation-caused latex flow lasts from 10 min to a few hours, which is convenient for exploring the transcript profiling of latex metabolism-related genes at the different stages of latex flow. In the present study, the expression pattern of 62 latex metabolism-related genes involved in water transportation, carbohydrate metabolism, natural rubber biosynthesis, hormone signaling, ROS generation and scavenging, and latex coagulum across three stages of latex flow between rubber tree clones CATAS7-33-97 and CATAS8-79 were comparatively analyzed by quantitative real-time PCR. The two clones show differences in latex regeneration and have a different duration of latex flow. The results showed that the expression levels of 38 genes were significantly higher in CATAS8-79 latex than in CATAS7-33-97 during latex regeneration, while 45 genes had a notably higher expression level in CATAS8-79 latex during latex flow. Together with the activation of the MEP pathway and jasmonate pathway in CATAS8-79 latex, HbPIP1;3, HbPIP1;4, HbSUT3, HbSus3, HbHMGS1-2, HbMK should contribute to the high latex regeneration ability. The up-regulation of ethylene signaling and Hb44KD and the down-regulation of latex coagulation-related genes in CATAS8-79 latex might contribute to its longer latex flow duration. This study provides some cues for revealing the regulation of latex metabolism in rubber trees.
Latex allergy and filaggrin null mutations
DEFF Research Database (Denmark)
Carlsen, Berit C; Meldgaard, Michael; Hamann, Dathan
2011-01-01
to aeroallergens and it is possible that filaggrin null mutations also increase the risk of latex allergy. The aim of this paper was to examine the association between filaggrin null mutations and type I latex allergy. Methods Twenty latex allergic and 24 non-latex allergic dentists and dental assistants...... in the cases in this study may not have occurred through direct skin contact but through the respiratory organs via latex proteins that are absorbed in glove powder and aerosolized...
LOL2 and LOL5 loci control latex production by laticifer cells in Euphorbia lathyris.
Castelblanque, Lourdes; Balaguer, Begoña; Marti, Cristina; Orozco, Marianela; Vera, Pablo
2018-06-07
Laticifers are specialized plant cells capable of indefinite elongation that ramify extensively and are responsible for latex biosynthesis and accumulation. However, the mechanisms underlying laticifer cell differentiation, growth and production of latex remain largely unknown. In a search for mutants showing enhanced accumulation of latex we identified two LOT OF LATEX (LOL) loci in Euphorbia lathyris. lol2 and lol5 mutants show enhanced production of latex contained within laticifer cells. The recessive lol2 mutant carries increased biosynthesis of the plant hormone jasmonoyl-isoleucine (JA-Ile) and therefore establishes a genetic link between jasmonic acid (JA) signaling and latex production in laticifers. Instead, heightened production of latex in lol5 plants obeys to enhanced proliferation of laticifer cells. Phylogenetic analysis of laticifer-expressed genes in E. lathyris and in two other latex-bearing species, Euphorbia corallioides and Euphorbia palustris, allowed the identification of canonical JA responsive elements present in the gene promoter regions of laticifer marker genes. Moreover, we identified that the hormone JA functions not as a morphogen for laticifer differentiation but as a trigger for the fill out of laticifers with latex and the associated triterpenoids. The identification of LOL loci represents a further step towards the understanding of mechanisms controlling latex production in laticifer cells. No claim to original US Government works New Phytologist © 2018 New Phytologist Trust.
Shiraz, Hana; Peake, Simon J; Davey, Tim; Cameron, Neil R; Tabor, Rico F
2018-05-15
Film-forming polymer latex particles of diameter acrylate (BA) as co-monomers, potassium persulphate (KPS) as an initiator and a commercially available colloidal nano-silica (Ludox®-TM40). It was found that pH control before polymerisation using methacrylic acid (MAA) facilitated the formation of armoured latexes, and mechanistic features of this process are discussed. An alternative, more robust protocol was developed whereby addition of vinyltriethoxysilane (VTES) to control wettability resulted in latexes completely armoured in colloidal nano-silica. The latexes were characterised using SEM, cryo-TEM and AFM imaging techniques. The mechanism behind the adsorption was investigated through surface pressure and contact angle measurements to understand the factors that influence this irreversible adsorption. Results indicate that nanoparticle attachment (but intriguingly not latex size) is dependent on particle wettability, providing new insight into the formation of nanoparticle-armoured latexes, along with opportunities for further development of diversely functionalized inorganic/organic polymer composite particles. Copyright © 2018 Elsevier Inc. All rights reserved.
Anti-ulcer activity of Synadenium grantii latex
Directory of Open Access Journals (Sweden)
Larissa L. G. Costa
2012-10-01
Full Text Available Synadenium grantii Hook f., Euphorbiaceae, is popularly known as leitosinha or janaúba. The diluted latex (18 drops/L of water is commonly used in the south of Brazil to treat gastric disturbances. This study evaluated phytochemical screening and toxicity using Artemia salina Leach of crude bark extract and also latex. The toxicity and the anti-ulcer activity of S. grantii latex were also tested in rats. Phytochemical results showed presence of tannins, terpenes, unsaponificable substances, coumarins and anthraquinones in the crude bark extract and terpenes in the latex. Gas chromatography-mass spectrometry (GC-MS analysis demonstrated the presence of diterpene tigliane esters in the latex, identified as 12-deoxyphorbol-13-(2-metilpropionate and phorbol 12,13,20-triacetate. The toxicity results using A. salina presented CL50 26.58μg/mL and CL50 778.66μg/mL, for the latex and the crude bark extract respectively. The toxicological hepatic parameters of the diluted latex were not different to the control group (p<0.05. The eosinophils cells showed an increase in both the diluted and pure latex groups. The pure latex showed gastric protection of 90% (p<0.05 and the diluted latex showed 6% compared to the negative control. Therefore, our data indicate that S. grantii latex, under research conditions presented gastric protection. Pure latex showed more toxicity than the diluted latex.
Latex Allergy In Health Care Workers
Directory of Open Access Journals (Sweden)
Hayriye Sarıcaoğlu
2013-05-01
Full Text Available Background and Design: We aimed to determine the frequency of latex allergy in our hospital and to to evaluate the clinical and demographical features of the cases.Materials and Methods: A detailed questionnaire was administered to healthcare workers by a physician. Skin prick test with latex and patch test with rubber chemicals and a piece of latex glove were performed for all healthcare workers. Latex-specific IgE was measured in serum.Results: The study sample consisted of 36 nurses, 14 doctors, and 50 healthcare workers. While 46 subjects had symptoms, 54 subjects had no symptoms. The relationship of clinical disease with working duration, exposure duration (hour/day, history of atopy, and drug/food allergies was statistically significant. Five nurses and 1 healthcare worker had positive skin prick test. Two of them had positive latex-specific IgE. Positive skin prick test statistically significantly correlated with occupation, working duration, exposure duration (hour/day and positive latex-specific IgE. Two nurses and 2 healthcare workers had positive latex-specific IgE. Two of them had positive skin prick test. Positive latexspecific IgE statistically significantly correlated with working duration, exposure duration, and positive skin prick test. Patch test with a piece of latex glove was negative in all subjects. Three healthcare workers had positive patch test with thiuram-mix, one of them had also positive patch test with mercaptobenzothiazole.Discussion: One of the risk factors for latex allergy is occupations involving frequent exposure to latex products. Latex allergy should be taken into consideration if type I hypersensitivity reactions occur in occupational groups at risk for anaphylactic reaction.
Evaluation of force degradation characteristics of orthodontic latex elastics in vitro and in vivo.
Wang, Tong; Zhou, Gang; Tan, Xianfeng; Dong, Yaojun
2007-07-01
To evaluate the characteristics of force degradation of latex elastics in clinical applications and in vitro studies. Samples of 3/16-inch latex elastics were investigated, and 12 students between the ages of 12 and 15 years were selected for the intermaxillary and intramaxillary tractions. The elastics in the control groups were set in artificial saliva and dry room conditions and were stretched 20 mm. The repeated-measure two-way analysis of variance and nonlinear regression analysis were used to identify statistical significance. Overall, there were statistically significant differences between the different methods and observation intervals. At 24- and 48-hour time intervals, the force decreased during in vivo testing and in artificial saliva (P .05). In intermaxillary traction the percentage of initial force remaining after 48 hours was 61%. In intramaxillary traction and in artificial saliva the percentage of initial force remaining was 71%, and in room conditions 86% of initial force remained. Force degradation of latex elastics was different according to their environmental conditions. There was significantly more force degradation in intermaxillary traction than in intramaxillary traction. The dry room condition caused the least force loss. There were some differences among groups in the different times to start wearing elastics in intermaxillary traction but no significant differences in intramaxillary traction.
Extractable proteins from electron beam (EB) irradiated natural rubber (NR) latex
International Nuclear Information System (INIS)
Feroza Akhtar; Fumio Yoshii; Keizo Makuuchi
1996-01-01
The protein assay of natural rubber latex (NRL) vulcanized by low energy electron beam (EB, 300 keV, 30 mA) has been carried out using Bicinchoninic acid (BCA) reagent. Extractable protein in irradiated latex film was determined by measuring the absorption of colored solution at 562 nm using UV spectrometer. The effect of various radiation doses on the extractable protein content of NRL was investigated. It was ,found that the quantities of extractable protein increases with radiation dose. When compared with ,gamma-ray irradiated samples the same trend was observed. Electron beam irradiated latex films are leached in 1% (ammonia water for various lengths of time. From the results it was established that within 2 hours of leaching in ammonia water most of the extractable protein (96%) were removed from rubber film
Latex particle template lift-up guided gold wire-networks via evaporation lithography
Lone, Saifullah; Vakarelski, Ivan Uriev; Chew, Basil; Wang, Zhihong; Thoroddsen, Sigurdur T
2014-01-01
We describe a hybrid methodology that combines a two dimensional (2D) monolayer of latex particles (with a pitch size down to 1 μm) prepared by horizontal dry deposition, lift-up of a 2D template onto flat surfaces and evaporation lithography to fabricate metal micro- and nano wire-networks. This journal is
Preparation of composites of national rubber latex (NRL) - portland cement mould. Vol. 3
International Nuclear Information System (INIS)
Dessouki, A.M.; Taher, N.H.; El-Nahas, H.H.
1996-01-01
The aim of this study is to prepare some polymeric mould using national rubber latex (NRL) - portland cement composites based on a delayed- action mechanism. Factors affecting the preparation process such as concentration, mixing percentage, additives and their effect on what is regarded as a delayed action coacervant combination was studied. Composites of national latex (NRL) - portland cement would were prepared as two separate parts. The stabilized natural rubber latex (NRL) 100 parts with hydroxy ethyl cellulose (HEC) 2 parts as stabilizer and a delayed - action coacervant (sodium meta silicate as a delaying agent) 5 parts on one hand and the dry blend of cement 65 parts soluble in 65 parts of water as a paste on the other hand were mixed thoroughly on site. (HEC) was added to the rubber latex to prevent the coagulation of the rubber latex with the electrolyte (sodium meta silicate) present in the rubber mixture. Two kinds of stabilization occurred in the rubber part, namely steric stabilization and the stabilization against electrolyte. The effect of delayed - action coacervant (sodium meta silicate) on the initial setting time of rubber - cement mould showed that the molding process did not occur at sodium meta silicate concentration less than 2.66 parts per 100 parts of rubber latex (phr), and the optimum concentration used was 5% parts of rubber latex. It was observed that addition of a delaying agent (Sodium meta silicate) to the rubber part enhanced the delaying mechanism in the time needed for the molding process, while the addition of the delaying agent to the cement part did not have any effect on retardation of the molding process. Chemical coacervants function mainly by reducing the ζ potential which is associated with the electrical double layer surrounding the latex particle. This reduction may brought about in at least three distinct ways which take place in the system studied. 5 figs., 3 tabs
Preparation of composites of national rubber latex (NRL) - portland cement mould. Vol. 3
Energy Technology Data Exchange (ETDEWEB)
Dessouki, A M; Taher, N H; El-Nahas, H H [National Center for Radiation Research and Technology, Atomic Energy Athority, Cairo (Egypt)
1996-03-01
The aim of this study is to prepare some polymeric mould using national rubber latex (NRL) - portland cement composites based on a delayed- action mechanism. Factors affecting the preparation process such as concentration, mixing percentage, additives and their effect on what is regarded as a delayed action coacervant combination was studied. Composites of national latex (NRL) - portland cement would were prepared as two separate parts. The stabilized natural rubber latex (NRL) 100 parts with hydroxy ethyl cellulose (HEC) 2 parts as stabilizer and a delayed - action coacervant (sodium meta silicate as a delaying agent) 5 parts on one hand and the dry blend of cement 65 parts soluble in 65 parts of water as a paste on the other hand were mixed thoroughly on site. (HEC) was added to the rubber latex to prevent the coagulation of the rubber latex with the electrolyte (sodium meta silicate) present in the rubber mixture. Two kinds of stabilization occurred in the rubber part, namely steric stabilization and the stabilization against electrolyte. The effect of delayed - action coacervant (sodium meta silicate) on the initial setting time of rubber - cement mould showed that the molding process did not occur at sodium meta silicate concentration less than 2.66 parts per 100 parts of rubber latex (phr), and the optimum concentration used was 5% parts of rubber latex. It was observed that addition of a delaying agent (Sodium meta silicate) to the rubber part enhanced the delaying mechanism in the time needed for the molding process, while the addition of the delaying agent to the cement part did not have any effect on retardation of the molding process. Chemical coacervants function mainly by reducing the {zeta} potential which is associated with the electrical double layer surrounding the latex particle. This reduction may brought about in at least three distinct ways which take place in the system studied. 5 figs., 3 tabs.
Latex sensitisation in healthcare workers in Singapore.
Tang, M B Y; Leow, Y H; Ng, V; Koh, D; Goh, C L
2005-06-01
Epidemiological data on latex sensitisation among Asian healthcare workers is lacking. The aim of the study is to determine the rate of latex sensitisation in our healthcare workers. We recruited 313 healthcare workers, of which 46.6% were operating theatre staff and 53.4% were non-operating theatre staff. Seventy-one administrative staff served as controls. All participants answered a self-administered questionnaire relating to latex exposure and glove-related symptoms. Latex sensitisation was determined by skin prick testing to latex and latex-specific IgE detection. The prevalence of latex sensitisation among healthcare workers was 9.6%, with no difference between operating theatre and nonoperating theatre staff. Glove-related symptoms were reported in 13.7% of all healthcare workers, of which 22.9% were sensitised to latex. Only 26.7% of latex-sensitised healthcare workers had glove-related symptoms while the rest were asymptomatic. The most common symptoms were itch and hand eczema but the most important discriminating symptom was contact urticaria. Personal history of atopy was more common in sensitised healthcare workers (40.0%) compared to non-sensitised workers (31.8%). Only 1 out of 9 (11.2%) symptomatic latex-sensitised subjects had sought previous medical attention for the problem. Latex sensitisation among healthcare workers in Singapore should be considered a significant occupational health risk, as it is in the West. Increased screening and awareness of this problem is essential to identify those at risk.
International Nuclear Information System (INIS)
Parra, D. F.
2006-01-01
This study refers to the degradability of NRLF, natural rubber latex films, obtained by ionizing radiation. Three types of NRLF were prepared: irradiated latex, irradiated latex with about 1% of soy lecithin and sulfur-vulcanized latex, by cold vulcanization process. The films were buried in vases of two different kinds of soil: common soil and common soil with earthworm humus. Fast aging tests in laboratory with exposition to ultraviolet rays were done in irradiated latex films and irradiated latex films with soy lecithin. The results obtained after ten months of tests with buried films agree with the results of the fast aging tests, showing singularities of each type of soil and each kind of latex process. It also shows how weather inclemency can induce the films degradation process. The sulfur-vulcanized films were weakly degraded when buried. The films with lecithin and buried in vase with only common soil showed the biggest mass loss, but the films with lecithin buried in vases with common earthworm humus and soil increased their weigh and dimensions due to fungi formation. The irradiated latex films are more degradable then the sulfur-vulcanized films. The irradiated latex film, unlike the sulfur vulcanized film, showed high fungi colonization when buried. We conclude that the irradiated latex films are more easily biodegradable than the sulfur vulcanized latex films. The biodegradability increases with the addition of small amounts of soy lecithin (∼1%). The mechanical resistance of the buried films decreased related to the non-buried ones, proving that the outdoor aging in soil and the presence of fungi in the films can modify the mechanical properties of the irradiated latex owing to the biodegradation
Sulfonated macro-RAFT agents for the surfactant-free synthesis of cerium oxide-based hybrid latexes.
Garnier, Jérôme; Warnant, Jérôme; Lacroix-Desmazes, Patrick; Dufils, Pierre-Emmanuel; Vinas, Jérôme; van Herk, Alex
2013-10-01
Three types of amphiphatic macro-RAFT agents were employed as compatibilizers to promote the polymerization reaction at the surface of nanoceria for the synthesis of CeO2-based hybrid latexes. Macro-RAFT copolymers and terpolymers were first synthesized employing various combinations of butyl acrylate as a hydrophobic monomer and acrylic acid (AA) and/or 2-acrylamido-2-methylpropane sulfonic acid (AMPS) as hydrophilic monomers. After characterizing the adsorption of these macro-RAFT agents at the cerium oxide surface by UV-visible spectrometry, emulsion copolymerization reactions of styrene and methyl acrylate were then carried out in the presence of the surface-modified nanoceria. Dynamic Light Scattering and cryo-Transmission Electron Microscopy were employed to confirm the hybrid structure of the final CeO2/polymer latexes, and proved that the presence of acrylic acid units in amphiphatic macro-RAFT agents enabled an efficient formation of hybrid structures, while the presence of AMPS units, when combined with AA units, resulted in a better distribution of cerium oxide nanoclusters between latex particles. Copyright © 2013 Elsevier Inc. All rights reserved.
Cost evaluation of radiation vulcanization of natural rubber latex
International Nuclear Information System (INIS)
Makuuchi, K.
2003-01-01
Cost of radiation vulcanized NR latex was evaluated. The plant would be built in an existing dipping factory in an industrial area in a Southeast Asian country. One thousands dry tons of NR latex are vulcanized with a low energy electron accelerator. The electron accelerator is a self-shielding low energy type. The maximum accelerating voltage is 300 kV and the output power is 10 kW. The total construction cost of the plant is $400,000 including electron accelerator and other equipments. Costs of raw materials and utilities are $1.165 and $0.023 per one kg of product, respectively. The fixed costs of the plant consist of labor costs, labor overhead, maintenance, plant overhead, depreciation, and bank interest. It is $0.190/kg of product. The company overhead for operation including company management, R and D and insurance is $0.044/kg of product. Thus, the total production cost is estimated to be $1.422/kg of product. (author)
Directory of Open Access Journals (Sweden)
Georg Bauer
Full Text Available Among latex-producing plants, mainly the latex of Hevea brasiliensis has been studied in detail so far, while comprehensive comparative studies of latex coagulation mechanisms among the more than 20,000 latex-bearing plant species are lacking. In order to give new insights into the potential variety of coagulation mechanisms, the untreated natural latices of five latex-bearing plants from the families Euphorbiaceae, Moraceae and Campanulaceae were visualised using Cryo-SEM and their particle size compared using the laser diffraction method. Additionally, the laticifers of these plants species were examined in planta via Cryo-SEM. Similar latex particle sizes and shape were found in Ficus benjamina and Hevea brasiliensis. Hence, and due to other similarities, we hypothesize comparable, mainly chemical, coagulation mechanisms in these two species, whereas a physical coagulation mechanism is proposed for the latex of Euphorbia spp. The latter mechanism is based on the huge amount of densely packed particles that after evaporation of water build a large surface area, which accelerates the coagulation procedure.
Englert, Michael; Ulms, Kerstin; Wendlinger, Christine; Vetter, Walter
2016-02-01
Furan fatty acids are valuable and bioactive minor fatty acids that usually contribute chromatography. A first run using pH-zone-refining countercurrent chromatography provided 48.4 mg of 9-(3-methyl-5-pentylfuran-2-yl)-nonanoic acid from 210 mg latex extract in a purity of 95%. The purity was increased to 99% by means of one second run in conventional countercurrent chromatography mode. The Structure and purity of 9-(3-methyl-5-pentylfuran-2-yl)-nonanoic acid were determined by gas chromatography coupled to mass spectrometry and (1)H and (13)C NMR spectroscopy. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Acetylcholinesterase Inhibitory and Antioxidant Properties of Euphorbiacharacias Latex
Directory of Open Access Journals (Sweden)
Francesca Pintus
2013-03-01
Full Text Available The aim of the present study was to evaluate the acetylcholinesterase inhibitory capacity and the antioxidant properties of extracts of Euphorbia characias latex, a Mediterranean shrub. We performed a new extraction method involving the use of the trichloroacetic acid. The extract showed high antioxidant activity, was rich in total polyphenolic and flavonoid content and exhibited substantial inhibition of acetylcholinesterase activity.
Graphene oxide for acid catalyzed-reactions: Effect of drying process
Gong, H. P.; Hua, W. M.; Yue, Y. H.; Gao, Z.
2017-03-01
Graphene oxides (GOs) were prepared by Hummers method through various drying processes, and characterized by XRD, SEM, FTIR, XPS and N2 adsorption. Their acidities were measured using potentiometric titration and acid-base titration. The catalytic properties were investigated in the alkylation of anisole with benzyl alcohol and transesterification of triacetin with methanol. GOs are active catalysts for both reaction, whose activity is greatly affected by their drying processes. Vacuum drying GO exhibits the best performance in transesterification while freezing drying GO is most active for alkylation. The excellent catalytic behavior comes from abundant surface acid sites as well as proper surface functional groups, which can be obtained by selecting appropriate drying process.
[Latex allergy in a population at risk].
Ruiz Fernández, M; Flores Sandoval, G; Orea Solano, M
1999-01-01
The allergy to latex is an illness whose prevalence has been increased in very significant form in the last years. To know the allergy incidence to latex in population of risk, as well as to identify the related sintomatology and the importance or paper that play the atopia antecedents and time of contact with latex for the development of the illness. We carry out a prospective, descriptive, experimental and traverse study in population of risk, in the service of Allergy and clinical Immunology of the Hospital Regional Lic. Adolfo López Mateos, ISSSTE. One hundred patients of both sexes were included, with age of 20 to 50 years, with the antecedent of being personal medical and paramedic and to have presented contact with latex material in a minimum period of one year. They were carried out clinical history with registration of sintomatology nasal, bronchial, cutaneous and associated to contact with latex. They were carried out cutaneous test for prick to latex with positive control with the help of histamine solution and negative control with solution of Evans and immediate reading of the same one. 22% of the patients in study, they presented positive skin test latex, with a time of exhibition 10 year-old average, 68% presented antecedent of atopy personal, family and, likewise the associate sintomatology was in a 33.3% dermatology, 54.5 nasal, nobody presented bronchial symptoms and a 9% asymptomatic was reported. We support that the immediate skin test latex for Prick is an important parameter of support diagnosis for allergy to type 1 latex.
Nitrile versus Latex for Glove Juice Sampling.
Landers, Timothy F; Dent, Anthony
2014-01-01
The objective of this study was to explore the utility of nitrile gloves as a replacement for latex surgical gloves in recovering bacteria from the hands. Two types of nitrile gloves were compared to latex gloves using the parallel streak method. Streaks of Klebsiella pneumoniae and Staphylococcus aureus were made on tryptic soy agar plates, and the zones of inhibition were measured around pieces of glove material placed on the plates. Latex gloves produced a mean zone of inhibition of 0.28 mm, compared to 0.002 mm for nitrile gloves (pnitrile may be a viable alternative to latex in glove juice sampling methods, since nitrile avoids the risk of latex exposure.
NMR relaxation times of natural rubber latex
International Nuclear Information System (INIS)
Harun, S.; Aziz, H.; Basir, Z.
1994-01-01
NMR relaxation times T sub 1 and T sub 2 of natural rubber latex have been measured at 25 degree C on a pulsed NMR spectrometer. The work focuses on the variation of the relaxation times with the amount of water content from 0% to 50%. The water content was adjusted by centrifuging and removing a certain amount of water from the sample. The data were analysed using a biexponential fitting procedure which yields simultaneously either T sub 1a and T sub 1b or T sub 2a and T sub 2b. The amount of solid was compared with the known amount of dry rubber content
Latex improvement of recycled asphalt pavement
Drennon, C.
1982-08-01
The performance of a single unmodified milled recycled asphalt concrete was compared to milled asphalt concrete modified by addition of three types of rubber latex. Latex was added at 2, 3, 5, and 8 percent latex by weight of asphalt in the asphalt concrete. Lattices used were a styrene butadiene (SBR), a natural rubber (NR), an acrylonitrile butadiene (NBR), and four varieties of out of specification SBR lattices. Marshall tests, while indecisive, showed a modest improvement in properties of SBR and NR added material at 3 and 5 percent latex. Addition of NBR latex caused deterioration in Marshall stability and flow over that of control. Repeated load tests were run using the indirect tensile test, analyzed by the VESYS program, which computes life of pavements. Repeated load tests showed improvement in asphalt concrete life when 3 and 5 percent SBR was added. Improvement was also shown by the out of specification SBR.
Directory of Open Access Journals (Sweden)
E. E. Abano
2013-01-01
Full Text Available The effects of ascorbic acid, salt solution, lemon juice, and honey pretreatment on the drying kinetics and sensory characteristics were studied. Pretreatments used affected the effective moisture diffusivity and rehydration properties of the dried mangoes. The effective moisture diffusivity values were 2.22 × 10-10 m2/s for ascorbic acid, 1.80 × 10-10 m2/s for salt solution, 2.01 × 10-10 m2/s for lemon juice, 1.93 × 10-10 m2/s for honey pretreated mangoes, and 2.31 × 10-10 m2/s for the control slices. Pretreatments enhanced the drying rate potential of mangoes. Among the thin-layer drying models fitted to the experimental data, the Middil model gave the best fit. The ascorbic acid pretreated samples were the best while the salt solution ones were the poorest with respect to reconstitution capacity. Consumer studies for overall preference for taste, colour, texture, flavour and chewiness of the dried products revealed that there was a higher preference for honey pretreated dried samples followed by the ascorbic acid, control, lemon juice, and salt solution pretreated samples. The results demonstrate that these pretreatments can be applied to enhance the moisture transport during drying and the quality of the dried products.
Kimata, Hajime
2006-07-01
Allergic responses are enhanced by stress, whereas they are reduced by laughter in atopic eczema patients. Emotion with tears decreases plasma IL-6 levels in patients with rheumatoid arthritis. Thus, the effect of emotion with tears on allergic responses in patients with atopic eczema was studied. Sixty patients with atopic eczema having latex allergy viewed both the weather information video and the heart-warming movie, Kramer vs. Kramer. Just before and immediately after viewing each video, allergic responses to latex were measured. Viewing the weather information video did not cause emotion with tears in any patients, and it failed to modulate allergic responses. In contrast, viewing Kramer vs. Kramer caused emotion with tears in 44 of 60 patients, and it reduced allergic skin wheal responses to latex and latex-specific IgE production in them. Emotion with tears reduced allergic responses, and it may be useful in the treatment of allergic diseases.
Nitrile versus Latex for Glove Juice Sampling.
Directory of Open Access Journals (Sweden)
Timothy F Landers
Full Text Available The objective of this study was to explore the utility of nitrile gloves as a replacement for latex surgical gloves in recovering bacteria from the hands. Two types of nitrile gloves were compared to latex gloves using the parallel streak method. Streaks of Klebsiella pneumoniae and Staphylococcus aureus were made on tryptic soy agar plates, and the zones of inhibition were measured around pieces of glove material placed on the plates. Latex gloves produced a mean zone of inhibition of 0.28 mm, compared to 0.002 mm for nitrile gloves (p<.001. While the parallel streak method is not intended as a quantitative estimate of antimicrobial properties, these results suggest that nitrile may be a viable alternative to latex in glove juice sampling methods, since nitrile avoids the risk of latex exposure.
Dongen, M R C van
2012-01-01
LaTeX is a free, automated state-of-the-art typesetting system. This book teaches all the ins and outs of LaTeX which are needed to write an article, report, thesis, or book. The book teaches by example, giving many worked out examples showing input and output side by side. The book presents the most recent techniques for presenting data plots, complex graphics, and computer presentations, but does not require previous knowledge. However, it is also a reference for the more seasoned user, with pointers to modern techniques and packages. Recurring themes in the book are consistent and effective
Hierarchically structured self-supported latex films for flexible and semi-transparent electronics
International Nuclear Information System (INIS)
Määttänen, Anni; Ihalainen, Petri; Törngren, Björn; Rosqvist, Emil; Pesonen, Markus; Peltonen, Jouko
2016-01-01
Graphical abstract: - Highlights: • Transparent self-supported latex films were fabricated by a peel-off process. • Various template substrates were used for creating e.g. hierarchically structured latex films. • Ultra-thin and semi-transparent conductive gold electrodes were evaporated on the latex films.Electrochemical experiments were carried out to verify the applicability of the electrodes. - Abstract: Different length scale alterations in topography, surface texture, and symmetry are known to evoke diverse cell behavior, including adhesion, orientation, motility, cytoskeletal condensation, and modulation of intracellular signaling pathways. In this work, self-supported latex films with well-defined isotropic/anisotropic surface features and hierarchical morphologies were fabricated by a peel-off process from different template surfaces. In addition, the latex films were used as substrates for evaporated ultrathin gold films with nominal thicknesses of 10 and 20 nm. Optical properties and topography of the samples were characterized using UV–vis spectroscopy and Atomic Force Microscopy (AFM) measurements, respectively. The latex films showed high-level transmittance of visible light, enabling the fabrication of semi-transparent gold electrodes. Electrochemical impedance spectroscopy (EIS) measurements were carried out for a number of days to investigate the long-term stability of the electrodes. The effect of 1-octadecanethiol (ODT) and HS(CH_2)_1_1OH (MuOH) thiolation and protein (human serum albumin, HSA) adsorption on the impedance and capacitance was studied. In addition, cyclic voltammetry (CV) measurements were carried out to determine active medicinal components, i.e., caffeic acid with interesting biological activities and poorly water-soluble anti-inflammatory drug, piroxicam. The results show that the fabrication procedure presented in this study enables the formation of platforms with hierarchical morphologies for multimodal (optical and
Hierarchically structured self-supported latex films for flexible and semi-transparent electronics
Energy Technology Data Exchange (ETDEWEB)
Määttänen, Anni, E-mail: anni.maattanen@abo.fi [Laboratory of Physical Chemistry, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland); Ihalainen, Petri, E-mail: petri.ihalainen@abo.fi [Laboratory of Physical Chemistry, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland); Törngren, Björn, E-mail: bjorn.torngren@abo.fi [Laboratory of Physical Chemistry, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland); Rosqvist, Emil, E-mail: emil.rosqvist@abo.fi [Laboratory of Physical Chemistry, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland); Pesonen, Markus, E-mail: markus.pesonen@abo.fi [Physics, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland); Peltonen, Jouko, E-mail: jouko.peltonen@abo.fi [Laboratory of Physical Chemistry, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland)
2016-02-28
Graphical abstract: - Highlights: • Transparent self-supported latex films were fabricated by a peel-off process. • Various template substrates were used for creating e.g. hierarchically structured latex films. • Ultra-thin and semi-transparent conductive gold electrodes were evaporated on the latex films.Electrochemical experiments were carried out to verify the applicability of the electrodes. - Abstract: Different length scale alterations in topography, surface texture, and symmetry are known to evoke diverse cell behavior, including adhesion, orientation, motility, cytoskeletal condensation, and modulation of intracellular signaling pathways. In this work, self-supported latex films with well-defined isotropic/anisotropic surface features and hierarchical morphologies were fabricated by a peel-off process from different template surfaces. In addition, the latex films were used as substrates for evaporated ultrathin gold films with nominal thicknesses of 10 and 20 nm. Optical properties and topography of the samples were characterized using UV–vis spectroscopy and Atomic Force Microscopy (AFM) measurements, respectively. The latex films showed high-level transmittance of visible light, enabling the fabrication of semi-transparent gold electrodes. Electrochemical impedance spectroscopy (EIS) measurements were carried out for a number of days to investigate the long-term stability of the electrodes. The effect of 1-octadecanethiol (ODT) and HS(CH{sub 2}){sub 11}OH (MuOH) thiolation and protein (human serum albumin, HSA) adsorption on the impedance and capacitance was studied. In addition, cyclic voltammetry (CV) measurements were carried out to determine active medicinal components, i.e., caffeic acid with interesting biological activities and poorly water-soluble anti-inflammatory drug, piroxicam. The results show that the fabrication procedure presented in this study enables the formation of platforms with hierarchical morphologies for multimodal
Cement-latex grouting mortar for cementing boreholes
Energy Technology Data Exchange (ETDEWEB)
Kateev, I S; Golyshkina, L A; Gorbunova, I V; Kurochkin, B M; Vakula, Ya V
1980-01-01
The need for the development of cement-latex grouting mortar for the purpose of separating strata when reinforcing boreholes at deposits in the Tatar Associated SSR is evaluated. Results of studies of the physical and mechanical properties of cement-latex grouting mortar systems (mortar plus brick) are presented. Formulas for preparing cement-latex grouting mortor are evaluated and results of industrial tests of such mortars shown.
Vollick, Brandon McRae
This thesis describes the preparation of iridescent, birefringent, composite films composed of cellulose nanocrystals (CNCs), latex nanoparticles (NPs) and a NP crosslinker; hexanediamine (HDA). First, aqueous suspensions were prepared with varying quantities of CNCs, NPs and HDA before equilibrating for one week. The cholesteric (Ch) phase was then cast and dried into a film. The optical, structural and mechanical properties of the film was analyzed. Second, films with identical compositions of CNCs, NPs, and HDA were fabricated in three different ways to yield films of different morphology, (i) fast drying of an isotropic suspension, yielding an isotropic film, (ii) slow drying of an isotropic suspension, yielding a partially Ch films, (iii) slow drying of an equilibrated suspension, yielding a highly Ch film. The optical and mechanical properties of the films was analyzed.
Directory of Open Access Journals (Sweden)
Flávio A. Carvalho
Full Text Available ABSTRACT Natural latex from Hevea brasiliensis (Wild. ex A.Juss Müll.Arg., Euphorbiaceae, showed angiogenic action and Casearia sylvestris Sw., Salicaceae, leaf derivatives presented anti-inflammatory and wound healing activities. Therefore, an association of these effects was interesting for wound healing applications. The aims of this study were the development of membranes of natural latex incorporated with C. sylvestris leaf derivatives (ethanolic extract, diterpene concentrated fraction and casearin J, their chemical and physical characterization, and the evaluation of in vitro skin permeation and retention of C. sylvestris bioactive secondary metabolites (diterpenes and phenolic compounds. The membranes were developed mixing hydroethanolic solutions of C. sylvestris derivatives with latex and drying them in a desiccator. They were characterized by infrared spectroscopy, scanning electron microscopy, water vapor permeability and mechanical resistance assays, demonstrating that all membranes were permeable, resistant and homogeneous in surfaces. The permeation and retention assays demonstrated dermal penetration of phenolic compounds for ethanolic extract membrane and of casearin-like clerodane diterpenes for all membranes, indicating that these membranes have great potential for therapeutical application as a topical system for C. sylvestris components releasing.
Allergy to latex in health workers
Directory of Open Access Journals (Sweden)
Fajardo-Zapata, Álvaro L.
2015-01-01
Full Text Available Introduction: A common and growing problem in hospitals is hypersensitivity to rubber latex antigens, since many products, including gloves, are manufactured from this material, with the consequent possibility of producing allergy in persons who use them. Objective: To find out if health workers at a fourth level clinic in Bogotá, Colombia, are allergic to rubber latex, in relation to the use of gloves. Materials and methods: Descriptive, cross-sectional study of a non-probabilistic intentional-type sample in each one of four hospital units. A survey was applied to participants. Results: 16 of the 26 persons (61.5% with history of allergic processes manifested some kind of reaction when they had contact with latex gloves; the problem was more significant in the nursing personnel compared to physicians. Conclusions: The exposure to latex gloves may be generating the appearance of allergic occupational disease in health workers.
Harahap, H.; Ridha, M.; Halimatuddahliana; Taslim; Iriany
2018-02-01
This study about the resistance of natural rubber latex films using nanocrystals cellulose filler from corn cob waste by aging treatment. Corn cob used as organic filler composed of cellulose, hemicellulose, and lignin. Each component has a potential for reuse, such as cellulose. Cellulose from corn cob has potential application as a filler prepared by hydrolysis process using a strong acid. The producing of natural rubber latex films through coagulant dowsing process. This research started with the pre-vulcanization process of natural rubber latex at 70 °C and followed by process of vulcanization at 110 °C for 20 minutes. Natural rubber latex films that have been produced continued with the aging treatment at 70 °C for 168 hours. The mechanical properties of natural rubber latex films after aging treatment are the tensile strength, elongation at break, M100 and M300 have performed.
Tetgure, Sandesh R; Borse, Amulrao U; Sankapal, Babasaheb R; Garole, Vaman J; Garole, Dipak J
2015-04-01
Simple and eco-friendly biosynthesis approach was developed to synthesize silver nanoparticles (SNPs) and gold nanoparticles (GNPs) using Ficus racemosa latex as reducing agent. The presence of sunlight is utilized with latex and achieved the nanoparticles whose average size was in the range of 50-120 nm for SNPs and 20-50 nm for GNPs. The synthesized nanoparticles were characterized by UV/Visible absorption spectroscopy, X-ray diffraction, and field emission-scanning electron microscopy techniques toget understand the obtained nanoparticles. The pH-dependent binding studies of SNPs and GNPs with four amino acids, namely L-lysine, L-arginine, L-glutamine and glycin have been reported.
Synthesis and characterization of novel polyacid-stabilized latexes.
Yang, Pengcheng; Armes, S P
2012-09-18
A series of novel polyacid macromonomers based on 2-hydroxypropyl methacrylate (HPMA) were prepared by atom transfer radical polymerization (ATRP) via a two-step route. First, a range of well-defined PHPMA homopolymer precursors were synthesized by ATRP using a tertiary amine-functionalized initiator, 2-(dimethylamino)ethyl-2-bromoisobutyrylamide, and a CuCl/2, 2'-bipyridine (bpy) catalyst in alcoholic media at 50 °C. ATRP polymerizations were relatively slow and poorly controlled in pure isopropanol (IPA), especially when targeting higher degrees of polymerization (DP > 30). Improved control was achieved by addition of water: low polydispersity (M(w)/M(n) propyl methacrylate) (PSPMA) macromonomers by quaternizing the tertiary amine end-group with excess 4-vinylbenzyl chloride, followed by esterification of the pendent hydroxyl groups using excess succinic anhydride at 20 °C. These polyacid macromonomers were evaluated as reactive steric stabilizers for polystyrene latex synthesis under either aqueous emulsion polymerization or alcoholic dispersion polymerization conditions. Near-monodisperse polystyrene latexes were obtained via aqueous emulsion polymerization using 10 wt % PSPMA macromonomer (with respect to styrene monomer) with various initiators as evidenced by scanning electron microscopy, disk centrifuge photosedimentometry and light scattering studies. PSPMA macromomer concentrations as low as 1.0 wt % also produced near-monodisperse latexes, suggesting that these PSPMA macromonomers are highly effective stabilizers. Alcoholic dispersion polymerization of styrene conducted in various ethanol/water mixtures with 10 wt % PSPMA(50) macromonomer produced relatively large near-monodisperse latexes. Increasing the water content in such formulations led to smaller latexes, as expected. Control experiments conducted with 10 wt % PSPMA(50) homopolymer produced relatively large polydisperse latexes via emulsion polymerization and only macroscopic precipitates via
Effects of Spray Drying on Physicochemical Properties of Chitosan Acid Salts
Cervera, Mirna Fernández; Heinämäki, Jyrki; de la Paz, Nilia; López, Orestes; Maunu, Sirkka Liisa; Virtanen, Tommi; Hatanpää, Timo; Antikainen, Osmo; Nogueira, Antonio; Fundora, Jorge; Yliruusi, Jouko
2011-01-01
The effects of spray-drying process and acidic solvent system on physicochemical properties of chitosan salts were investigated. Chitosan used in spray dryings was obtained by deacetylation of chitin from lobster (Panulirus argus) origin. The chitosan acid salts were prepared in a laboratory-scale spray drier, and organic acetic acid, lactic acid, and citric acid were used as solvents in the process. The physicochemical properties of chitosan salts were investigated by means of solid-state CP...
Pilot Scale Production of Irradiated Natural Rubber Latex and its Dipping Products
Directory of Open Access Journals (Sweden)
M. Utama
2005-07-01
Full Text Available One hundred and fifty kg natural rubber latex (NRL before and after concentration were added with 3 phr (part hundred ratio of rubber normal butyl acrylate, then the mixture were irradiated at 25 kGy by gamma rays of 60Co in pilot scale. The irradiated natural rubber latex (INRL were then being to use for producing rubber products such as condom, surgical gloves, and spygmomanometer in factory scale. The quality of INRL and rubber products such as : total solid content (TSC, dry rubber content (DRC, KOH, VFA and MST number, tensile strength, modulus, elongation at break, extractable protein content, and response against Type I allergy etc. were evaluated. The economic aspect for producing INRL by means of Gamma Irradiator (GI and Electron Beam Machine (EBM such as payback period (PP, net present value (NPV and internal rate return (IRR were calculated. The results showed that the latex properties of INRL such as DRC, TSC, KOH, VFA, and MST number are not only found to the requirement of the ISO 2004 standard but also the latex has low protein, lipid, and carbohydrate content. The physical and mechanical properties (tensile strength, modulus, and elongation at break of rubber dipping products such as condom, gloves, and sphygmomanometer are not only found to the requirement of ISO 4074, ISO 10282, and ANSI/AAMI SP-1994 standards, but also the allergic response tested clinical latex-sensitive protein allergen by ELISA test on gloves, and by SPT test on condom are found to be negative. It indicates that production of INRL or PVNRL or RVNRL by EBM 250 keV/10 mA, was more cheap than by using gamma γ irradiator 200 kCi, or sulfur vulcanization. The value of PBP (payback period was 2,1 years, NPV (net present value was 4,250 US $, PI (profitability index 1,06 and IRR (internal rate of returns was 25,0%.
Plant latex lipase as biocatalysts for biodiesel production | Mazou ...
African Journals Online (AJOL)
Plant latex lipase as biocatalysts for biodiesel production. ... This paper provides an overview regarding the main aspects of latex, such as the reactions catalyzed, physiological functions, specificities, sources and their industrial applications. Keywords: Plant latex, lipase, Transesterification, purification, biodiesel ...
Larese Filon, Francesca; Bochdanovits, Letizia; Capuzzo, Chiara; Cerchi, Roberto; Rui, Francesca
2014-07-01
To assess the incidence of sensitization and gloves-related symptoms in 10-year follow-up in a group of health care workers (9,660 person-years) using non-powdered latex gloves from 2000 to 2009 and to examine related factors. We studied 2,053 health care workers in Trieste Hospitals by means of skin prick test for latex extract, patch tests and medical examinations. We report the incidence of latex sensitization among workers using non-powdered latex gloves. The incidence of latex sensitization, rhinitis, asthma, urticaria, irritant and allergic contact dermatitis were 1.0; 0.12; 0.21; 0.72; 2.39 and 2.50 cases per 1,000 person-years, respectively. Respiratory symptoms and urticaria were positively related with latex sensitization (OR = 8.0; 95 % CL 1.27-48.6), with common allergic respiratory symptoms (OR = 4.19; 95 % CL 1.04-16.8) and with familial atopy (OR = 4.47; 95 % CL 1.1-17.9). The incidence of latex sensitization and latex-related symptoms were very low but subjects with allergic symptoms related to common allergens are at higher risk. The use of non-latex gloves is suggested for them.
Grätzer, George
2007-01-01
For close to two decades, Math into Latex has been the standard introduction and complete reference for writing articles and books containing mathematical formulas. In this fourth edition, the reader is provided with important updates on articles and books. An important new topic is discussed: transparencies (computer projections). Key features of More Math into Latex, 4th edition: Installation instructions for PC and Mac users; An example-based, visual approach and a gentle introduction with the Short Course; A detailed exposition of multiline math formulas with a Visual Guide; A unified appr
Recombinant albumin monolayers on latex particles.
Sofińska, Kamila; Adamczyk, Zbigniew; Kujda, Marta; Nattich-Rak, Małgorzata
2014-01-14
The adsorption of recombinant human serum albumin (rHSA) on negatively charged polystyrene latex micro-particles was studied at pH 3.5 and the NaCl concentration range of 10(-3) to 0.15 M. The electrophoretic mobility of latex monotonically increased with the albumin concentration in the suspension. The coverage of adsorbed albumin was quantitatively determined using the depletion method, where the residual protein concentration was determined by electrokinetic measurements and AFM imaging. It was shown that albumin adsorption was irreversible. Its maximum coverage on latex varied between 0.7 mg m(-2) for 10(-3) M NaCl to 1.3 mg m(-2) for 0.15 M NaCl. The latter value matches the maximum coverage previously determined for human serum albumin on mica using the streaming potential method. The increase in the maximum coverage was interpreted in terms of reduced electrostatic repulsion among adsorbed molecules. These facts confirm that albumin adsorption at pH 3.5 is governed by electrostatic interactions and proceeds analogously to colloid particle deposition. The stability of albumin monolayers was measured in additional experiments where changes in the latex electrophoretic mobility and the concentration of free albumin in solutions were monitored over prolonged time periods. Based on these experimental data, a robust procedure of preparing albumin monolayers on latex particles of well-controlled coverage and molecule distribution was proposed.
The Synthesis and Modification of Nanosized Clickable Latex Particles
Almahdali, Sarah
2013-05-01
This research aims to add to the current knowledge available for miniemulsion polymerization reactions and to use this knowledge to synthesize multifunctional nanosized latex particles that have the potential to be used in catalysis. The physical properties of the latex can be adjusted to suit various environments due to the multiple functional groups present. For this research, styrene, pentafluorostyrene, azidomethyl styrene, pentafluorostyrene with azidomethyl styrene and pentafluorostyrene with styrene latexes were produced, and analyzed by dynamic light scattering. The latexes were synthesized using a miniemulsion polymerization technique found through this research. Potassium oleate and potassium 1,1,2,2,3,3,4,4-nonafluorobutane-1-sulfonate were used as surfactants during the miniemulsion polymerization reaction to synthesize pentafluorostyrene with azidomethyl styrene latex. Transmission electron microscopy data and dynamic light scattering data have been collected to analyze the structure of this latex, and it has been synthesized using a number of conditions, differing in reaction time, surfactant amount and sonication methods. We have also improved the solubility of the latex through a copper(I) catalyzed 1,3-dipolar azide-alkyne reaction, by clicking (polyethylene glycol)5000 onto the azide functional groups.
[Latex allergy in a paediatric hospital. Characteristics and risk factors].
Bailey, Michael; Norambuena, Ximena; Roizen, Gigia; Rodríguez, Jorge; Quezada, Arnoldo
The prevalence of latex sensitisation varies according to the population studied. There are various risk factors that increase latex sensitisation, such as genetic risk, atopy, and multiple surgeries. To characterise patients referred to an Immunology Unit with suspected latex allergy, and to analyse their clinical features and risk factors. A retrospective, descriptive study was conducted on children suspected of latex allergy. Their medical records were reviewed in order to assess symptoms with contact or exposure to latex materials. Known risk factors to latex sensitisation, such as pathologies requiring repeated surgery (spina bifida, myelomeningocele, scoliosis and nephro-urological alterations), atopy (rhinitis, asthma, atopic dermatitis) were investigated. A prick test and/or specific IgE to latex were also performed. A multivariate logistic regression model was performed to find associations between symptoms triggered by exposure to latex with underlying diseases and other risk conditions. A total of 106 patients were enrolled in the study, of whom 50 were evaluable. At diagnosis 96% of patients were older than five years. Most of the risk factors described were observable in these patients, such as multiple surgeries, neurological and nephro-urological malformations, surgery before one year-old, and repeated bladder catheterisation. After latex exposure, mucous cutaneous manifestations were the most common (52%), followed by respiratory symptoms (36%). All patients were sensitised and allergic to latex. Latex allergy is a significant problem in children with risk factors. The results shown in this study raise important challenges for preventive measures and awareness. Copyright © 2016 Sociedad Chilena de Pediatría. Publicado por Elsevier España, S.L.U. All rights reserved.
Isolation and characterization of latex-specific promoters from Papaver somniferum L.
Raymond, Michelle Jean
2004-01-01
The pharmacologically important alkaloids morphine and codeine are found in latex of opium poppy (Papaver somniferum). Latex is harbored in laticifers, a specialized vascular cell-type. Isolation and characterization of latex-specific genes may provide a useful tool to metabolically engineer increased alkaloid production. Previous research in the Nessler laboratory identified genes that exhibit latex-specific gene expression. Latex-specific genes were an 2-oxoglutarate-dioxygense (DIOX), ...
Thermodynamics of swelling of latex particles with two monomers
Maxwell, I.A.; Kurja, J.; van Doremaele, G.H.J.; German, A.L.
1992-01-01
The partitioning of 2 monomers between the latex particle, monomer droplet, and aq. phases of an emulsion polymer latex are measured at satn. swelling of the latex particle phase (corresponding to intervals I and II of an emulsion polymn.). The monomer (Me acrylate, Bu acrylate, styrene) and polymer
Encapsulation of Clay Platelets inside Latex Particles
Voorn, D.J.; Ming, W.; Herk, van A.M.; Fernando, R.H.; Sung, Li-Piin
2009-01-01
We present our recent attempts in encapsulating clay platelets inside latex particles by emulsion polymerization. Face modification of clay platelets by cationic exchange has been shown to be insufficient for clay encapsulation, leading to armored latex particles. Successful encapsulation of
Preparation of highly stabilised natural rubber latex for radiation vulcanisation
International Nuclear Information System (INIS)
Kulatunge, S.S.; Nadarajah, M.; Kalyani, N.M.V.; Chandralal, H.N.K.K.; Devendra, R.
1996-01-01
There is a bright future for radiation vulcanised natural rubber latex (RVNRL) but there are problems in manufacturing it as the centrifuged latex to be used for radiation has to be kept for at least a month or sometimes even three to six months before adding the sensitisers and even then the latex sometimes coagulates on adding the sensitisers. This paper describes a process by which the latex can be stabilised by addition of an anionic soap before centrifuging so that it has a high mechanical stability and hence can be used even within one week of the manufacture of the centrifuged latex
The Morphology of Emulsion Polymerized Latex Particles
Wignall, G. D.; Ramakrishnan, V. R.; Linne, M. A.; Klein, A.; Sperling, L. H.; Wai, M. P.; Gelman, R. A.; Fatica, M. G.; Hoerl, R. H.; Fisher, L. W.
1987-11-01
Under monomer starved feed conditions, emulsion polymerization of perdeuterated methyl methacrylate and styrene in the presence of preformed polymethylmethacrylate latexes resulted in particles with a core-shell morphology, as determined by small-angle neutron scattering (SANS) analysis for a hollow sphere. The locus of polymerization of the added deuterated monomer is therefore at the particle surface. In similar measurements a statistical copolymer of styrene and methyl methacrylate was used as seed particles for further polymerization of trideuteromethyl methacrylate. The resulting polymer latex was again shown to have a core-shell morphological structure as determined by SANS. SANS experiments were also undertaken on polystyrene latexes polymerized by equilibrium swelling methods, with deuterated polymer forming the first or second step. The experiments covered a molecular weight range of 6 x 10{sup 4} 10{sup 6} the molecular weights are consistent with the experimental errors, indicating that the deuterium labeled molecules are randomly distributed in the latex. These results led to the finding that the polymer chains were constrained in the latex particles by factors of 2 to 4 from the relaxed coil dimensions. For M molecules. Several models were examined, including the possible development of core-shell structures at lower molecular weights.
Troubleshooting for the observed problems in processing latex concentrate from natural resource
International Nuclear Information System (INIS)
Afreen, S; Haque, K R; Huda, M K
2013-01-01
Natural latex has special importance in the rubber industry for manufacturing different types of goods like gloves, balloons, male contraceptive and similar thin walled articles. This natural latex is much more sensitive a liquid to handle since it can easily become contaminated and thereby coagulated which makes it unfavourable for centrifuge and getting concentrate from it. Some other related measures also are included in consideration during the processing of concentrate latex from the natural raw latex. The problems that are being faced in a concentrate latex processing plant can be categorized in different groups like, problems related to the latex property, mechanical problems, electrical problems, handling and storage problems, transformation problems, problems related to environmental issues, etc. Among them, the most common and vital problems frequently observed in a concentrate latex processing plant are discussed here with a view to finding the measures for solution which will help to maintain the latex property in any latex processing plant.
Radiation vulcanization of Philippine natural rubber latex
International Nuclear Information System (INIS)
Dela Rosa, Alumanda M.; Abad, Lucille V.; Sta, Lorna P.; Ana-Relleve; Tranquilan-Aranilla, Charito O.; Pascual, Cristina L.
1996-01-01
The response of Philippine natural rubber latex to radiation vulcanization and the stability of the irradiated natural rubber latex (INRL) upon storage and aging were investigated. Commercially available high ammonia (HA) concentrated lattices obtained from various rubber plantations in Mindanao Island were treated with 5 phr of n-butyl acrylate (nBA), and gamma-irradiated at the PNRI sup 60 Co irradiation facility at dose rate of 2.57 KGy/hr. Unirradiated cast latex films gave different green strength which varied from 2 - 11 MPa. Cast films from INRL exhibited maximum tensile strengths of 25 - 32 MPa at a radiation dose of 15 kGy. Higher tensile strengths were obtained from cast films with low Mg and high nitrogen contents. Thermal analysis using thermogravimetry (TG) revealed one major decomposition product at 374 degree C - 377 degree C. Its rate of decomposition decreased to a minimum at 15 kGy, then increased as radiation dose increased. This trend correlated well with the tensile strength measurements. The stability of the INRL upon storage and aging is an essential parameter to the rubber latex industry. For storage studies, INRL was stored for various periods of time. It was found that the pH and total solids content of the stored INRL did not change significantly after 12 months of storage; the MST values remained at above 100 seconds, and the viscosity decreased with time. The cast films exhibited a decline in tensile strength, modulus 300% and crosslinking density upon storage. While there were observed changes in the physical properties of the IRNL during the storage period, the data indicate that these properties were within values acceptable to the latex industry. Tests on the aging properties of INRL film were undertaken. It was shown that among the chemical antioxidants presently used by the latex industry. TNPP demonstrated the highest antioxidant property, followed by Antage DAHQ and Vulcanox BKF. Our data indicate that the natural rubber latex
Radiation vulcanization of Philippine natural rubber latex
International Nuclear Information System (INIS)
Dela Rosa, A.M.; Abad, L.V.; Sta.Ana-Relleve, L.P.; Tranquilan-Aranilla, C.O.; Pascual, C.L.
1996-01-01
The response of Philippine natural rubber latex to irradiation vulcanization and the stability of the irradiated natural rubber latex (INRL) upon storage and aging were investigated. Commercially available high ammonia (HA) concentrated latices obtained from various rubber plantations in Mindanao island were treated with 5 phr of n-butyl acrylate (nBA), and gamma-irradiated at the PNRI 60 Co irradiation facility at a dose rate of 2.57 kGy/hr. Unirradiated cast latex films gave different green strengths which varied from 2-11 MPa. Cast films from INRL exhibited maximum tensile strengths were obtained from cast films with low Mg and high nitrogen contents. Thermal analysis using thermogravimetry (TG) revealed one major decomposition product at 374 o -377 o C. Its rate of decomposition decreased to a minimum at 15 kGy, then increased as radiation dose was increased. This trend correlated well with the tensile strength measurements. The stability of the INRL upon storage and aging is an essential parameter to the rubbe latex industry. For storage studies, INRL was stored for various periods of time. It was found that the pH and total solids content of the stored INRL did not change significantly after 12 months of storage; the MST values remained at above 1000 seconds, and the viscosity decreased with time. The cast films exhibited a decline in tensile strength, modulus 300% , and crosslinking density upon storage. While there were observed changes in the physical properties of the INRL during the storage period, the data indicate that these properties were within values acceptable to the latex industry. Tests on the aging properties of INRL films were undertaken. It was shown that among the chemical antioxidants presently used by the latex industry, TNPP demonstrated the highest antioxidant property, followed by Antage DAHQ and Vulcanox BKF. Our data indicate that the natural rubber latex produced and processed in the Philippines is suited for radiation vulcanization
CHARACTERIZATION AND RECYCLING OF WASTE WATER FROM GUAYULE LATEX EXTRACTION
Guayule commercialization for latex production to be used in medical products and other applications is now a reality. Currently, waste water following latex extraction is discharged into evaporation ponds. As commercialization reaches full scale, the liquid waste stream from latex extraction will b...
EDITORIALS Latex allergy: 'Plight, rights and fights'
African Journals Online (AJOL)
anaphylaxis and life-threatening food allergies to cross-reacting fruit allergens such as kiwi, banana, tomato and chestnuts). Latex allergy is also encountered more frequently in children with spina bifida than in other hospitalised children.[7] Sensitisation is usually confirmed by commercial latex allergy skinprick testing or by ...
Size effects of latex nanomaterials on lung inflammation in mice
International Nuclear Information System (INIS)
Inoue, Ken-ichiro; Takano, Hirohisa; Yanagisawa, Rie; Koike, Eiko; Shimada, Akinori
2009-01-01
Effects of nano-sized materials (nanomaterials) on sensitive population have not been well elucidated. This study examined the effects of pulmonary exposure to (latex) nanomaterials on lung inflammation related to lipopolysaccharide (LPS) or allergen in mice, especially in terms of their size-dependency. In protocol 1, ICR male mice were divided into 8 experimental groups that intratracheally received a single exposure to vehicle, latex nanomaterials (250 μg/animal) with three sizes (25, 50, and 100 nm), LPS (75 μg/animal), or LPS plus latex nanomaterials. In protocol 2, ICR male mice were divided into 8 experimental groups that intratracheally received repeated exposure to vehicle, latex nanomaterials (100 μg/animal), allergen (ovalbumin: OVA; 1 μg/animal), or allergen plus latex nanomaterials. In protocol 1, latex nanomaterials with all sizes exacerbated lung inflammation elicited by LPS, showing an overall trend of amplified lung expressions of proinflammatory cytokines. Furthermore, LPS plus nanomaterials, especially with size less than 50 nm, significantly elevated circulatory levels of fibrinogen, macrophage chemoattractant protein-1, and keratinocyte-derived chemoattractant, and von Willebrand factor as compared with LPS alone. The enhancement tended overall to be greater with the smaller nanomaterials than with the larger ones. In protocol 2, latex nanomaterials with all sizes did not significantly enhance the pathophysiology of allergic asthma, characterized by eosinophilic lung inflammation and Igs production, although latex nanomaterials with less than 50 nm significantly induced/enhanced neutrophilic lung inflammation. These results suggest that latex nanomaterials differentially affect two types of (innate and adaptive immunity-dominant) lung inflammation
Acidic mammalian chitinase in dry eye conditions.
Musumeci, Maria; Aragona, Pasquale; Bellin, Milena; Maugeri, Francesco; Rania, Laura; Bucolo, Claudio; Musumeci, Salvatore
2009-07-01
An acidic mammalian chitinase (AMCase) seems to be implicated in allergic asthma and allergic ocular pathologies. The aim of this work was to investigate the role of AMCase during Sjögren's Syndrome (SS) and Meibomian Gland Dysfunction (MGD) dry eye diseases. Six patients with MGD dry eye (20-58 years, median 40) and six patients with dry eye associated to SS (32-60 years, median 47) were enrolled in this study. AMCase activity was measured in tears and AMCase mRNA expression was evaluated by real-time polymerase chain reaction from RNA extracted from epithelial cells of the conjunctiva. Six healthy adult subjects of the same age (34-44 years, median 39) were also studied as the control group. AMCase activity was significantly increased in patients affected by MGD dry eye (18.54 +/- 1.5 nmol/ml/h) and SS dry eye (8.94 +/- 1.0 nmol/ml/h) respectively, compared to healthy controls (1.6 +/- 0.2 nmol/ml/h). AMCase activity was higher in the tears of subjects with MGD dry eye (P < 0.001). AMCase mRNA was detected in conjunctival epithelial cells and the expression was significantly higher in MGD dry eye than SS dry eye. A significant correlation between AMCase activity in the tears and mRNA in conjunctival epithelial cells was found. AMCase may be an important marker in the pathogenesis of dry eye, suggesting the potential role of AMCase as a therapeutic target in these frequent pathologies.
Surface fixation of dried blood by glutaraldehyde and peracetic acid.
Kampf, G; Bloss, R; Martiny, H
2004-06-01
The difficulties of successful prion inactivation by chemical agents has led to changes in recommendations regarding the reprocessing of instruments including flexible endoscopes. One of the changes is the preference for peracetic acid instead of glutaraldehyde in order to avoid fixation of organic material, but the surface fixation by various active agents has not been fully investigated. We used a standardized amount of dried blood soil on metal carriers (on average 22 mg). One part of the carriers was exposed to different disinfectants (four based on peracetic acid, three based on glutaraldehyde, two based on quaternary ammonium compounds (QAC), one based on QAC and amines, one based on phenols and one cleaning agent) and air dried. The difference compared with the non-exposed soiled carrier was taken as the measure of blood removal by exposure to the disinfectants. In addition the other part of the carriers was exposed to a cleaning agent and air dried. The cleaning agent itself was capable of removing more than 99% of the dried blood and served as a control for non-fixation. The rate of fixation of dried blood was calculated as the ratio of the weight of residual soil on 'soiled, disinfected and cleaned' carriers and on 'soiled and disinfected' carriers. All experiments were repeated eight times. Blood removal varied between 90.3% +/- 1.5% (phenol-based disinfectant) and peracetic acid. No other preparations showed a potential for blood fixation (peracetic acid, and support the evidence that effective cleaning should precede the chemical disinfection. Copyright 2004 The Hospital Infection Society
Karisola, Piia; Mikkola, Jari; Kalkkinen, Nisse; Airenne, Kari J; Laitinen, Olli H; Repo, Susanna; Pentikäinen, Olli T; Reunala, Timo; Turjanmaa, Kristiina; Johnson, Mark S; Palosuo, Timo; Kulomaa, Markku S; Alenius, Harri
2004-02-15
Recently we have established that IgE Abs bind to conformational epitopes in the N- and C-terminal regions of the major natural rubber latex allergen, hevein (Hev b 6.02). To identify the critical amino acid residues that interact with IgE, the hevein sequence was scanned by using site-specific mutations. Twenty-nine hevein mutants were designed and produced by a baculovirus expression system in insect cells and tested by IgE inhibition-ELISA using sera from 26 latex allergic patients. Six potential IgE-interacting residues of hevein (Arg(5), Lys(10), Glu(29), Tyr(30), His(35), and Gln(38)) were identified and characterized further in detail. Based on these six residues, two triple mutants (Hdelta3A, Hdelta3B) and hevein mutant where all six residues were mutated (Hdelta6), were designed, modeled, and produced. Structural and functional properties of these combinatory mutants were compared experimentally and in silico with those of recombinant hevein. The IgE-binding affinity of the mutants decreased by three to five orders of magnitude as compared with that of recombinant hevein. Skin prick test reactivity of the triple mutant HDelta3A was drastically reduced and that of the six-residue mutant Hdelta6 was completely abolished in all patients examined in this study. The approach presented in this paper offers tools for identification and modification of amino acid residues on conformational epitopes of allergens that interact with IgE. Hevein with a highly reduced ability to bind IgE should provide a valuable candidate molecule for immunotherapy of latex allergy and is anticipated to have a low risk of systemic side effects.
Home Healthcare Workers: How to Prevent Latex Allergies
... can help prevent allergic reactions for both home healthcare workers and their clients. LATEX EXPOSURE REACTIONS Three ... being used). • Inform your employer and your personal healthcare professionals that you have latex allergy. • Wear a ...
Essential fatty acids in the treatment of dry eye syndrome: A myth or reality?
Al Mahmood, Ammar M.; Al-Swailem, Samar A.
2014-01-01
Dry eye is a common condition that can severely impair the quality of life. Systemic and topical omega-3 fatty acids and omega-6 fatty acids have been used as treatment for patients with dry eye disease and showed promising results. Further multicenter randomized controlled trials are required in order to establish a standardized protocol for the treatment of dry eye syndrome with those essential fatty acids.
Pongsathit, Siriwan; Pattamaprom, Cattaleeya
2018-03-01
Maleic anhydride (MA) is an interesting monomer to be grafted onto natural rubber(NR) due to its potential as a compatibilizer of hydrophobic rubbers and polymers with higher polarity. So far, radiation grafting of MA onto NR in latex state has not been reported. In this study, the grafting of NR with MA in latex state was investigated by exposing the latex to cobalt-60 gamma irradiation at a fixed MA content of 9% and a varied absorbed doses from 2 to 10 kGy. The FTIR spectrometer, 1H NMR spectrometer and gel content analysis have confirmed successful grafting of MA onto NR after irradiation. The grafted NRs were then used to increase the compatibility and the impact property of PLA/NR blends. It was found that the highest impact strength of the blends was achieved when the grafting was carried out at the absorbed dose of 4 kGy.
Angiogenic activity of Synadenium umbellatum Pax latex
Directory of Open Access Journals (Sweden)
PR. Melo-Reis
Full Text Available Synadenium umbellatum Pax, popularly known as "cola-nota", is a medicinal plant that grows in tropical regions. Latex of this plant is used to treat various diseases such as diabetes mellitus, Hansen´s disease, tripanosomiases, leukemia and several malignant tumors. In the present study, the angiogenic activity of S. umbellatum latex was evaluated using the chick embryo chorioallantoic membrane (CAM assay. Results showed significant increase of the vascular net (p < 0.05 compared to the negative control (H2O. The histological analysis was in accordance with the results obtained. In conclusion, our data indicate that S. umbellatum latex, under the conditions of this research, presented angiogenic effect.
Zhiyi, Nie; Guijuan, Kang; Yu, Li; Longjun, Dai; Rizhong, Zeng
2015-01-01
The ATP-binding cassette (ABC) proteins or transporters constitute a large protein family in plants and are involved in many different cellular functions and processes, including solute transportation, channel regulation and molecular switches, etc. Through transcriptome sequencing, a transcriptome-wide survey and expression analysis of the ABC protein genes were carried out using the laticiferous latex from Hevea brasiliensis (rubber tree). A total of 46 putative ABC family proteins were identified in the H. brasiliensis latex. These consisted of 12 'full-size', 21 'half-size' and 13 other putative ABC proteins, and all of them showed strong conservation with their Arabidopsis thaliana counterparts. This study indicated that all eight plant ABC protein paralog subfamilies were identified in the H. brasiliensis latex, of which ABCB, ABCG and ABCI were the most abundant. Real-time quantitative reverse transcription-polymerase chain reaction assays demonstrated that gene expression of several latex ABC proteins was regulated by ethylene, jasmonic acid or bark tapping (a wound stress) stimulation, and that HbABCB15, HbABCB19, HbABCD1 and HbABCG21 responded most significantly of all to the abiotic stresses. The identification and expression analysis of the latex ABC family proteins could facilitate further investigation into their physiological involvement in latex metabolism and rubber biosynthesis by H. brasiliensis.
Ferreira, Jorge F S; Luthria, Devanand L
2010-02-10
There is limited information on how postharvest drying of Artemisia annua affects artemisinin (ART) biosynthesis and A. annua antioxidant capacity. Antioxidants may boost the bioactivity of ART and the crop commercial value. We evaluated the effect of freeze, oven, shade, and sun drying, time of drying, and light intensity on the leaf concentration of ART, dihydroartemisinic acid (DHAA), artemisinic acid (AA), and on the leaf antioxidant capacity. Freeze-dried samples had the lowest ART concentrations as compared to the other drying methods. However, the ferric reducing antioxidant power assay showed that freeze- and oven-dried samples had similarly high antioxidant activities, which declined significantly after plants were shade- and sun-dried. Shade drying for 1, 2, and 3 weeks, under ambient or low light, did not change the ART content but significantly decreased the leaf antioxidant activity, mainly if sun-dried. A significant decrease (82% average) in DHAA was observed for all drying procedures as compared to freeze drying, with a simultaneous, significant increase in ART (33% average). The average bioconversion of DHAA to ART was 43% for oven- and shade-dried plants and 94% for sun-dried plants, reiterating the hypothesis that DHAA, not AA, is the main biosynthetic precursor of ART and suggesting that sun drying improves the bioconversion from DHAA to ART. Data also indicate that oven drying for 24 h at 45 degrees C can provide good levels of both ART and antioxidants in leaves. These findings are valuable for the commercial production of ART and of bioactive antioxidants that might synergize with the antimalarial and anticancer effects of ART when combined in traditional preparations to improve human and animal health.
Enhanced protein adsorption and patterning on nanostructured latex-coated paper.
Juvonen, Helka; Määttänen, Anni; Ihalainen, Petri; Viitala, Tapani; Sarfraz, Jawad; Peltonen, Jouko
2014-06-01
Specific interactions of extracellular matrix proteins with cells and their adhesion to the substrate are important for cell growth. A nanopatterned latex-coated paper substrate previously shown to be an excellent substrate for cell adhesion and 2D growth was studied for directed immobilization of proteins. The nanostructured latex surface was formed by short-wavelength IR irradiation of a two-component latex coating consisting of a hydrophilic film-forming styrene butadiene acrylonitrile copolymer and hydrophobic polystyrene particles. The hydrophobic regions of the IR-treated latex coating showed strong adhesion of bovine serum albumin (cell repelling protein), fibronectin (cell adhesive protein) and streptavidin. Opposite to the IR-treated surface, fibronectin and streptavidin had a poor affinity toward the untreated pristine latex coating. Detailed characterization of the physicochemical surface properties of the latex-coated substrates revealed that the observed differences in protein affinity were mainly due to the presence or absence of the protein repelling polar and charged surface groups. The protein adsorption was assisted by hydrophobic (dehydration) interactions. Copyright © 2014 Elsevier B.V. All rights reserved.
Studies on physico-chemical and mechanical properties of the irradiated latex modified mortar
International Nuclear Information System (INIS)
Yassene, A.A.M.A.
2009-01-01
This thesis contains three chapter; chapter(I): Introduction and literature review on:- Introduction to polymer. - Mechanism of polymer-cement co-matrix formation.-Sulphate attack. - Solidification /stabilization of heavy metal in cement mortar. chapter(II): Materials and experimental techniques that include: 1- Preparation of latex polymer films from different polymer latices of styrene butadine rubber latex (SBR), poly (styrene-acrylic ester) latex (SAE) and vinylacetate /versatic -ester copolymer latex (C2A). The effect of γ-irradiation dose on the physico - chemical and mechanical properties of different latex polymer films was studied.2- Preparation of latex polymer-modified cement mortar with different ratios of cement: latex polymer and different curing method.3- Solidification /stabilization (S/S) of electroplating heavy metal precipitate in latex polymer- modified mortar with different cement /electroplating heavy metal sludge ratio. chapter(III) results and discussion
PS-HEMA latex fractionation by sedimentation and colloidal crystallization
Directory of Open Access Journals (Sweden)
Cardoso André H.
1999-01-01
Full Text Available A poly(styrene-co-hydroxyethylmethacrylate latex underwent sedimentation under gravity followed by an spontaneous and extensive colloidal crystallization. It was then fractionated in three visually distinguishable layers. Latex aliquots layers were sampled at different heigths and the particles were characterized by PCS, microelectrophoresis, infrared spectra and analytical electron microscopy. The major fraction was opalescent and contained the colloidal crystals settled in the bottom of the liquid. Two other latex fractions were obtained, which differed in their chemical compositions, particle sizes and topochemical features from the self-arraying particles. Macrocrystallization of the fractionated latex yielded high quality crystals with a low frequency of defects, which confirms that particle chemical homogeneity is an important factor for particle self-arraying.
Integration of Succinic Acid Production in a Dry Mill Ethanol Facility
Energy Technology Data Exchange (ETDEWEB)
None
2006-08-01
This project seeks to address both issues for a dry mill ethanol biorefinery by lowering the cost of sugars with the development of an advanced pretreatment process, improving the economics of succinic acid (SA), and developing a model of an ethanol dry mill to evaluate the impact of adding different products and processes to a dry mill.
Directory of Open Access Journals (Sweden)
Thiago Lustosa Jucá
2013-01-01
Full Text Available Calotropis procera is a medicinal plant whose pharmacological properties are associated with its latex. Here, the Calotropis procera latex fractions were investigated in an attempt to trace its phytochemical profile and measure its anti-inflammatory and toxicity activity. The crude latex was partitioned, yielding five fractions (49.4% hexane, 5.2% dichloromethane, 2.0% ethyl acetate, 2.1% n-butanol, and 41.1% aqueous. Phytochemical screening and spectroscopy analysis revealed that dichloromethane is the most chemically diverse fraction. Triterpenes were detected in both the hexane and dichloromethane fractions, while flavonoids were detected in the dichloromethane and ethyl acetate fractions. These fractions were cytotoxic to cancer cell lines (LD50 0.05 to 3.9 μg/mL and lethal to brine shrimp (LD50 10.9 to 65.7 μg/mL. Reduced neutrophil migration in rats was observed in carrageenan-induced peritonitis for the dichloromethane (67%, ethyl acetate (56%, and aqueous (72% fractions. A positive reaction with tolidine and ninhydrin suggested that cyclopeptides are in the ethyl acetate fraction. It is therefore concluded that Calotropis procera latex dichloromethane and ethyl acetate fractions exhibit both in vitro and in vivo activities as well as anti-inflammatory properties. Cyclopeptide detection is especially interesting because previous attempts to investigate these low-molecular cyclic amino acid sequences in C. procera have failed.
A simple kit for rapid field diagnosis of potato virus Y by latex serological test
Directory of Open Access Journals (Sweden)
Aarne Kurppa
1987-07-01
Full Text Available A simple kit for rapid detection of potato virus Y by latex serological test was developed. The test is carried out on a white cardboard sheet and the results can be read by naked eye in two minutes. A test card of 10 x 6 cm holds latex sensitized antibodies, buffers and other necessary ingredients as dry blue colored formulate on the ringed areas of the card. A test card includes space for six tests and positive and negative controls. The kit also includes disposable plastic sticks for mixing the samples with test reagents and a hand press with disposable plastic tips. For testing, dried reagents are dissolved in drops of sample and mixed. After gentle rotation, samples containing virus appear clearly granulated while samples from healthy plants remain unagglutinated. The testing of undiluted extracts of evenly developed tuber sprouts resulted in over 91 % identity with the results obtained with ELISA that was used as a control method. Testing of diluted leaf extracts reached the same reliability but undiluted leaf extracts from glasshouse grown potatoes were not well suitable as test samples because of their dark green color. No such problems occurred with field grown material and a complete identity with the ELISA readings was true when the samples included secondarily infected potato plants. No reaction to other potato viruses than PVY was obtained by the test kit.
Synthesis and characterization of fluorinated polyacrylate latex emulsified with novel surfactants.
Zhang, Cuifeng; Xu, Tingting; Bao, Zhongbin; Chen, Lijun
2017-01-01
The fluorinated polyacrylate latex were successfully prepared with semi- continuous seeded emulsion polymerization of butyl acrylate (BA), methyl methacrylate (MMA) and hexafluorobutyl methacrylate (HFMA) which was initiated with potassium persulfate (KPS) initiator and emulsified with the novel mixed surfactants of sodium lauryl glutamate (SLG) and alkylphenol ethoxylates (OP-10). The structure of the resultant latex was confirmed by Fourier transform infrared spectroscopy (FTIR). The particle size of the latex was measured by Zetatrac dynamic light scattering detector. The film of latex was tested by differential scanning calorimetry (DSC), thermogravimetric analysis (TGA) and contact angle (CA). The optimum conditions of preparing the novel fluorinated polyacrylate latex are optimized and the results are as follows: the amount of emulsifiers is 4.0%; mass ratio of SLG to OP-10 is 1:1, the amount of the initiator is 0.6%. The mass ratio of MMA to BA is 1:1 and the amount of HFMA is 7.0%. In this case, the conversion is high and the polymerization stability is good. In addition, the water resistance and thermal properties of the latex films were improved significantly in comparison with the film of the latex prepared without the fluorinated monomer.
Plant latex: a promising antifungal agent for post harvest disease control.
Sibi, G; Wadhavan, Rashmi; Singh, Sneha; Shukla, Abhilasha; Dhananjaya, K; Ravikumar, K R; Mallesha, H
2013-12-01
Bioactive compounds from plant latex are potential source of antifungic against post harvest pathogens. Latex from a total of seven plant species was investigated for its phytochemical and antifungal properties. Six fungi namely Aspergillus fumigatus, A. niger, A. terreus, F. solani, P. digitatum and R. arrhizus were isolated from infected fruits and vegetables and tested against various solvent extracts of latex. Analysis of latex extracts with phytochemical tests showed the presence of alkaloids, flavonoids, glycosides, phenols, saponins, steroids, tannins and terpenoids. Antifungal assay revealed the potential inhibitory activity of petroleum ether extracts against the postharvest fungal isolates. Various degree of sensitivity was observed irrespective of plant species studied with A. terreus and P. digitatum as the most susceptible ones. F. solani and A. fumigatus were moderately sensitive to the latex extracts tested. Among the plants, latex of Thevetia peruviana (75.2%) and Artocarpus heterophyllus (64.8%) were having potential antifungal activity against the isolates followed by Manilkara zapota (51.1%). In conclusion, use of plant latex makes interest to control postharvest fungal diseases and is fitting well with the concept of safety for human health and environment.
Antimicrobial activity of a 48-kDa protease (AMP48) from Artocarpus heterophyllus latex.
Siritapetawee, J; Thammasirirak, S; Samosornsuk, W
2012-01-01
Artocarpus heterophyllus (jackfruit) is a latex producing plant. Plant latex is produced from secretory cells and contains many intergradients. It also has been used in folk medicine. This study aimed to purify and characterize the biological activities of a protease from jackfruit latex. A protease was isolated and purified from crude latex of a jackfruit tree by acid precipitation and ion exchange chromatography. The proteolytic activities of protein were tested using gelatin- and casein-zymography. The molecular weight and isoelectric point (pl) of protein were analysed by SDS/12.5% PAGE and 2D-PAGE, respectively. Antimicrobial activity of protein was analysed by broth microdilution method. In addition, the antibacterial activity of protein against Pseudomonas aeruginosa ATCC 27853 was observed and measured using atomic force microscopy (AFM) technique. The purified protein contained protease activity by digesting gelatin- and casein-substrates. The protease was designated as antimicrobial protease-48 kDa or AMP48 due to its molecular mass on SDS-PAGE was approximately 48 kDa. The isoelectric point (pl) of AMP48 was approximately 4.2. In addition, AMP48 contained antimicrobial activities by it could inhibit the growths of Pseudomonas aeruginosa ATCC 27853 and clinical isolated Candida albicans at minimum inhibitory concentration (MIC) 2.2 mg/ml and Minimum microbicidal concentration (MMC) 8.8 mg/ml. AFM image also supported the antimicrobial activities of AMP48 by the treated bacterial morphology and size were altered from normal.
Radiation response of Philippine natural rubber latex
International Nuclear Information System (INIS)
Dela Rosa, A.M.; Abad, L.V.; Ana-Relleve, L.S.; Tranquilan-Aranilla, C.; Pascual, C.L.
1998-01-01
Our earlier work has shown that the natural rubber latex (NRL) produced and processed in the Philippines is suited for radiation vulcanization. The cast films from NRL with 50% TSC exhibited maximum tensile strengths of 25-32 MPa at 15 kGy, which is the vulcanization dose or Dv. In the manufacture of dipped NRL products, certain specifications such as %TSC, protein content and tensile properties, must be met to ensure an acceptable product. For radiation vulcanization of natural rubber latex (RVNRL) to be accepted as an alternative process, it must also meet the requirements. Thus, this paper presents additional data on the radiation response of local NRL at different total solids contents (TSC), leachable proteins from NRL films as a function of dose, and the thermal activities of irradiated natural rubber latex (INRL). Different formulations of NRL showed varying tolerances to nBA. Data showed that as %TSC increases, the maximum concentration of nBA that can be added without affecting the stability of the latex decreases. The Dv increases as the %TSC increases and the nBA content decreases. This difference in response may be attributed to a lower concentration of nBA in formulations with higher %TSC. These data indicate that the parameters in the radiation treatment will be dictated by the intended applications of INRL. The thermogravimetric data showed greater stability of INRL to thermal oxidation relative to the unirradiated NRL, which correlates directly with the tensile properties of the INRL. A radiation dose of 10 kGy increased the amount of proteins leached from cast latex films. The amount of extractable proteins did not increase significantly at higher doses. The SDS PAGE analysis of the extractable proteins from unirradiated latex film showed distinct bands. An additional band at 60 Kda appeared at 10 kGy. All these bands became diffuse at higher doses, indicating the radiolysis of the proteins
A Reappraisal of Online Mathematics Teaching Using LaTeX
Directory of Open Access Journals (Sweden)
Eamon Costello
2009-12-01
Full Text Available The mathematics language LaTeX is often seen outside of academic circles as a legacy technology that is awkward to use. MathML - a verbose language designed for data-exchange, and to be written and understood by machines - is sometimes by contrast seen as something that will aid online mathematics and lack of browser support for it bemoaned. However LaTeX can already do many of the things that MathML might promise. LaTeX is here proposed as a language from which small fragments, with concise syntax, can be used by people to easily create and share mathematical expressions online. The capability to embed fragments of LaTeX code in online discussions is described here and its impact on a group of educators and learners evaluated. Here LaTeX is posited as a useful tool for facilitating asynchronous, online, collaborative learning of mathematics.
Antibacterial activity of the latex of Argemone ochroleuca Sweet
International Nuclear Information System (INIS)
Saad A. Alamri; Mahmoud F. Moustafa
2010-01-01
To investigate the antibacterial effect of the crude latex of Argemone ochroleuca (A. ochroleuca) as antibacterial potential against a range of human pathogenic bacteria. This study was carried out at King Khalid University, Abha, Kingdom of Saudi Arabia from January to March 2010. Seventeen ml of fresh latex from A. ochroleuca Sweet was collected, and the antibacterial activity of crude and diluted latex were examined using one ml of standardized inoculum suspension, and using the agar diffusion method test against Bacillus subtilis, Enterobacter aerogenes, Micrococcus luteus, Escherichia coli, and Staphylococcus aureus. All inoculated plates were incubated aerobically at 290C for 48 hours. The diameter of the zones of inhibition was measured to the nearest mm. The crude latex of A. ochroleuca exhibited a potent antibacterial effect on all bacterial strains examined. The zones of inhibition against the tested bacteria were found in the range of 9.30 - 40.3 mm along with their respective minimum inhibitory concentration values 100 ul/ml. The observable inhibition on selected bacteria by latex of A. ochroleuca makes it a promising alternative as a potential source of natural antibacterial (Author).
Thrombin like activity of Asclepias curassavica L. latex: action of cysteine proteases.
Shivaprasad, H V; Rajesh, R; Nanda, B L; Dharmappa, K K; Vishwanath, B S
2009-05-04
To validate the scientific basis of plant latex to stop bleeding on fresh cuts. Cysteine protease(s) from Asclepias curassavica (Asclepiadaceae) plant latex was assessed for pro-coagulant and thrombin like activities. A waxy material from the latex of Asclepias curassavica latex was removed by freezing and thawing. The resulted latex enzyme fraction was assayed for proteolytic activity using denatured casein as substrate. Its coagulant activity and thrombin like activity were determined using citrated plasma and pure fibrinogen, respectively. Inhibition studies were performed using specific protease inhibitors to know the type of protease. The latex enzyme fraction exhibited strong proteolytic activity when compared to trypsin and exerted pro-coagulant action by reducing plasma clotting time from 195 to 58 s whereas trypsin reduced clotting time marginally from 195 to 155 s. The pro-coagulant activity of this enzyme fraction was exerted by selectively hydrolyzing A alpha and B beta subunits of fibrinogen to form fibrin clot when pure fibrinogen was used as substrate as assessed by fibrinogen-agarose plate method and fibrinogen polymerization assay. Trypsin failed to induce any fibrin clot under similar conditions. The electrophoretic pattern of latex enzyme fraction-induced fibrin clot was very much similar to that of thrombin-induced fibrin clot and mimic thrombin like action. The proteolytic activity including thrombin like activity of Asclepias curassavica latex enzyme fraction was completely inhibited by iodoaceticacid (IAA). Cysteine proteases from Asclepias curassavica latex exhibited strong pro-coagulant action and were found to be specific in its action (Thrombin like). This could be the basis for the use of plant latex in pharmacological applications that justify their use as folk medicine.
Directory of Open Access Journals (Sweden)
Markus Kopp
Full Text Available Because of minimal data available on folate analysis in dried matrix spots (DMSs, we combined the advantages of stable isotope dilution assays followed by LC-MS/MS analysis with DMS sampling to develop a reliable method for the quantitation of plasma 5-methyltetrahydrofolic acid in dried blood spots (DBSs and dried plasma spots (DPSs as well as for the quantitation of whole blood 5-methyltetrahydrofolic acid in DBSs. We focused on two diagnostically conclusive parameters exhibited by the plasma and whole blood 5-methyltetrahydrofolic acid levels that reflect both temporary and long-term folate status. The method is performed using the [2H4]-labeled isotopologue of the vitamin as the internal standard, and three steps are required for the extraction procedure. Elution of the punched out matrix spots was performed using stabilization buffer including Triton X-100 in a standardized ultrasonication treatment followed by enzymatic digestion (whole blood only and solid-phase extraction with SAX cartridges. This method is sensitive enough to quantify 27 nmol/L whole blood 5-methyltetrahydrofolic acid in DBSs and 6.3 and 4.4 nmol/L plasma 5-methyltetrahydrofolic acid in DBSs and DPSs, respectively. The unprecedented accurate quantification of plasma 5-methyltetrahydrofolic acid in DBSs was achieved by thermal treatment prior to ultrasonication, inhibiting plasma conjugase activity. Mass screenings are more feasible and easier to facilitate for this method in terms of sample collection and storage compared with conventional clinical sampling for the assessment of folate status.
Alergia látex-fruta Latex-fruit allergy
Directory of Open Access Journals (Sweden)
Flávia Andréia MARIN
2002-01-01
Full Text Available O látex está sendo considerado o alergênico do ano 2000, tendo em vista que inúmeros indivíduos, principalmente profissionais da área de saúde e pacientes submetidos a várias intervenções diagnósticas e terapêuticas, estão freqüentemente expostos aos alérgenos do látex, presentes em produtos de borracha natural. As manifestações clínicas conseqüentes às reações alérgicas de hipersensibilidade imediata vão desde rinite, urticária, conjuntivite, angioedema, asma, até anafilaxia. Estudos recentes estão demonstrando que pacientes alérgicos ao látex desenvolvem concomitantemente sensibilização a certos alimentos de origem vegetal, especialmente frutas como papaia, figo, banana, abacate, kiwi, pêssego, abacaxi, melão e castanha, acreditando-se numa provável ocorrência de reações cruzadas entre os alérgenos do látex e destas frutas. Faz-se, então, uma revisão sobre a alergia ao látex, em particular sobre os grupos de risco, incluindo a presença de reatividade cruzada entre o látex e as frutas.The latex is being considered the allergenic agent of the year 2000, taking into account that several individuals, mainly health care professionals, and patients who had undergone many diagnostic and therapeutic interventions, are frequently exposed to latex allergens, which are present in natural rubber latex products. The clinical manifestations, derived from allergic reactions of immediate hypersensitivity vary from since rhinitis, conjunctivitis, urticaria, angioedema, asthma, to anaphylaxis. Recent researches are demonstrating that patients allergic to latex develop concomitantly sensitization to certain vegetable foods, especially fruits like papaya, fig, banana, avocado, kiwi, peach, pineapple, melon and chestnut, and a probable occurrence of cross reaction between allergens of latex and of these fruits is believed. A review is made about latex allergy, in particular about risk groups, including the presence of
Trejo, Sebastián A; López, Laura M I; Caffini, Néstor O; Natalucci, Claudia L; Canals, Francesc; Avilés, Francesc X
2009-07-01
Asclepain f is a papain-like protease previously isolated and characterized from latex of Asclepias fruticosa. This enzyme is a member of the C1 family of cysteine proteases that are synthesized as preproenzymes. The enzyme belongs to the alpha + beta class of proteins, with two disulfide bridges (Cys22-Cys63 and Cys56-Cys95) in the alpha domain, and another one (Cys150-Cys201) in the beta domain, as was determined by molecular modeling. A full-length 1,152 bp cDNA was cloned by RT-RACE-PCR from latex mRNA. The sequence was predicted as an open reading frame of 340 amino acid residues, of which 16 residues belong to the signal peptide, 113 to the propeptide and 211 to the mature enzyme. The full-length cDNA was ligated to pPICZalpha vector and expressed in Pichia pastoris. Recombinant asclepain f showed endopeptidase activity on pGlu-Phe-Leu-p-nitroanilide and was identified by PMF-MALDI-TOF MS. Asclepain f is the first peptidase cloned and expressed from mRNA isolated from plant latex, confirming the presence of the preprocysteine peptidase in the latex.
Preparation and characterization of spray-dried co-amorphous drug-amino acid salts
DEFF Research Database (Denmark)
Jensen, Katrine Birgitte Tarp; Blaabjerg, Lasse Ingerslev; Lenz, Elisabeth
2016-01-01
scale. In this study, spray-drying was investigated as a scale up preparation method for co-amorphous indomethacin (IND)-amino acid mixtures. In addition, the physico-chemical properties of the different co-amorphous systems were investigated with respect to the amino acids' ability towards co...... dissolution behaviour, and physical stability at various storage conditions, were examined. KEY FINDINGS: Results showed that IND could be converted into an amorphous form in combination with the amino acids arginine (ARG), histidine (HIS) and lysine (LYS) by spray-drying. Solid state characterization...... mixtures were physically stable (>10 months) at room temperature and 40°C under dry conditions. Intrinsic dissolution of the co-amorphous mixtures showed an improved dissolution behaviour under intestinal pH conditions for IND-ARG compared with the crystalline and amorphous forms of the drug. On the other...
Mkoma, S. L.; Kawamura, K.
2013-02-01
Atmospheric aerosol samples of PM2.5 and PM10 were collected during the wet and dry seasons in 2011 from a rural site in Tanzania and analysed for water-soluble dicarboxylic acids, ketocarboxylic acids, α-dicarbonyls, and fatty acids using a gas chromatography/flame ionization detector (GC/FID) and GC/mass spectrometry. Here we report the molecular composition and sources of diacids and related compounds for wet and dry seasons. Oxalic acid (C2) was found as the most abundant diacid species followed by succinic and/or malonic acids whereas glyoxylic acid and glyoxal were the dominant ketoacid and α-dicarbonyl, respectively in both seasons in PM2.5 and PM10. Mean concentration of C2 in PM2.5 (121 ± 47 ng m-3) was lower in wet season than dry season (258 ± 69 ng m-3). Similarly, PM10 samples showed lower concentration of C2 (169 ± 42 ng m-3) in wet season than dry season (292 ± 165 ng m-3). Relative abundances of C2 in total diacids were 65% and 67% in PM2.5 and 65% and 64% in PM10 in the wet and dry seasons, respectively. Total concentrations of diacids (289-362 ng m-3), ketoacids (37.8-53.7 ng m-3), and α-dicarbonyls (5.7-7.8 ng m-3) in Tanzania are higher than those reported at a rural background site in Nylsvley (South Africa) but comparable or lower than those reported from sites in Asia and Europe. Diacids and ketoacids were found to be present mainly in PM2.5 in both seasons (total α-dicarbonyls in the dry season), suggesting a production of organic acids from pyrogenic sources and photochemical oxidations. Averaged contributions of total diacids to aerosol total carbon were 1.4% in PM2.5 and 2.1% in PM10 during wet season and 3.3% in PM2.5 and 3.9% in PM10 during dry season whereas those to water-soluble organic carbon were 2.2% and 4.7% in PM2.5 during wet season and 3.1% and 5.8% in PM10 during dry season. The higher ratios in dry season suggest an enhanced photochemical oxidation of organic precursors probably via heterogeneous reactions on
[Research update of effectiveness and mechanism of essential fatty acids in treating dry eye].
Liu, Y; Liang, Q F
2017-03-11
Topical anti-inflammatory therapy has become the significant way of treating dry eye so far. However, as the long-term use of routine anti-inflammatory medications are restricted from their side effects, it is inevitable to explore safer and more effective alternatives. Essential fatty acids have proven to be anti-inflammatory systemically, which makes it possible to treat dry eye. Clinical trials have demonstrated that supplementation with either ω-3 or ω-6 essential fatty acids or both has multifactorial efficacies including improvement of subjective symptoms, alleviation of inflammation of ocular surface and eyelid margin, prolongation of tear break-up time and increase of tear flow secretion. Besides anti-inflammation effects, several basic researches have revealed that other mechanisms of essential fatty acids treating dry eye might lie in the corneal epithelial healing and tear secretion promotion. This review puts emphasis on the effectiveness, feasibility and mechanism of treating dry eye with essential fatty acids. (Chin J Ophthalmol, 2017, 53: 225-229) .
Radiation vulcanization of natural rubber latex sensitized with commercial gases
International Nuclear Information System (INIS)
Chirinos, H.; Lugao, A.
2002-01-01
The industrial activities using natural rubber latex are fully compatible with rural areas in Amazon and other places in Brazil, as well as in other tropical countries. However the classical sulfur vulcanization presents many occupational problems for the workers in rural areas. Radiation vulcanization of natural rubber latex is a much more friendly process as sulfur compounds are not needed for crosslinking, although chemicals as acrylate monomers, particularly multifunctional acrylates are still used as sensitizers for radiation processes. Two commercial gases, acetylene and butadiene, were selected as sensitizers for the radiation vulcanization of natural rubber latex instead of acrylates. These gases accelerate the crosslinking rates of the cure process and lower the radiation dose required to achieve vulcanization of natural rubber latex and improve the mechanical properties to reduce the tackiness of rubber goods. (author)
Radiation vulcanization of natural rubber latex sensitized with commercial gases
Energy Technology Data Exchange (ETDEWEB)
Chirinos, H.; Lugao, A. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)
2002-07-01
The industrial activities using natural rubber latex are fully compatible with rural areas in Amazon and other places in Brazil, as well as in other tropical countries. However the classical sulfur vulcanization presents many occupational problems for the workers in rural areas. Radiation vulcanization of natural rubber latex is a much more friendly process as sulfur compounds are not needed for crosslinking, although chemicals as acrylate monomers, particularly multifunctional acrylates are still used as sensitizers for radiation processes. Two commercial gases, acetylene and butadiene, were selected as sensitizers for the radiation vulcanization of natural rubber latex instead of acrylates. These gases accelerate the crosslinking rates of the cure process and lower the radiation dose required to achieve vulcanization of natural rubber latex and improve the mechanical properties to reduce the tackiness of rubber goods. (author)
Preparation of irradiated natural rubber latex-styrene copolymer for electrical gloves
International Nuclear Information System (INIS)
Made Sumarti Kardha
2010-01-01
Research on irradiated natural rubber latex-styrene copolymer to prepare electrical glove have been done. Vulcanization of natural rubber latex (NRL) was done by mixing 2 phr (per hundred of rubber) of normal butyl acrylate (n-BA) emulsion then irradiated with ã-ray "6"0Co at the dose of 30 kGy producing irradiated natural rubber latex (INRL). Natural rubber latex-styrene copolymers (SC) were prepared by mixing NRL and styrene monomer at styrene concentrations of 50 phr, 75 phr, 100 phr, 500 phr and irradiated at the doses of 15 kGy, 30 kGy and 45 kGy, then characterized their latex and film properties to obtain optimum SC of SC50. This optimum SC, SC50 then mixed with IRNL at the weight ratio of 0/100, 30/70, 50/50, 70/30 and 100/0, to produce irradiated natural rubber latex-styrene copolymer. The properties of copolymer rubber films made by dipping process i.e., % conversion, total solid content, latex viscosity, tensile strength, modulus 300 %, elongation at break, electrical resistance and dielectric constant were then characterized. Characterization result showed that (INRL-SC50) with 50/50 ratio irradiated at the dose of 30 kGy, have % conversion of 80.93 %, electrical resistivity of 1.73 x 10"1"4 Ohm cm and dielectric constant of 2.76 which fulfill the requirement as material for electrical gloves. (author)
A Latex Metabolite Benefits Plant Fitness under Root Herbivore Attack.
Directory of Open Access Journals (Sweden)
Meret Huber
2016-01-01
Full Text Available Plants produce large amounts of secondary metabolites in their shoots and roots and store them in specialized secretory structures. Although secondary metabolites and their secretory structures are commonly assumed to have a defensive function, evidence that they benefit plant fitness under herbivore attack is scarce, especially below ground. Here, we tested whether latex secondary metabolites produced by the common dandelion (Taraxacum officinale agg. decrease the performance of its major native insect root herbivore, the larvae of the common cockchafer (Melolontha melolontha, and benefit plant vegetative and reproductive fitness under M. melolontha attack. Across 17 T. officinale genotypes screened by gas and liquid chromatography, latex concentrations of the sesquiterpene lactone taraxinic acid β-D-glucopyranosyl ester (TA-G were negatively associated with M. melolontha larval growth. Adding purified TA-G to artificial diet at ecologically relevant concentrations reduced larval feeding. Silencing the germacrene A synthase ToGAS1, an enzyme that was identified to catalyze the first committed step of TA-G biosynthesis, resulted in a 90% reduction of TA-G levels and a pronounced increase in M. melolontha feeding. Transgenic, TA-G-deficient lines were preferred by M. melolontha and suffered three times more root biomass reduction than control lines. In a common garden experiment involving over 2,000 T. officinale individuals belonging to 17 different genotypes, high TA-G concentrations were associated with the maintenance of high vegetative and reproductive fitness under M. melolontha attack. Taken together, our study demonstrates that a latex secondary metabolite benefits plants under herbivore attack, a result that provides a mechanistic framework for root herbivore driven natural selection and evolution of plant defenses below ground.
A Latex Metabolite Benefits Plant Fitness under Root Herbivore Attack.
Huber, Meret; Epping, Janina; Schulze Gronover, Christian; Fricke, Julia; Aziz, Zohra; Brillatz, Théo; Swyers, Michael; Köllner, Tobias G; Vogel, Heiko; Hammerbacher, Almuth; Triebwasser-Freese, Daniella; Robert, Christelle A M; Verhoeven, Koen; Preite, Veronica; Gershenzon, Jonathan; Erb, Matthias
2016-01-01
Plants produce large amounts of secondary metabolites in their shoots and roots and store them in specialized secretory structures. Although secondary metabolites and their secretory structures are commonly assumed to have a defensive function, evidence that they benefit plant fitness under herbivore attack is scarce, especially below ground. Here, we tested whether latex secondary metabolites produced by the common dandelion (Taraxacum officinale agg.) decrease the performance of its major native insect root herbivore, the larvae of the common cockchafer (Melolontha melolontha), and benefit plant vegetative and reproductive fitness under M. melolontha attack. Across 17 T. officinale genotypes screened by gas and liquid chromatography, latex concentrations of the sesquiterpene lactone taraxinic acid β-D-glucopyranosyl ester (TA-G) were negatively associated with M. melolontha larval growth. Adding purified TA-G to artificial diet at ecologically relevant concentrations reduced larval feeding. Silencing the germacrene A synthase ToGAS1, an enzyme that was identified to catalyze the first committed step of TA-G biosynthesis, resulted in a 90% reduction of TA-G levels and a pronounced increase in M. melolontha feeding. Transgenic, TA-G-deficient lines were preferred by M. melolontha and suffered three times more root biomass reduction than control lines. In a common garden experiment involving over 2,000 T. officinale individuals belonging to 17 different genotypes, high TA-G concentrations were associated with the maintenance of high vegetative and reproductive fitness under M. melolontha attack. Taken together, our study demonstrates that a latex secondary metabolite benefits plants under herbivore attack, a result that provides a mechanistic framework for root herbivore driven natural selection and evolution of plant defenses below ground.
Antimicrobial activity of latex silver nanoparticles using Calotropis procera
Directory of Open Access Journals (Sweden)
Nadia Hussein Mohamed
2014-11-01
Conclusions: It can be concluded that serum latex of Calotropis procera was found to display strong potential for the synthesis of AgNPs as antimicrobial agents through rapid reduction of silver ions (Ag+ to Ag0. The green synthesized AgNPs were found to show higher antimicrobial efficacy than crude latex.
Huber, Meret; Triebwasser-Freese, Daniella; Reichelt, Michael; Heiling, Sven; Paetz, Christian; Chandran, Jima N; Bartram, Stefan; Schneider, Bernd; Gershenzon, Jonathan; Erb, Matthias
2015-07-01
The secondary metabolites in the roots, leaves and flowers of the common dandelion (Taraxacum officinale agg.) have been studied in detail. However, little is known about the specific constituents of the plant's highly specialized laticifer cells. Using a combination of liquid and gas chromatography, mass spectrometry and nuclear magnetic resonance spectrometry, we identified and quantified the major secondary metabolites in the latex of different organs across different growth stages in three genotypes, and tested the activity of the metabolites against the generalist root herbivore Diabrotica balteata. We found that common dandelion latex is dominated by three classes of secondary metabolites: phenolic inositol esters (PIEs), triterpene acetates (TritAc) and the sesquiterpene lactone taraxinic acid β-D-glucopyranosyl ester (TA-G). Purification and absolute quantification revealed concentrations in the upper mgg(-1) range for all compound classes with up to 6% PIEs, 5% TritAc and 7% TA-G per gram latex fresh weight. Contrary to typical secondary metabolite patterns, concentrations of all three classes increased with plant age. The highest concentrations were measured in the main root. PIE profiles differed both quantitatively and qualitatively between plant genotypes, whereas TritAc and TA-G differed only quantitatively. Metabolite concentrations were positively correlated within and between the different compound classes, indicating tight biosynthetic co-regulation. Latex metabolite extracts strongly repelled D. balteata larvae, suggesting that the latex constituents are biologically active. Copyright © 2015 Elsevier Ltd. All rights reserved.
Hierarchically structured self-supported latex films for flexible and semi-transparent electronics
Määttänen, Anni; Ihalainen, Petri; Törngren, Björn; Rosqvist, Emil; Pesonen, Markus; Peltonen, Jouko
2016-02-01
Different length scale alterations in topography, surface texture, and symmetry are known to evoke diverse cell behavior, including adhesion, orientation, motility, cytoskeletal condensation, and modulation of intracellular signaling pathways. In this work, self-supported latex films with well-defined isotropic/anisotropic surface features and hierarchical morphologies were fabricated by a peel-off process from different template surfaces. In addition, the latex films were used as substrates for evaporated ultrathin gold films with nominal thicknesses of 10 and 20 nm. Optical properties and topography of the samples were characterized using UV-vis spectroscopy and Atomic Force Microscopy (AFM) measurements, respectively. The latex films showed high-level transmittance of visible light, enabling the fabrication of semi-transparent gold electrodes. Electrochemical impedance spectroscopy (EIS) measurements were carried out for a number of days to investigate the long-term stability of the electrodes. The effect of 1-octadecanethiol (ODT) and HS(CH2)11OH (MuOH) thiolation and protein (human serum albumin, HSA) adsorption on the impedance and capacitance was studied. In addition, cyclic voltammetry (CV) measurements were carried out to determine active medicinal components, i.e., caffeic acid with interesting biological activities and poorly water-soluble anti-inflammatory drug, piroxicam. The results show that the fabrication procedure presented in this study enables the formation of platforms with hierarchical morphologies for multimodal (optical and electrical) real-time monitoring of length-scale-dependent biomaterial-surface interactions.
Immune response modulation by curcumin in a latex allergy model
Directory of Open Access Journals (Sweden)
Raju Raghavan
2007-01-01
Full Text Available Abstract Background There has been a worldwide increase in allergy and asthma over the last few decades, particularly in industrially developed nations. This resulted in a renewed interest to understand the pathogenesis of allergy in recent years. The progress made in the pathogenesis of allergic disease has led to the exploration of novel alternative therapies, which include herbal medicines as well. Curcumin, present in turmeric, a frequently used spice in Asia has been shown to have anti-allergic and inflammatory potential. Methods We used a murine model of latex allergy to investigate the role of curcumin as an immunomodulator. BALB/c mice were exposed to latex allergens and developed latex allergy with a Th2 type of immune response. These animals were treated with curcumin and the immunological and inflammatory responses were evaluated. Results Animals exposed to latex showed enhanced serum IgE, latex specific IgG1, IL-4, IL-5, IL-13, eosinophils and inflammation in the lungs. Intragastric treatment of latex-sensitized mice with curcumin demonstrated a diminished Th2 response with a concurrent reduction in lung inflammation. Eosinophilia in curcumin-treated mice was markedly reduced, co-stimulatory molecule expression (CD80, CD86, and OX40L on antigen-presenting cells was decreased, and expression of MMP-9, OAT, and TSLP genes was also attenuated. Conclusion These results suggest that curcumin has potential therapeutic value for controlling allergic responses resulting from exposure to allergens.
Dong, Wenjiang; Hu, Rongsuo; Chu, Zhong; Zhao, Jianping; Tan, Lehe
2017-11-01
This study investigated the effect of different drying techniques, namely, room-temperature drying (RTD), solar drying (SD), heat-pump drying (HPD), hot-air drying (HAD), and freeze drying (FD), on bioactive components, fatty acid composition, and the volatile compound profile of robusta coffee beans. The data showed that FD was an effective method to preserve fat, organic acids, and monounsaturated fatty acids. In contrast, HAD was ideal for retaining polyunsaturated fatty acids and amino acids. Sixty-two volatile compounds were identified in the differently dried coffee beans, representing 90% of the volatile compounds. HPD of the coffee beans produced the largest number of volatiles, whereas FD resulted in the highest volatile content. A principal component analysis demonstrated a close relationship between the HPD, SD, and RTD methods whereas the FD and HAD methods were significantly different. Overall, the results provide a basis for potential application to other similar thermal sensitive materials. Copyright © 2017 Elsevier Ltd. All rights reserved.
Capacitance Regression Modelling Analysis on Latex from Selected Rubber Tree Clones
International Nuclear Information System (INIS)
Rosli, A D; Baharudin, R; Hashim, H; Khairuzzaman, N A; Mohd Sampian, A F; Abdullah, N E; Kamaru'zzaman, M; Sulaiman, M S
2015-01-01
This paper investigates the capacitance regression modelling performance of latex for various rubber tree clones, namely clone 2002, 2008, 2014 and 3001. Conventionally, the rubber tree clones identification are based on observation towards tree features such as shape of leaf, trunk, branching habit and pattern of seeds texture. The former method requires expert persons and very time-consuming. Currently, there is no sensing device based on electrical properties that can be employed to measure different clones from latex samples. Hence, with a hypothesis that the dielectric constant of each clone varies, this paper discusses the development of a capacitance sensor via Capacitance Comparison Bridge (known as capacitance sensor) to measure an output voltage of different latex samples. The proposed sensor is initially tested with 30ml of latex sample prior to gradually addition of dilution water. The output voltage and capacitance obtained from the test are recorded and analyzed using Simple Linear Regression (SLR) model. This work outcome infers that latex clone of 2002 has produced the highest and reliable linear regression line with determination coefficient of 91.24%. In addition, the study also found that the capacitive elements in latex samples deteriorate if it is diluted with higher volume of water. (paper)
Calotropis procera Latex-Induced Inflammatory Hyperalgesia—Effect of Antiinflammatory Drugs
Directory of Open Access Journals (Sweden)
Raman Sehgal
2005-01-01
Full Text Available The milky white latex of plant Calotropis procera produces inflammation of the skin and mucous membranes on accidental exposure. It produces edema on local administration due to the release of histamine and prostaglandins and is associated with hyperalgesia. In the present study we have evaluated the antiedematous and analgesic activity of antiinflammatory drugs against inflammatory response induced by dried latex (DL of C procera in rat paw edema model. An aqueous extract of DL of C procera was injected into the subplantar surface of the rat paw and the paw volume was measured by a plethysmometer at 0, 1, 2, 6, 12, and 24 hours. Concomitantly the hyperalgesic response was also evaluated by motility test, stair climbing ability test, dorsal flexion pain test, compression test, and observing the grooming behavior. The inhibitory effect of diclofenac and rofecoxib on edema formation and hyperalgesic response was compared with cyproheptadine (CPH. DL-induced edema formation was maximum at 2 hours that was associated with decreased pain threshold, functional impairment, and grooming. Treatment with antiinflammatory drugs and CPH significantly attenuated the edematous response and grooming, increased the pain threshold, and improved functional parameters. Both antiinflammatory and antiserotonergic drugs significantly inhibited the hyperalgesia associated with DL-induced paw edema. Rofecoxib was found to be superior than diclofenac and was as effective as CPH in ameliorating the hyperalgesia. However, it was found to be less effective than CPH in attenuating edema formation.
Decontamination of latex gloves; Decontamination de gants en latex
Energy Technology Data Exchange (ETDEWEB)
Boutot, P; Schipfer, P; Blachere, A [Commissariat a l' Energie Atomique, Chusclan (France). Centre de Production de Plutonium de Marcoule
1969-07-01
Initially the latex gloves used in controlled zones were processed after use as radioactive waste. In view of the continually increasing number used, however, the persons in charge of the SPRAR have considered the possibility of decontaminating the gloves and using them again after control. The recovery installations which have been developed were initially designed rather crudely and operated irregularly; they have been progressively improved as a result of the experience acquired; today they are more really an industrial concern, equipped with automatic machinery. In 1967 it has been possible with this set-up to recover 247000 pairs of gloves, representing nearly 70 per cent of the number treated. (author) [French] Initialement, les gants de latex utilises dans les zones controlees etaient conditionnes apres emploi comme dechets radioactifs. Mais, devant l'augmentation sans cesse croissante des quantites employees, les responsables du SPRAR ont envisage leur decontamination et leur recyclage apres controles. Les installations de recuperation mises au point, de conception artisanale et fonctionnant de maniere episodique au depart, se sont progressivement ameliorees au fur et a mesure de l'experience acquise; elles revetent aujourd'hui le caractere d'une exploitation industrielle equipee de machines automatiques. En 1967, ces nouvelles installations ont permis de recuperer 247000 paires de gants, ce qui represente pres de 70 pour cent des quantites traitees. (auteur)
Follow-up Study of Latex-allergic Health Care Workers in Japan
Directory of Open Access Journals (Sweden)
Akiko Yagami
2006-01-01
Conclusions: After avoiding latex products and following our educational suggestions, the patients' allergy symptoms had generally improved. This indicates that our countermeasures against latex allergy were largely successful.
Morphology and film formation of poly(butyl methacrylate)-polypyrrole core-shell latex particles
Huijs, F; Lang, J
Core-shell latex particles made of a poly(butyl methacrylate) (PBMA) core and a thin polypyrrole (PPy) shell were synthesized by two-stage polymerization. In the first stage, PBMA latex particles were synthesized in a semicontinuous process by free-radical polymerization. PBMA latex particles were
Latex allergies - for hospital patients
... ency/patientinstructions/000499.htm Latex allergies - for hospital patients To use the sharing features on this page, ... ADAM Health Solutions. About MedlinePlus Site Map FAQs Customer Support Get email updates Subscribe to RSS Follow ...
Retention of short chain fatty acids under drying and storage conditions
Directory of Open Access Journals (Sweden)
Alexandre Santos Souza
2011-09-01
Full Text Available Cheese whey permeate was used as a substrate for the fermentation of Propionibacterium freudenreichi PS1 for the production of short chain fatty acids, components of the bio-aroma of Swiss cheese. The liquid bio-aroma was encapsulated by spray drying under different conditions of air inlet temperature and feed rate. A study was carried out on the stability of the bio-aroma during storage in laminated packages at 30 °C for 96 days using the product showing the greatest retention of acetic and propionic acids. The results showed that the best drying conditions were an air entrance temperature of 180 °C and a feed rate of 24 g/min resulting in particles with a smooth surface and few invaginations and micro-fissures. However, 72% of the acetic acid and 80% of the propionic acid were lost during storage showing that the wall material used was inadequate to guarantee product stability.
Slatnar, Ana; Klancar, Urska; Stampar, Franci; Veberic, Robert
2011-11-09
Fresh figs were subjected to two different drying processes: sun-drying and oven-drying. To assess their effect on the nutritional and health-related properties of figs, sugars, organic acids, single phenolics, total phenolics, and antioxidant activity were determined before and after processing. Samples were analyzed three times in a year, and phenolic compounds were determined using high-performance liquid chromatography coupled with mass spectrometry (HPLC-MS). In figs, monomer sugars predominate, which is important nutritional information, and the content of sugars as well as organic acids in fresh figs was lower than in dried fruits. However, the best sugar/organic acid ratio was measured after the sun-drying process. Analysis of individual phenolic compounds revealed a higher content of all phenolic groups determined after the oven-drying process, with the exception of cyanidin-3-O-rutinoside. Similarly, higher total phenolic content and antioxidant activity were detected after the drying process. With these results it can be concluded that the differences in analyzed compounds in fresh and dried figs are significant. The differences between the sun-dried and oven-dried fruits were determined in organic acids, sugars, chlorogenic acid, catechin, epicatechin, kaempferol-3-O-glucoside, luteolin-8-C-glucoside, and total phenolic contents. The results indicate that properly dried figs can be used as a good source of phenolic compounds.
Installing fonts in LaTeX a user's experience
Hanssen, F.T.Y.
2003-01-01
This paper presents a user's experience with installing fonts for use in LaTeX. It will be shown that it is not hard to make a standard Type 1 font work, if you use modern font installation software for LaTeX. All the steps necessary to install the example fonts will be shown. The example fonts used
Simulated dry deposition of nitric acid near forest edges
DeJong, JJM; Klaassen, W; Jong, J.J.M. de
1997-01-01
Dry deposition is simulated to understand and generalize observations of enhanced deposition of air pollution near forest edges. Nitric acid is taken as an example as its deposition velocity is often assumed to be determined by turbulent transport only. The simulations are based on the
Omega-3 fatty acid supplementation can improve both symptoms and signs of dry eye disease
Directory of Open Access Journals (Sweden)
Kwon J
2017-03-01
Full Text Available Jae-Woo Kwon,1 Sang Beom Han2 1Department of Internal Medicine, 2Department of Ophthalmology, Kangwon National University Hospital, Kangwon National University Graduate School of Medicine, Chuncheon, South Korea We read with great interest the article by Gatell-Tortajada1 entitled “Oral supplementation with a nutraceutical formulation containing omega-3 fatty acids, vitamins, minerals, and antioxidants in a large series of patients with dry eye symptoms: results of a prospective study”. The prospective large-scale study was undoubtedly well designed and conducted, and the authors should be congratulated for successfully demonstrating that oral omega-3 fatty acid supplementation can be an effective treatment for dry eye symptoms.1The authors showed that supplementation of omega-3 fatty acids improved dry eye signs, such as corneal erosion, tear film breakup time, and conjunctival hyperemia, suggesting that they can reduce ocular surface inflammation and also alleviate dry eye symptoms.1 Rashid et al2 also demonstrated that topical application of omega-3 fatty acids led to a decrease in dry eye signs and inflammatory changes at both cellular and molecular levels. View original paper by Gatell-Tortajada
Involvement of Ethylene in the Latex Metabolism and Tapping Panel Dryness of Hevea brasiliensis
Putranto, Riza-Arief; Herlinawati, Eva; Rio, Maryannick; Leclercq, Julie; Piyatrakul, Piyanuch; Gohet, Eric; Sanier, Christine; Oktavia, Fetrina; Pirrello, Julien; Kuswanhadi; Montoro, Pascal
2015-01-01
Ethephon, an ethylene releaser, is used to stimulate latex production in Hevea brasiliensis. Ethylene induces many functions in latex cells including the production of reactive oxygen species (ROS). The accumulation of ROS is responsible for the coagulation of rubber particles in latex cells, resulting in the partial or complete stoppage of latex flow. This study set out to assess biochemical and histological changes as well as changes in gene expression in latex and phloem tissues from trees grown under various harvesting systems. The Tapping Panel Dryness (TPD) susceptibility of Hevea clones was found to be related to some biochemical parameters, such as low sucrose and high inorganic phosphorus contents. A high tapping frequency and ethephon stimulation induced early TPD occurrence in a high latex metabolism clone and late occurrence in a low latex metabolism clone. TPD-affected trees had smaller number of laticifer vessels compared to healthy trees, suggesting a modification of cambial activity. The differential transcript abundance was observed for twenty-seven candidate genes related to TPD occurrence in latex and phloem tissues for ROS-scavenging, ethylene biosynthesis and signalling genes. The predicted function for some Ethylene Response Factor genes suggested that these candidate genes should play an important role in regulating susceptibility to TPD. PMID:26247941
Directory of Open Access Journals (Sweden)
S. L. Mkoma
2013-02-01
Full Text Available Atmospheric aerosol samples of PM2.5 and PM10 were collected during the wet and dry seasons in 2011 from a rural site in Tanzania and analysed for water-soluble dicarboxylic acids, ketocarboxylic acids, α-dicarbonyls, and fatty acids using a gas chromatography/flame ionization detector (GC/FID and GC/mass spectrometry. Here we report the molecular composition and sources of diacids and related compounds for wet and dry seasons. Oxalic acid (C2 was found as the most abundant diacid species followed by succinic and/or malonic acids whereas glyoxylic acid and glyoxal were the dominant ketoacid and α-dicarbonyl, respectively in both seasons in PM2.5 and PM10. Mean concentration of C2 in PM2.5 (121 ± 47 ng m−3 was lower in wet season than dry season (258 ± 69 ng m−3. Similarly, PM10 samples showed lower concentration of C2 (169 ± 42 ng m−3 in wet season than dry season (292 ± 165 ng m−3. Relative abundances of C2 in total diacids were 65% and 67% in PM2.5 and 65% and 64% in PM10 in the wet and dry seasons, respectively. Total concentrations of diacids (289–362 ng m−3, ketoacids (37.8–53.7 ng m−3, and α-dicarbonyls (5.7–7.8 ng m−3 in Tanzania are higher than those reported at a rural background site in Nylsvley (South Africa but comparable or lower than those reported from sites in Asia and Europe. Diacids and ketoacids were found to be present mainly in PM2.5 in both seasons (total α-dicarbonyls in the dry season, suggesting a production of organic acids from pyrogenic sources and photochemical oxidations. Averaged contributions of total diacids to aerosol total carbon were 1.4% in PM2.5 and 2.1% in PM10 during wet season and 3.3% in PM2.5 and 3.9% in PM10 during
Mkoma, S. L.; Kawamura, K.
2012-09-01
Atmospheric aerosol samples of PM2.5 and PM10 were collected during the wet and dry seasons in 2011 from a rural site in Tanzania and analysed for water-soluble dicarboxylic acids, ketocarboxylic acids, α-dicarbonyls and fatty acids using a gas chromatography (GC) and GC/mass spectrometry. Here we report the size distribution and sources of diacids and related compounds for wet and dry seasons. Oxalic acid (C2) was found as the most abundant diacid species followed by succinic and/or malonic acids whereas glyoxylic acid and glyoxal were the dominant ketoacids and α-dicarbonyls, respectively in both seasons in PM2.5 and PM10. Mean concentration of C2 in PM2.5 (121.5± 46.6 ng m-3) was lower in wet season than dry season (258.1± 69.5 ng m-3). Similarly, PM10 samples showed lower concentration of C2 (168.6 ± 42.4 ng m-3) in wet season than dry season (292.4± 164.8 ng m-3). Relative abundances of C2 in total diacids were 65.4% and 67.1% in PM2.5 and 64.6% and 63.9% in PM10 in the wet and dry seasons, respectively. Total concentrations of diacids (289-362 m-3), ketoacids (37.8-53.7ng m-3), and α-dicarbonyls (5.7-7.8 ng m-3) in Tanzania are higher to those reported at a rural background site in Nylsvley (South Africa) but comparable or lower to those reported from sites in Asia and Europe. Diacids and ketoacids were found to be present mainly in the fine fraction in both seasons (total α-dicarbonyls in the dry season), suggesting a production of organic aerosols from pyrogenic sources and photochemical oxidations. The averaged contributions of total diacid carbon to aerosol total carbon were 1.4% in PM2.5 and 2.1% in PM10 in wet season and 3.3% in PM2.5 and 3.9% in PM10 in dry season whereas those to water-soluble organic carbon were 2.2% and 4.7% inPM2.5 and 3.1% and 5.8% in PM10 during the wet and dry seasons, respectively. These ratios suggest an enhanced photochemical oxidation of organic precursors and heterogeneous reactions on aerosols under strong solar
Allergenicity of latex rubber products used in South African dental ...
African Journals Online (AJOL)
Fourteen latex examination gloves (powdered and non-powdered) and five dental rubber dams, representing 6 brands, from five dental academic institutions were analysed for latex allergens and total protein. Total protein content was determined using the BioRad DC protein assay kit and natural rubber allergen levels ...
Comparing the level of dexterity offered by latex and nitrile SafeSkin gloves.
Sawyer, Jo; Bennett, Allan
2006-04-01
An increase in the occurrence of latex allergy has been concurrent with the increasing use of latex gloves by laboratory and healthcare workers. In recent years nitrile gloves have been used to replace latex gloves to prevent latex allergy. Nitrile gloves offer a comparable level of protection against chemical and biological agents and are more puncture resistant. However, if manual dexterity is compromised by nitrile gloves to a greater degree than latex then this may increase the risk of sharps injuries. The Purdue pegboard test, which measures both gross and fine finger dexterity, was used to test the dexterity levels of two glove types used at HPA CEPR; Kimberly-Clark SafeSkin nitrile and latex laboratory gloves. There was a statistically significant 8.6% increase in fine finger dexterity provided by latex compared with nitrile SafeSkin laboratory gloves but no difference in gross dexterity between the glove types. There was no significant relationship between glove dexterity and age or gender. The selection of glove size was influenced by the digit length of participants. Moreover, those with longer, thinner fingers appeared to have an advantage when using nitrile SafeSkin gloves. The level of dexterity provided by latex and nitrile SafeSkin gloves for tasks on a gross dexterity level are comparable and health workers will benefit from the non-allergenic properties of nitrile. For tasks requiring fine finger dexterity nitrile SafeSkin gloves may impede dexterity. Despite this, the degree of restriction appears to have a negligible impact on safety in this study when compared with the risk of latex sensitization and subsequent allergy. In addition to glove material, working practices must also take into account glove size, fit, grip and thickness, as these factors can all influence dexterity.
Radiation vulcanization of natural rubber latex with low energy accelerator
Energy Technology Data Exchange (ETDEWEB)
Haque, Emdadul; Makuuchi, Keizo; Ikeda, Kenichi; Yoshii, Fumio; Kume Tamikazu [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment; Mitomo, Hiroshi [Gunma Univ., Faculty of Engineering, Department of Biological and Chemical Engineering, Kiryu, Gunma (Japan)
2001-03-01
The radiation vulcanization of natural rubber latex (RVNRL) with the recently installed electron beam (EB) pilot plant at Takasaki Radiation Chemistry Research Establishment, Takasaki, Japan has been discussed. The accelerating voltage and beam current of the plant are 250 kV and 10 mA respectively. The plant has a reaction vessel with the capacity of 18 liters latex to irradiate at a time. In order to obtain a suitable setting of experimental for RVNRL under EB of the plant the parameters such as irradiation time, defoamer concentration, volume of latex, beam current etc. are being optimized by varying the individual parameter at a constant set of the other variables. (author)
Latex-modified fiber-reinforced concrete bridge deck overlay : construction/interim report.
1993-06-01
Latex-modified concrete (LMC) is Portland cement concrete (PCC) with an admixture of latex. LMC is considered to be nearly impermeable to chlorides and is extensively used to construct bridge deck overlays. Unfortunately, some of these overlays have ...
Identification and characterization of Euphorbia nivulia latex proteins.
Badgujar, Shamkant B; Mahajan, Raghunath T
2014-03-01
The protein profile of latex of Euphorbia nivulia Buch.-Ham. is established. Three new proteins viz., Nivulian-I, II and III have been purified to homogeneity from the latex. The relative molecular masses of Nivulian-I, II and III are 31,486.985, 43,670.846 and 52,803.470 Da respectively. Nivulian-I is a simple type of protein while Nivulian-II and III are glycoproteins. Peptide mass fingerprint analysis revealed peptides of these proteins match with Tubulin alpha-1 chain of Eleusine indica, Maturase K of Banksia quercifolia and hypothetical protein of Zea mays respectively. Tryptic digestion profile of Nivulian-I, II and III, infer the exclusive nature of latex origin proteins and may be new and are additive molecules in the dictionaries of phytoproteins or botany. This is the first of its kind, regarding characterization and validation of Nivulian-I, II and III with respect to peptide sequencing. Copyright © 2013 Elsevier B.V. All rights reserved.
Antimalarial Anthrone and Chromone from the Leaf Latex of Aloe ...
African Journals Online (AJOL)
In Ethiopian traditional medicine, the leaf latex of Aloe debranan Chrstian is used for the treatment of several diseases including malaria. In an ongoing search for effective, safe and cheap antimalarial agents from plants, the leaf latex of A. debrana was tested for its in vivo antimalarial activity, in a 4-day suppressive assay ...
Polylactide/Montmorillonite Hybrid Latex as a Barrier Coating for Paper Applications
Directory of Open Access Journals (Sweden)
Davide Bandera
2016-03-01
Full Text Available We developed a paper coating for the potential application in food packaging based on polylactide and montmorillonite. It is applied to the paper in the form of a stable, water-based latex with a solid content of 25–28 wt %. The latex is prepared from a commercially available polylactide, surfactants, montmorillonite, a plasticizer, chloroform (to be removed later and water by an emulsion/solvent evaporation procedure. This coating formulation is applied to the paper substrate by bar-coating, followed by hot-pressing at 150 °C. The coated papers achieved up to an 85% improvement in water vapor transmission rates when compared to the pristine papers. The coating latex is prepared from inexpensive materials and can be used for a solvent-free coating process. In addition, the ingredients of the latex are non-toxic; thus, the coated papers can be safely used for food packaging.
Erosive potential of calcium-modified acidic candies in irradiated dry mouth patients
DEFF Research Database (Denmark)
Jensdottir, Thorbjörg; Buchwald, Christian; Nauntofte, Birgitte
2010-01-01
PURPOSE: Patients who have received irradiation therapy on the head and neck area are known to suffer from reduced saliva flow and may therefore use acidic candies to relieve symptoms of dry mouth. However, such acidic candies have erosive potential even among healthy individuals. Therefore...... candies, while their whole saliva was collected into a closed system. The erosive potential of both candies was evaluated from saliva degree of saturation with respect to hydroxyapatite and by dissolution of hydroxyapatite (HAp) directly in candy-stimulated saliva. The results were compared to normative......, surprisingly, slightly lower in patients compared to normative data. CONCLUSIONS: Modified acidic candy with calcium has reduced erosive potential in patients irradiated on the head and neck area and could therefore be used as a favourable stimulant for relief of dry mouth....
Jiang, Hao; Zhang, Min; Mujumdar, Arun S; Lim, Rui-Xin
2014-07-01
To overcome the flaws of high energy consumption of freeze drying (FD) and the non-uniform drying of microwave freeze drying (MFD), pulse-spouted microwave vacuum drying (PSMVD) was developed. The results showed that the drying time can be dramatically shortened if microwave was used as the heating source. In this experiment, both MFD and PSMVD could shorten drying time by 50% as compared to the FD process. Depending on the heating method, MFD and PSMVD dried banana cubes showed trends of expansion while FD dried samples demonstrated trends of shrinkage. Shrinkage also brought intensive structure and highest fracturability of all three samples dried by different methods. The residual ascorbic acid content of PSMVD dried samples can be as high as in FD dried samples, which were superior to MFD dried samples. The tests confirmed that PSMVD could bring about better drying uniformity than MFD. Besides, compared with traditional MFD, PSMVD can provide better extrinsic feature, and can bring about improved nutritional features because of the higher residual ascorbic acid content. © 2013 Society of Chemical Industry.
Lactic acid bacteria in dried vegetables and spices.
Säde, Elina; Lassila, Elisa; Björkroth, Johanna
2016-02-01
Spices and dried vegetable seasonings are potential sources of bacterial contamination for foods. However, little is known about lactic acid bacteria (LAB) in spices and dried vegetables, even though certain LAB may cause food spoilage. In this study, we enumerated LAB in 104 spices and dried vegetables products aimed for the food manufacturing industry. The products were obtained from a spice wholesaler operating in Finland, and were sampled during a one-year period. We picked isolates (n = 343) for species identification based on numerical analysis of their ribotyping patterns and comparing them with the corresponding patterns of LAB type strains. We found LAB at levels >2 log CFU/g in 68 (65%) of the samples, with the highest counts detected from dried onion products and garlic powder with counts ranging from 4.24 to 6.64 log CFU/g. The LAB identified were predominantly Weissella spp. (61%) and Pediococcus spp. (15%) with Weissella confusa, Weissella cibaria, Weissella paramesenteroides, Pediococcus acidilactici and Pediococcus pentosaceus being the species identified. Other species identified belonged to the genera of Enterococcus spp. (8%), Leuconostoc spp. (6%) and Lactobacillus spp. (2%). Among the LAB identified, Leuconostoc citreum, Leuconostoc mesenteroides and W. confusa have been associated with food spoilage. Our findings suggest that spices and dried vegetables are potential sources of LAB contamination in the food industry. Copyright © 2015 Elsevier Ltd. All rights reserved.
Kim, Hwang-Hee; Kim, Chun-Soo; Jeon, Ji-Hong; Park, Chan-Gi
2016-01-29
To evaluate the effects of industrial by-products materials on the performance of porous concrete for plant growth, this study investigated the physical, strength, and freeze/thaw resistances of porous concrete for plant growth, prepared by replacing cement with blast furnace slag powder at 60% by weight, and replacing natural stone aggregates with coarse blast furnace slag aggregates at rates of 0%, 20%, 40%, 60% and 100% by weight. In addition, the effects of adding natural jute fiber and styrene butadiene ( SB) latex to these concrete mixtures were evaluated. The void ratio, compressive strength, and freeze/thaw resistance of the samples were measured. With increasing replacement rate of blast furnace aggregates, addition of latex, and mixing of natural jute fiber the void ratio of the concrete was increased. Compressive strength decreased as the replacement rate of blast-furnace slag aggregates increased. The compressive strength decreased after 100 freeze/thaw cycles, regardless of the replacement rate of blast furnace slag aggregates or of the addition of natural jute fiber and latex. The addition of natural jute fiber and latex decreased the compressive strength after 100 freeze/thaw cycles. The test results indicate that the control mixture satisfied the target compressive strength of 10 MPa and the target void ratio of 25% at replacement rates of 0% and 20% for blast furnace aggregates, and that the mixtures containing latex satisfied the criteria up to an aggregate replacement rate of 60%. However, the mixtures containing natural jute fiber did not satisfy these criteria. The relationship between void ratio and residual compressive strength after 100 freeze/thaw cycles indicates that the control mixture and the mixtures containing jute fiber at aggregate replacement rates of 20% and 40% satisfied the target void ratio of 25% and the target residual compressive strength of over 80% after 100 freeze/thaw cycles. The mixtures containing latex and aggregate
Directory of Open Access Journals (Sweden)
Hwang-Hee Kim
2016-01-01
Full Text Available To evaluate the effects of industrial by-products materials on the performance of porous concrete for plant growth, this study investigated the physical, strength, and freeze/thaw resistances of porous concrete for plant growth, prepared by replacing cement with blast furnace slag powder at 60% by weight, and replacing natural stone aggregates with coarse blast furnace slag aggregates at rates of 0%, 20%, 40%, 60% and 100% by weight. In addition, the effects of adding natural jute fiber and styrene butadiene (SB latex to these concrete mixtures were evaluated. The void ratio, compressive strength, and freeze/thaw resistance of the samples were measured. With increasing replacement rate of blast furnace aggregates, addition of latex, and mixing of natural jute fiber the void ratio of the concrete was increased. Compressive strength decreased as the replacement rate of blast-furnace slag aggregates increased. The compressive strength decreased after 100 freeze/thaw cycles, regardless of the replacement rate of blast furnace slag aggregates or of the addition of natural jute fiber and latex. The addition of natural jute fiber and latex decreased the compressive strength after 100 freeze/thaw cycles. The test results indicate that the control mixture satisfied the target compressive strength of 10 MPa and the target void ratio of 25% at replacement rates of 0% and 20% for blast furnace aggregates, and that the mixtures containing latex satisfied the criteria up to an aggregate replacement rate of 60%. However, the mixtures containing natural jute fiber did not satisfy these criteria. The relationship between void ratio and residual compressive strength after 100 freeze/thaw cycles indicates that the control mixture and the mixtures containing jute fiber at aggregate replacement rates of 20% and 40% satisfied the target void ratio of 25% and the target residual compressive strength of over 80% after 100 freeze/thaw cycles. The mixtures containing
High concentrations of natural rubber latex allergens in gloves used ...
African Journals Online (AJOL)
Introduction. Gloves made of natural rubber latex (NRL) are commonly used by healthcare workers because of their good qualities. However, allergic reactions to latex allergens are still commonly reported. Objective. To measure the concentrations of Hev b 1, Hev b 3, Hev b 5 and Hev b 6.02 allergens in gloves used by a ...
Application of radiation vulcanized natural rubber latex in Indonesia
International Nuclear Information System (INIS)
Soebianto, Y.S.; Wiwik Sofiarti; Razzak, M.T.
1996-01-01
The center has carried out R and D of Radiation Vulcanization Natural Rubber Latex (RVNRL) technology and introduced it to the industries since the inauguration and operation of the latex pilot plant in 1983. After years of experiences and the environmental consideration, n-butylacrylate (n-BA) has replaced CCI, as the sensitizer. Until now the introduction program shows that radiation vulcanized latex is more suitable for home industries than large industries. The obstacle of the program is the marketing of the dipped products. In spite of these problems, the introduction of this technology to the people in some undeveloped area of Java has supported the national program to improve their living standard. The problems of nitrosamine and protein allergic have turn up RVNRL to be the substitute of sulfur vulcanized latex in the future. The cooperation with a national condom manufacturer (PT Mitra Banjaran) has applied RVNRL for condom production in the large scale. Soft condoms with less probability of pinhole are obtained, but the technical problem is stickiness after pilling. Supply to a baby teat and a rubber thread manufacturer offers great advantages by not using any chemicals. In spite of the advantages, the problem of latex viscosity for dipping and the low modulus of elasticity of the threads arise. Through those input CAIR-BATAN is conducting the research and development in improving the crosslinking among the rubber particles that are supposed to be the reason of the stickiness and low modulus of elasticity. This effort is expected to be able to broaden the application of RVNRL, and it will be achieved only by the involvement of rubber chemist, rubber technologist, and radiation chemist
Histamine mediates the pro-inflammatory effect of latex of Calotropis procera in rats
Directory of Open Access Journals (Sweden)
Yatin M. Shivkar
2003-01-01
Full Text Available Introduction: Calotropis procera is known to produce contact dermatitis and the latex of this plant produces intense inflammation when injected locally. However, the precise mode of its pro-inflammatory effect is not known. In present study we have pharmacologically characterized the inflammation induced by latex of C. procera in a rat paw edema model and determined the role of histamine in latex-induced inflammation.
Pilot scale experiments on radiation vulcanization of NR latex
International Nuclear Information System (INIS)
Ridwan, M.
1985-01-01
The potential of irradiated latex as raw material of commercial use is under testing on pilot plant scale in Indonesia which has 225 kCi Co-60 irradiation facility and can irradiate 1000 tonnes of centrifuged latex per annum. The facility was jointly designed by BATAN of Indonesia and JAERI of Japan and was jointly financed by UNDP/IAEA, Government of Japan and Government of Indonesia under UNDP/IAEA Regional Cooperative Agreement Project on Industrial Application of Isotopes and Radiation Technology. The facility is a water pool type and can accommodate 400 kCi Co-60. The Co-60 rack has two shapes, plate and cylindrical shapes. The plate shape source is used for natural rubber latex irradiation and the cylindrical one is used for other irradiation services. The vulcanization system consists of three major components: emulsification unit, mixing unit and vulcanization reactor. The first two components are located outside shielded room while the third one in irradiation room. The radiation vulcanization process is a much simpler energy saving process compared to the conventional thermal process which has two vulcanization steps before and after dipping. The physical and mechanical properties of irradiated NR latex are comparable to those of sulfur vulcanized. (author)
Directory of Open Access Journals (Sweden)
Luciana Patrícia Lima Alves Pereira
2017-12-01
Full Text Available ABSTRACT Euphorbia umbellata (Pax Bruyns is an easily cultivated shrub, with occurrence in the tropical regions of the American and African continents. Chemical studies have revealed that the latex of this plant is rich in terpene compounds, which are highly toxic to snails Biomphalaria glabrata (Basommatophora: Planorbidae. The aim of this study was to evaluate the chemical composition and molluscicidal activity of the latex produced by E. umbellata, as well as the safety of its application in aquatic environments. The concentration of latex that killed 90% of the exposed snails after 24 h exposure (LC90 was 3.69 mg/L. Toxicity bioassays using Danio rerio (zebrafish revealed that these animals were less susceptible to latex than planorbids. However, it is important to perform other toxicity tests to ensure the feasibility of using latex to control populations of mollusks that contribute to schistosomiasis transmission. A phytochemical screening performed with the E. umbellata latex identified the triterpenoid and coumarin class. Further studies are warranted to isolate, identify, and test the active compounds of E. umbellata latex in B. glabrata.
Study on irradiation condition in radiation vulcanization of natural rubber latex
International Nuclear Information System (INIS)
Zhu Nankang; Wang Chunlei; Makuuchi, K.; Yoshii, F.
1996-01-01
The effect of gamma rays irradiation dose rates on RVNRL preparation was studied using Malaysian latex added with O.2 phr of KOH and 5 phr n-BA. The results showed, to ensure the tensile strength of the latex film meet the requirement, when applying vulcanisation doses, Dv of 20 kGy 20 and 15 kGy, irradiation dose rates should not be greater than 0. 49 kGy/hr and 1. 6 kGy/hr respectively. Its was found that within the storage time of 20 days there was no change in the physical properties of the latex films
Respiratory and dermal symptoms in Thai nurses using latex products.
Supapvanich, C; Povey, A C; de Vocht, F
2013-09-01
Despite known health risks related to the use of powdered latex gloves (PLGs), they are still widely used in hospitals in developing countries due to the high cost of alternatives. To determine the prevalence of dermal and respiratory symptoms associated with latex glove use in nurses in Thailand and evaluate the influence of previously reported occupational risk factors in this population. A cross-sectional study in female nurses working in three Thai hospitals. Participants completed a questionnaire on demographics, occupational and personal history, use of latex products at work and dermal and respiratory symptoms attributed to occupational use of latex gloves. Of 899 nurses, 18% reported health effects attributed to the use of latex products. After adjustment for confounding, occupational risk factors associated with increased reporting of dermal symptoms included wearing more than 15 pairs of PLG per day (odds ratio (OR): 2.10, 95% confidence interval (CI): [1.32-3.34]), using chlorhexidine (OR: 2.07, 95% CI: [1.22-3.52]) and being an operating theatre nurse (OR: 2.46, 95% CI: [1.47-4.12]). Being a labour ward nurse (OR: 3.52, 95% CI: [1.26-9.85]) was the only factor associated with increased reporting of respiratory symptoms. Continuing use of PLGs in Thai nurses is associated with increased prevalence of dermal symptoms compared with data from developed countries. Measures to reduce such health effects are well established and should be considered. Additionally, replacement of chlorhexidine with an alternative detergent seems advisable.
International Nuclear Information System (INIS)
Syuhada Ramli; Sofian Ibrahim; Mohd Noorwadi Mat Lazim
2016-01-01
This paper presents the effects of virgin coconut oil (VCO) and olive oil (OO) as an alternative stabilizer in the radiation vulcanized natural rubber latex (RVNRL). Potassium laurite (KL) as a stabilizer considered as a control of RVNRL sample were compared to mixed ratio 1:1 KL: VCO and 1:1 KL: OO stabilizer formulation. Total solid content (TSC) and tensile strength (TS) results showed no significant different between the formulations. Mechanical stability time (MST) indicates higher stability of RVNRL with addition of VCO. The fatty acid composition in VCO indicate VCO was acting well as stabilizer for latex stabilizer formulation. (author)
Aggregation and charging of sulfate and amidine latex particles in the presence of oxyanions.
Sugimoto, Takuya; Cao, Tianchi; Szilagyi, Istvan; Borkovec, Michal; Trefalt, Gregor
2018-08-15
Electrophoretic mobility and time resolved light scattering are used to measure the effect on charging and aggregation of amidine and sulfate latex particles of different oxyanions namely, phosphate, arsenate, sulfate, and selenate. In the case of negatively charged sulfate latex particles oxyanions represent the coions, while they represent counterions in the case of the positively charged amidine latex. Repulsive interaction between the sulfate latex surface and the coions results in weak ion specific effects on the charging and aggregation. On the other hand the interaction of oxyanions with the amidine latex surface is highly specific. The monovalent dihydrogen phosphate ion strongly adsorbs to the positively charged surface and reverses the charge of the particle. This charge reversal leads also to the restabilization of the amidine latex suspension at the intermediate phosphate concentrations. In the case of dihydrogen arsenate the adsorption to amidine latex surface is weaker and no charge reversal and restabilization occurs. Similar differences are seen between the sulfate and selenate analogues, where selenate adsorbs more strongly to the surface as compared to the sulfate ion and invokes charge reversal. The present results indicate that ion specificity is much more pronounced in the case of counterions. Copyright © 2018 Elsevier Inc. All rights reserved.
Managing latex allergies at home
... Associate Clinical Professor of Medicine, Division of Allergy, Immunology, and Rheumatology, Georgetown University Medical School, Washington, DC. Also reviewed by David Zieve, MD, MHA, Isla Ogilvie, PhD, and the A.D.A.M. Related MedlinePlus Health Topics Latex Allergy Browse the Encyclopedia A.D.A. ...
International Nuclear Information System (INIS)
Keizo Makuuchi; Fumio Yoshii; Miura, H.; Murakami, K.
1996-01-01
Thus a study has been carried out to investigate the effect of particle to particle variation in crosslink density on physical properties of radiation vulcanized NR latex film. NR latex was irradiated in small bottle by γ rays without vulcanization accelerator to provide latex rubber particles having homogeneous distribution of crosslink density. The doses were 30, 50, 100, 250, 300, 400, 500 and 600 kGy. Weight swelling ratio, gel fraction, tensile strength and elongation at break of the latex film from the mixed latex were measured. The vulcanization dose of this latex was 250 kGy. Then the two different latexes were mixed in a such way to adjust the average dose of 250 kGy to prepare a latex consisting of rubber particles having heterogeneous distribution of crosslink density. Tensile strength of the latex film was depressed by mixing. The reduction increased with increasing the decrease of gel fraction by mixing. However the reduction was not serious when the dose difference of two latexes was less than 200 kGy
Directory of Open Access Journals (Sweden)
Małgorzata Karwowska
2017-01-01
Full Text Available Objective This study evaluated the effect of acid whey and freeze-dried cranberries on the physicochemical characteristics, lipid oxidation and fatty acid composition of nitrite-free fermented sausage made from deer meat and pork fat. Antioxidant interactions between acid whey and cranberry compounds were also explored. Methods Four formulations of fermented venison sausage were prepared: F1 (control, F2 (with 5% liquid acid whey, F3 (with 0.06% of freeze-dried cranberries, and F4 (with 5% liquid acid whey and 0.06% of freeze-dried cranberries. Each sample was analyzed for pH, water activity (aw, heme iron content, 2-thiobarbituric acid reactive substances (TBARS value and conjugated dienes at the end of the manufacturing process and at 30 and 90 days of refrigerated storage. Fatty acid composition was measured once at the end of the manufacturing process. Results At the end of ripening, all samples presented statistically different values for a pH range of 4.47 to pH 4.59. The sum of the unsaturated fatty acids was higher, while the conjugated diene and the TBARS values were lower in sausages with freeze-dried cranberries as compared to the control sausage. The highest content of heme iron (21.52 mg/kg at day 90 was found in the sausage formulation with the addition of freeze-dried cranberries, which suggests that the addition of cranberries stabilized the porphyrin ring of the heme molecule during storage and thereby reduced the release of iron. The use of liquid acid whey in combination with cranberries appears to not be justified in view of the oxidative stability of the obtained products. Conclusion The results suggest that the application of freeze-dried cranberries can lower the intensity of oxidative changes during the storage of nitrite-free fermented sausage made from deer meat.
International Nuclear Information System (INIS)
Vo Van Thien; Nguyen Quoc Hien; Keizo Makuuchi; Fumio Yoshii
2000-01-01
Natural rubber latex was vulcanized by gamma radiation with n-butyl acrylate aqueous emulsion irradiated at dose of 1.5 kGy as sensitizer. The total solid content of latex increases on the irradiation dose. The viscosity of latex on the standing time was investigated and became stable after one month of storage. The gel content of latex films increasing with irradiation dose and attained more than 94% at dose of 10 kGy. Tensile strength of films reached the values of 31MPa; 30 Mpa and 25 Mpa at vulcanization doses of 20 kGy, 15 kGy and 8 kGy for the concentrations of sensitizer 7 phr, 9 phr and 13 phr respectively. Elongation at break decreases as increasing dose. Tear strength of rubber films was from 30-40 N/mm. The tackiness of latex films decreases and smell of vulcanized latex is almost negligible. (author)
Synthesis and Characterization of Core-Shell Acrylate Based Latex and Study of Its Reactive Blends
Directory of Open Access Journals (Sweden)
Ying Nie
2008-03-01
Full Text Available Techniques in resin blending are simple and efficient method for improving the properties of polymers, and have been used widely in polymer modification field. However, polymer latex blends such as the combination of latexes, especially the latexes with water-soluble polymers, were rarely reported. Here, we report a core-shell composite latex synthesized using methyl methacrylate (MMA, butyl acrylate (BA, 2-ethylhexyl acrylate (EHA and glycidyl methacrylate (GMA as monomers and ammonium persulfate and sodium bisulfite redox system as the initiator. Two stages seeded semi-continuous emulsion polymerization were employed for constructing a core-shell structure with P(MMA-co-BA component as the core and P(EHA-co-GMA component as the shell. Results of Transmission Electron Microscopy (TEM and Dynamics Light Scattering (DLS tests confirmed that the particles obtained are indeed possessing a desired core-shell structural character. Stable reactive latex blends were prepared by adding the latex with waterborne melamine-formaldehyde resin (MF or urea-formaldehyde resin (UF. It was found that the glass transition temperature, the mechanical strength and the hygroscopic property of films cast from the latex blends present marked enhancements under higher thermal treatment temperature. It was revealed that the physical properties of chemically reactive latexes with core-shell structure could be altered via the change of crosslinking density both from the addition of crosslinkers and the thermal treatment.
Progress in radiation vulcanization of natural rubber latex
International Nuclear Information System (INIS)
Makuuchi, Keizo
2000-01-01
Vulcanization dose defined as the radiation dose at which cross-linked natural rubber in latex has the maximum tensile strength can be reduced by adding carbon tetrachloride as a reaction accelerator. The radiation vulcanization of natural rubber latex was selected as one of regional projects of IAEA in 1989 and a pilot plant was built in Jakarta. The products from it were evaluated during 1983-1985, followed by IAEA decision to support the continued R and D study at Takasaki, JAERI. Various factors to improve the properties of the products have been studied. Several advantages of the process over conventional method, such as absence of N-nitrosoamines, low cytotoxicity, decomposability in the environment, transparency and softness, were confirmed. The technology has been transferred toward commercial application in Thailand, and pilot plants being set up in Indonesia, India, Malaysia and Thailand. Moreover, the process was found to be effective in reducing protein remaining in natural rubber latex products and the initial investment and irradiation cost was found to be greatly reduced by employing low energy electron accelerator. This paper reviews such progress. (S. Ohno)
Extractable protein of radiation vulcanized natural rubber latex
International Nuclear Information System (INIS)
Soebianto, Y.S.; Ratnayake, U.M.; Makuuchi, Keizo; Yoshii, Fumio; Kume, Tamikazu
2000-01-01
Protein remained in the latex products are reported to cause serious allergy. A new method to reduce the protein level in the latex products by irradiation is reported. Water soluble protein (WSP) solution (10%) was added into radiation vulcanized NR latex (RVNRL) in three different processes. The amount of WSP was 3 phr. It was only added to RVNRL (standard), added to re-centrifuged RVNRL (pre-centrifugation), and added to RVNRL followed by centrifugation (post-centrifugation). The protein content was determined by enhanced BCA method, and identified by SDS-PAGE. Extractable protein (EP) from the rubber has been reduced up to the minimum protein detection by combining WSP addition and centrifugation. Short leaching time (20-30 min.) can be achieved after the combine treatment, and SDS-PAGE confirms the reduction of soluble protein in the serum phase, and disappearance of protein bands in the rubber extract. Protein-WSP interaction produces water soluble complex, and removed by centrifugation. The efficiency of protein removal by WSP depends on its molecular weight of WSP which relates to its water solubility. (author)
Oral omega-6 essential fatty acid treatment in contact lens associated dry eye.
Kokke, Karolien H; Morris, Judith A; Lawrenson, John G
2008-06-01
Symptoms of dry eye are commonly reported in contact lens wearers and are a frequent cause of non-tolerance. The purpose of the present study is to evaluate the effects of oral treatment with particular omega-6 fatty acids in the form of evening primrose oil (EPO) on subjective symptoms, ocular surface signs and tear film characteristic in patients with contact lens associated dry eye. The study design was randomised, double-masked and placebo controlled. 76 female soft contact lens wearers were treated for 6 months with either EPO or placebo (olive oil). Subjects underwent three examinations (baseline, 3 and 6 months). At each examination subjects were given a questionnaire relating to lens comfort and dry eye symptoms and underwent a series of tests of tear film characteristics (tear meniscus height, break-up time), meibomian gland function (lipid layer thickness and quality) and ocular surface parameters (hyperaemia and staining). The EPO group showed a significant improvement in the specific symptom of 'dryness' at 3 and 6 months (porally administered omega-6 fatty acids in alleviating dry eye symptoms and improving overall lens comfort in patients suffering from contact lens associated dry eye.
The drying method affects the organic acid content of alfalfa forages
Directory of Open Access Journals (Sweden)
P. Pezzi
2011-03-01
Full Text Available Malic acid (the main organic acid contained in alfalfa; Callaway et al., 1997 is an important metabolite for ruminal microbial population since it improves the uptake of lactic acid by Selenomonas ruminantium (Evans and Martin, 1997 and Megasphaera elsdenii (Rossi and Piva, 1999. Several studies have shown the effect of adding malic acid to the diet of steers and dairy cows on ruminal fermentation (Martin et al., 1999; Martin et al., 2000 and animal performances (Krummrey et al., 1979; Stallcup, 1979; Kung et al., 1982. Aim of this study was the evaluation of the influence of drying method.......
Improving of Water Resistance of Asphalt Concrete Wearing Course Using Latex-Bitumen Binder
Directory of Open Access Journals (Sweden)
Siswanto Henri
2017-01-01
Full Text Available It is well known that presence of water in a bituminous mix is a critical factor which can lead to premature failure of flexible pavements. This requires solutions one of which is to formulate an asphalt mix that has a high resistance to moisture and one way to do this is to mix latex with the asphalt mix. The purpose of this experimental study was to investigate the effect of water on Marshall stability of asphalt concrete wearing course (ACWC made with a latex-bitumen binder. Latex-bitumen was mixed with aggregate and four levels of latex content were investigated in this study, namely, 0%, 2%, 4% and 6% respectively by weight of asphalt. Wet procces was used in the blending of mixtures. The procedure used to obtain the optimum binder contents conformed to the Marshall procedure (SNI 06-2489-1991. Six Marshall specimens at optimum binder content were prepared for each binder mix investigated. Three of six specimens from each group were tested under Marshall standards. The remaining specimens were tested by immersion in a bath at 60°C for 24 hours. The Marshall index of retained stability was used to evaluate the effect of water on the Marshall stability of ACWC. The results indicated that the addition of up to 4% latex to ACWC mix increased the retained Marshall stability, whereas the addition of latex above 4% decreased the retained stability of the mixture. The addition of 4% CRM significantly improved the retained stability of the mixture and was the best latex – ACWC mix.
IMMEDIATE AND DELAYED HYPERSENSITIVITY REACTIONS TO LATEX GLOVES IN A DENTAL STUDENT. A case report.
Directory of Open Access Journals (Sweden)
Iliyana Stoeva
2011-08-01
Full Text Available The article presents a case of dental student with immediate and delayed hypersensitivity reaction to latex gloves. Symptoms appeared during the second year of regularly using of latex gloves. The student was with no history of allergies and no previous exposure to latex products.
Science and technology of rubber reclamation with special attention to NR based waste latex products
Rajan, V.V.; Dierkes, Wilma K.; Joseph, R.; Noordermeer, Jacobus W.M.
2006-01-01
A comprehensive overview of reclamation of cured rubber with special emphasis on latex reclamation is depicted in this paper. The latex industry has expanded over the years to meet the world demands for gloves, condoms, latex thread, etc. Due to the strict specifications for the products and the
Norhazariah, S.; Azura, A. R.; Azahari, B.; Sivakumar, R.
2017-12-01
Semi-refined carrageenan (SRC) product is considerably cheaper and easier to produce as a natural polysaccharide, which was utilized in food and other product application. However, the application in latex is limited. The aim of this work is to evaluate the SRC produced from low industrial grade seaweed (LIGS) in the latex foam application. The FTIR spectra showed the SRC produced as kappa type carrageenan with lower sulfur content compared to native LIGS. NR latex foam is produced by using the Dunlop method with some modifications. The effect of SRC loading as a secondary gelling agent in NR latex foam is investigated. The density and morphology of the NR latex foam with the addition of the SRC are analyzed. NR latex foam density increased with SRC loading and peaked at 1.8 phr SRC. The addition of SRC has induced the bigger cell size compared to the cell size of the control NR latex foam, as shown in the optical micrograph. It can be concluded that SRC LIGS could be acted as secondary gelling agent in NR latex foam.
Radiation vulcanization of natural rubber latex (NRL) using low energy electron beam accelerator
International Nuclear Information System (INIS)
Feroza Akhtar; Keizo Makuuchi; Fumio Yoshii
1996-01-01
The electron beam induced vulcanization of natural rubber latex has been studied using low energy Electron Beam (EB) accelerators of 300, 250 and 175 keV ne latex was irradiated in a special type stainless steel reaction reactor with a stirrer at the bottom of the reactor. From the results it was found that 300 and 250 keV accelerators could effectively vulcanize NRL. But accelerator of 175 keV is too low energy to vulcanize the latex. At the same time a drum type irradiator where thin layer of NRL was irradiated by accelerator, was used for vulcanization of NRL. This type of irradiator also showed good physical properties of vulcanized latex. The effects of beam current and stirrer speed on vulcanization were studied
Nuhriawangsa, A. M. P.; Hertanto, B. S.; Kartikasari, L. R.; Swastike, W.; Cahyadi, M.; Rasid, S.
2018-01-01
The objective of this study was to evaluate the effect of extract level of Biduri latex on the meat quality of laying hens. The materials of this research were Biduri latex and thigh meat from hens strain Lohman. The latex was tapped from a young tissue stem and centrifuged for its supernatant. Meats were smeared with latex, punctured and incubated for 30 minutes. Concentrations of latex were 0, 3, 6 and 9% from the weight of meat (w/w). The variables were water, dissolved protein, crude fat content, tenderness and microstructure of meat. The statistical analysis method using ANOVA and if there was a mean difference, Duncan test was used. Descriptive analysis was used for microstructures of meat by comparing its hydrolysis conditions. The study showed that fat had significant difference (P meat structure. The fat content increased with addition of 3% latex. The value of dissolved protein increased but tenderness decreased by addition extract of 6% latex. The addition of Biduri latex extract showed that hydrolysis in the microstructure of meat. The addition of 6% latex was the best meat quality.
Latex Rubber Gloves as a Sampling Dosimeter Using a Novel Surrogate Sampling Device.
Sankaran, Gayatri; Lopez, Terry; Ries, Steve; Ross, John; Vega, Helen; Eastmond, David A; Krieger, Robert I
2015-01-01
Pesticide exposure during harvesting of crops occurs primarily to the workers' hands. When harvesters wear latex rubber gloves for personal safety and hygiene harvesting reasons, gloves accumulate pesticide residues. Hence, characterization of the gloves' properties may be useful for pesticide exposure assessments. Controlled field studies were conducted using latex rubber gloves to define the factors that influence the transfer of pesticides to the glove and that would affect their use as a residue monitoring device. A novel sampling device called the Brinkman Contact Transfer Unit (BCTU) was constructed to study the glove characteristics and residue transfer and accumulation under controlled conditions on turf. The effectiveness of latex rubber gloves as sampling dosimeters was evaluated by measuring the transferable pesticide residues as a function of time. The validation of latex rubber gloves as a residue sampling dosimeter was performed by comparing pesticide transfer and dissipation from the gloves, with the turf transferable residues sampled using the validated California (CA) Roller, a standard measure of residue transfer. The observed correlation (Pearson's correlation coefficient R(2)) between the two methods was .84 for malathion and .96 for fenpropathrin, indicating that the BCTU is a useful, reliable surrogate tool for studying available residue transfer to latex rubber gloves under experimental conditions. Perhaps more importantly, these data demonstrate that latex gloves worn by workers may be useful quantifiable matrices for measuring pesticide exposure.
Directory of Open Access Journals (Sweden)
Ilknur Alibas
2014-06-01
Full Text Available Mallow leaves (Malva sylvestris L. with initial moisture of 5.02±0.003 on dry basis (82.5% on wet basis were dried using three different drying methods, microwave, convective and vacuum. The leaves that weigh 75 g each were dried until their moisture fell down to 0.10±0.005 on dry basis (approximately 9% on wet basis. The following drying levels were used in each of the drying processes: 6.67, 8.67, 10, 11.33 W g-1 microwave power density; 50, 75, 100 and 125 °C for convective drying; and 3, 7 kPa at 50 and 75 °C for vacuum drying. Drying periods ranged from 6-10, 26-150 and 38-130 min. for microwave, convective and vacuum drying, respectively. Effective moisture diffisuvities ranged from 2.04403 10-10-3.63996 10-12 m2 s-1, 1.70182 10-11-1.10084 10-10 m2 s-1 and 1.85599 10-11-5.94559 10-10 m2 s-1 for microwave, convective and vacuum drying, respectively. According to ascorbic acid content and color parameters, the best microwave power density was found 10 W g-1 with a drying period of 6.5 min.
Labbtex: Toolbox para generación de informes en LATEX para Matlab
Directory of Open Access Journals (Sweden)
José Luis Almazán Gárate
2012-10-01
Full Text Available En este artículo se presenta el software desarrollado por el Equipo H3lite dentro del Departamento de Ingeneniería Civil. Transportes de la Escuela de Ingenieros de Caminos, Canales y Puertos de la Universidad Politécnica de Madrid para la generación de informes enLATEX mediante el software Matlab® y la integración en sus rutinas, Labbtex.La librería Labbtex proporciona un marco flexible para mezclar texto y código Matlab® para la generación automática de documentos. Un rchivo fuente simple contiene el texto de documentación y el código Matlab, al correr la aplicación se genera un documento final LATEX que contiene el texto, gráficos y tablas indicados con el formato de un documento LATEX. El código Matlab genera un documento LATEX usando la sintaxis. Así, LATEX (para composición de texto de alta calidad y Matlab® (para cálculo matemático pueden usarse simultáneamente. Esto permite la generación de informes en tiempo real con un uso de recursos mínimo.
Directory of Open Access Journals (Sweden)
Dr. Athma Prasanna
2005-10-01
Full Text Available The usage of rubber and its products are not uncommon in various walks of life. A continuous exposure or contact may sensitize the human body, causing reactions from mild to fatal. Despite the availability of the literature, medical personnel are still unaware of the implications of the use of latex materials.
Solid state NMR and LVSEM studies on the hardening of latex modified tile mortar systems
International Nuclear Information System (INIS)
Rottstegge, J.; Arnold, M.; Herschke, L.; Glasser, G.; Wilhelm, M.; Spiess, H.W.; Hergeth, W.D.
2005-01-01
Construction mortars contain a broad variety of both inorganic and organic additives beside the cement powder. Here we present a study of tile mortar systems based on portland cement, quartz, methyl cellulose and different latex additives. As known, the methyl cellulose stabilizes the freshly prepared cement paste, the latex additive enhances final hydrophobicity, flexibility and adhesion. Measurements were performed by solid state nuclear magnetic resonance (NMR) and low voltage scanning electron microscopy (LVSEM) to probe the influence of the latex additives on the hydration, hardening and the final tile mortar properties. While solid state NMR enables monitoring of the bulk composition, scanning electron microscopy affords visualization of particles and textures with respect to their shape and the distribution of the different phases. Within the alkaline cement paste, the poly(vinyl acetate) (VAc)-based latex dispersions stabilized by poly(vinyl alcohol) (PVA) were found to be relatively stable against hydrolysis. The influence of the combined organic additives methyl cellulose, poly(vinyl alcohol) and latexes stabilized by poly(vinyl alcohol) on the final silicate structure of the cement hydration products is small. But even small amounts of additives result in an increased ratio of ettringite to monosulfate within the final hydrated tile mortar as monitored by 27 Al NMR. The latex was found to be adsorbed to the inorganic surfaces, acting as glue to the inorganic components. For similar latex water interfaces built up by poly(vinyl alcohol), a variation in the latex polymer composition results in modified organic textures. In addition to the networks of the inorganic cement and of the latex, there is a weak network build up by thin polymer fibers, most probably originating from poly(vinyl alcohol). Besides the weak network, polymer fibers form well-ordered textures covering inorganic crystals such as portlandite
DEFF Research Database (Denmark)
Palosuo, Timo; Antoniadou, Irini; Gottrup, Finn
2011-01-01
Many hospitals have implemented policies to restrict or ban the use of devices made of natural rubber latex (NRL) in healthcare as precautionary measures against the perceived risk of NRL allergy. Changes in glove technology, progress in measuring the specific allergenic potential of gloves...... properties of NRL and synthetic gloves and the role of glove powder. The review shows that NRL medical gloves, when compared with synthetic gloves, tend to be stronger, more flexible and better accepted by clinicians. The introduction of powder-free gloves has been associated with reductions in protein...
Grossiord, N.; Wouters, M.E.L.; Miltner, H.E.; Lu, K.; Loos, J.; Van Mele, B.; Koning, C.E.
2010-01-01
Several series of nanocomposites were prepared using a latex-based process, the main step of which consisted of mixing an aqueous suspension of exfoliated carbon nanotubes (CNTs) and a polymer latex. In the present work, a systematic study on the electrical properties of fully amorphous (polystyrene
Proceedings of the international symposium on radiation vulcanization of natural rubber latex
International Nuclear Information System (INIS)
Machi, Sueo
1990-01-01
The First International Symposium on Radiation Vulcanization of Natural Rubber Latex (RVNRL) was held from 26 to 28 July 1989 at Tokyo and Takasaki. In these proceedings, thirty six papers presented at the Symposium are compiled. Main topics are commercial application of RVNRL, characterization of NR latex and vulcanization, properties of radiation vulcanized NR latex, development of sensitizers, mechanism of RVNRL, RVNRL with electron beams, and new Co-60 irradiator for RVNRL. Absence of nitrosamines and low cytotoxicity of radiation vulcanized NR latex are recognized as the remarkable advantages of RVNRL. The radiation vulcanization process for the production of protective rubber gloves for radioactive contamination was presented as the first commercial success in RVNRL. It was reported that various kinds of rubber articles for medical uses have being developed in West Germany. A sensitizer system consisting of n-butyl acrylate and t-butyl hydroperoxide was found to reduce the vulcanization dose to 8 kGy. (author)
CDNA library from the Latex of Hevea brasiliensis
Directory of Open Access Journals (Sweden)
Wilaiwan Chotigeat
2010-12-01
Full Text Available Latex from Hevea brasiliensis contains 30-50% (w/w of natural rubber (cis-1,4-polyisoprene, the important rawmaterial for many rubber industries. We have constructed a cDNA library from the latex of H. brasiliensis to investigate theexpressed genes and molecular events in the latex. We analyzed 412 expressed sequence tags (ESTs. More than 90% of theEST clones showed homology to previously described sequences in public databases. Functional classification of the ESTsshowed that the largest category were proteins of unknown function (30.1%, 11.4% of ESTs encoded for rubber synthesisrelatedproteins (RS and 8.5% for defense or stress related proteins (DS. Those with no significant homology to knownsequences (NSH accounted for 8.7%, primary metabolism (PM and gene expression and RNA metabolism were 7.8% and6.6%, respectively. Other categories included, protein synthesis-related proteins (6.6%, chromatin and DNA metabolism(CDM 3.9%, energy metabolism (EM 3.4%, cellular transport (CT 3.2%, cell structure (CS 3.2%, signal transduction (ST2.2%, secondary metabolism (SM 1.7%, protein fate (PF 2.2%, and reproductive proteins (RP 0.7%.
Spray-dried adjunct cultures of autochthonous non-starter lactic acid bacteria.
Peralta, Guillermo H; Bergamini, Carina V; Audero, Gabriela; Páez, Roxana; Wolf, I Verónica; Perotti, M Cristina; Hynes, Erica R
2017-08-16
Spray-drying of lactic cultures provides direct-to-vat starters, which facilitate their commercialization and use. However, this process may alter the metabolic activity and deteriorate technological features. In this work, we assessed the influence of spray-drying on the survival and aroma production of two strains of mesophilic lactobacilli: Lactobacillus paracasei 90 and Lactobacillus plantarum 91, which have already been characterized as good adjunct cultures. The spray-drying was carried out using a laboratory scale spray and the dried cultures were monitored during the storage for the survival rate. The dried cultures were applied to two cheese models: sterile cheese extract and miniature soft cheese. The influence on the carbohydrate metabolism and the production of organic acids and volatile compounds was determined. Both strains retained high levels of viable counts in the powder after drying and during the storage at 5°C for twelve months. In addition, they also remained at high level in both cheese models during incubation or ripening. Similar profiles of carbohydrate fermentation and bioformation of volatile compounds were observed in the cheese extracts for each of the strains when tested as both fresh and dried cultures. In addition, the ability of Lb. paracasei 90 to increase the production of acetoin and diacetyl remarkably in cheese models was also confirmed for the spray-dried culture. Copyright © 2017 Elsevier B.V. All rights reserved.
Dry-boxes for manipulation of high-energy β emitters
International Nuclear Information System (INIS)
Boclet, K.; Laurent, H.
1958-01-01
Because of the thinners of latex or neoprene gloves and the high intensity of Bremsstrahlung radiation, manipulation of pure high-energy β - emitters is impossible in ordinary dry-boxes. There are many types of box equipped with heavy lead or steel protection, but their use for radioelements such as 32 P, 90 Sr, 90 Y is not justified. We have devised units known as 'tong boxes' which, while retaining much of the flexibility of operation found in dry-boxes, provide adequate protection. 1 curie of 32 P placed in the centre of the enclosure gives about 15 mR/ 8 h. at the part of the wall closest to the source. (author) [fr
Obregón, Walter D; Liggieri, Constanza S; Trejo, Sebastian A; Avilés, Francesc X; Vairo-Cavalli, Sandra E; Priolo, Nora S
2009-01-01
Latices from Asclepias spp are used in wound healing and the treatment of some digestive disorders. These pharmacological actions have been attributed to the presence of cysteine proteases in these milky latices. Asclepias curassavica (Asclepiadaceae), "scarlet milkweed" is a perennial subshrub native to South America. In the current paper we report a new approach directed at the selective biochemical and molecular characterization of asclepain cI (acI) and asclepain cII (acII), the enzymes responsible for the proteolytic activity of the scarlet milkweed latex. SDS-PAGE spots of both purified peptidases were digested with trypsin and Peptide Mass Fingerprints (PMFs) obtained showed no equivalent peptides. No identification was possible by MASCOT search due to the paucity of information concerning Asclepiadaceae latex cysteine proteinases available in databases. From total RNA extracted from latex samples, cDNA of both peptidases was obtained by RT-PCR using degenerate primers encoding Asclepiadaceae cysteine peptidase conserved domains. Theoretical PMFs of partial polypeptide sequences obtained by cloning (186 and 185 amino acids) were compared with empirical PMFs, confirming that the sequences of 186 and 185 amino acids correspond to acI and acII, respectively. N-terminal sequences of acI and acII, characterized by Edman sequencing, were overlapped with those coming from the cDNA to obtain the full-length sequence of both mature peptidases (212 and 211 residues respectively). Alignment and phylogenetic analysis confirmed that acI and acII belong to the subfamily C1A forming a new group of papain-like cysteine peptidases together with asclepain f from Asclepias fruticosa. We conclude that PMF could be adopted as an excellent tool to differentiate, in a fast and unequivocal way, peptidases with very similar physicochemical and functional properties, with advantages over other conventional methods (for instance enzyme kinetics) that are time consuming and afford less
Faucheu, Jenny; Chazeau, Laurent; Gauthier, Catherine; Cavaillé, Jean-Yves; Goikoetxea, Monika; Minari, Roque; Asua, José M
2009-09-01
Among other uses, latexes are a successful alternative to solvent-borne binders for coatings. Efforts are made to produce hybrid nanostructured latexes containing an acrylic phase and an alkyd phase. However, after the film-forming process, the surfactant used to stabilize these latexes remains in the film, and its location can have a drastic effect on the application properties. Among the processing parameters, the alkyd hydrophobicity can strongly influence this location. This article aims at the imaging of these surfactant molecules in two hybrid latexes with different hydrophobicity level of the alkyd resin. A first part of this paper is dedicated to the understanding of the contrast provided by the surfactant in environmental STEM imaging of latexes. Then, the influence of surfactant-polymer affinity on the surfactant location after film-forming of those hybrid alkyd/acrylate latexes is studied by this technique. It is shown that in the hybrid latex with an alkyd shell (obtained with the most hydrophilic resin), the surfactant molecules tend to remain buried in the alkyd phase. Conversely, in the hybrid latex with an acrylate shell (in the case of the most hydrophobic resin), the surfactant molecules tend to gather into islands like in pure acrylate latex films.
Latex-modified grouts for in-situ stabilization of buried transuranic/mixed waste
International Nuclear Information System (INIS)
Allan, M.L.
1996-06-01
The Department of Applied Science at Brookhaven national Laboratory was requested to investigate latex-modified grouts for in-situ stabilization of buried TRU/mixed waste for INEL. The waste exists in shallow trenches that were backfilled with soil. The objective was to formulate latex-modified grouts for use with the jet grouting technique to enable in-situ stabilization of buried waste. The stabilized waste was either to be left in place or retrieved for further processing. Grouting prior to retrieval reduces the potential release of contaminants. Rheological properties of latex-modified grouts were investigated and compared with those of conventional neat cement grouts used for jet grouting
Radiation vulcanization of natural rubber latex with low energy accelerator-II
Energy Technology Data Exchange (ETDEWEB)
Haque, Md. Emdadul; Makuuchi, Keizo; Ikeda, Kenichi; Yoshii, Fumio; Kume, Tamikazu [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment; Mitomo, Hiroshi [Gunma Univ., Faculty of Engineering, Dept. of Biological and Chemical Engineering, Kiryu, Gunma (Japan)
2002-03-01
The natural rubber latex (NRL) was radiation vulcanized under a low energy electron accelerator. Accelerating voltage and maximum beam current of this accelerator are 250 kV and 10 mA respectively. Irradiation was carried out in a reaction vessel with constant stirring. The capacity of the vessel is 18 liters. Radiation vulcanization accelerators (RVA) were normal butyl acrylate (n-BA) and nonane-diol-diacrylate (NDDA). NDDA has no bad smell like that of n-BA. 20 minutes irradiation time is enough to vulcanize 14 liters of latex when 5 phr RVA (both types) are used. Maximum of {approx}30 MPa tensile strength was obtained with 5 phr NDD-A. However the remained NDDA is difficult to remove due to high molecular weight. Water-extractable proteins content was determined in dipped films for various leaching conditions without and with additive (polyvinyl alcohol, PVA). Water extractable proteins content is reduced to {<=} 41 by adding 5 phr PVA and leaching for 8 hours. The tackiness of the dipped films is reduced to 0.1 from 9 gf by mixing 6 phr PVA with the irradiated latex. Hand gloves (surgical and examination) were successfully produced from the irradiated latex. (author)
International Nuclear Information System (INIS)
Martins, Carlos Felipe Pinto
2005-01-01
The natural rubber latex (NRL) is industrially crosslinked by the conventional process of vulcanization, which uses sulphur and heat. Otherwise, the network can also be done by the alternative process with ionizing radiation. In this work the crosslinking of NRL was studied by the comparison of the conventional vulcanization system and the ionizing radiation process of 60 C source. The products obtained, the irradiated latex, the irradiated latex with approximately 1% of soy lecithin and the sulphur vulcanized latex were tested by accelerated aging with ultraviolet (UV) and outdoor aging with compostage, tensile strength at break, swelling and gel fraction, fungi micro biota, scanning electron microscopy (SEM), infrared spectroscopy (FTIR) and thermogravimetry and differential scanning calorimetry analysis (TG and DSC). The results showed that the aging with microorganisms have a great influence in the physical properties of the samples. The thermal stability order observed showed that the sulphur vulcanized latex is more resistant, what is probably associated to a network more stable under the aging conditions. On the other hand, the irradiated latex showed intense biodegradation aspects, particularly with the presence of the soy lecithin. (author)
Thermodynamics of swelling of latex particles with two monomers: a sensitivity analysis
Maxwell, I.A.; Noel, E.F.J.; Schoonbrood, H.A.S.; German, A.L.
1993-01-01
A sensitivity anal. is performed to det. at what conditions the simplified model for swelling of latex particles by two monomers or two solvents is valid. This model proposes that, inter alia, the fractions of two monomers in the latex particles and in the monomer droplets are equal. The model is a
Color Spectrum Properties of Pure and Non-Pure LATEX in Discriminating Rubber Clone Series
International Nuclear Information System (INIS)
Noor Aishah Khairuzzaman; Hadzli Hashim; Nina Korlina Madzhi; Noor Ezan Abdullah; Faridatul Aima Ismail; Ahmad Faiz Sampian; Azhana Fatnin Che Will
2015-01-01
A study of color spectrum properties for pure and non-pure latex in discriminating rubber clone series has been presented in this paper. There were five types of clones from the same series being used as samples in this study named RRIM2002, RRIM2007, RRIM2008, RRIM2014, and RRIM3001. The main objective is to identify the significant color spectrum (RGB) from pure and non-pure latex that can discriminate rubber clone series. The significant information of color spectrum properties for pure and non-pure latex is determined by using spectrometer and Statistical Package for the Social Science (SPSS). Visible light spectrum (VIS) is used as a radiation light of the spectrometer to emit light to the surface of the latex sample. By using SPSS software, the further numerical analysis of color spectrum properties is being conducted. As the conclusion, blue color spectrum for non-pure is able to discriminate for all rubber clone series whereas only certain color spectrum can differentiate several clone series for pure latex. (author)
Yield and acidity indices of sunflower and soybean oils in function of grain drying and storage
Directory of Open Access Journals (Sweden)
Paulo Carteri Coradi
2017-04-01
Full Text Available The aim of this study was to identify the best conditions for drying and storing soybeans and sunflower grains to maintain their quality. In the first experiment, the soybeans were found to have initial moisture contents of 25 and 19% (w.b. at different drying air temperatures (75, 90, 105, and 120°C. In the second step, the soybeans were evaluated after they were stored in paper bags and plastic polyethylene at temperatures of 3, 10 and 23°C for six months. In the third experiment, sunflower grains were tested after exposure to drying air temperatures of 45, 55, 65, and 75°C, and under storage conditions of 25°C and 50%, 20°C and 60%, 30°C and 40% RH over six months in paper bags and raffia. Drying the sunflower seeds at 45°C and storing them at 30°C and 40% RH led to higher oil yields and lower acid numbers. The oil that was extracted from the acid number was higher for soybean grains that were dried down from initial concentrations of 25% water at a drying air temperature of 120°C. The air temperature in storage at 3°C favored for yield and reduction of the soybean oil acidity.
Oral omega-6 essential fatty acid treatment in contact lens associated dry eye.
Kokke, K. H.; Morris, J. A.; Lawrenson, J.
2008-01-01
Symptoms of dry eye are commonly reported in contact lens wearers and are a frequent cause of non-tolerance. The purpose of the present study is to evaluate the effects of oral treatment with particular omega-6 fatty acids in the form of evening primrose oil (EPO) on subjective symptoms, ocular surface signs and tear film characteristic in patients with contact lens associated dry eye.
Antioxidant and sensitizer effect on the stability of natural rubber latex vulcanized by gamma rays
International Nuclear Information System (INIS)
Canavel, V.
1993-01-01
The natural rubber latex was vulcanized by gamma rays and electrons beam, in the presence and absence of sensitizer at room temperature. The sensitizers were the following; n-butyl acrylate (n-BA) / t-butyl hydroperoxide (t-B H) / KOH, C Cl 4 / potassium laurate and n-BA / KOH. The studied antioxidants, Irganox 1520, Vulcanox SP and Vulcanox BKF, were added to the latex after irradiation. Among the studied antioxidants in function of tensile strength (TS) after the aging of rubber plates, the Irganox was the best efficient on the gamma vulcanization in the presence of n-BA/t-B H/KOH, because only 0,20 p hr is enough to obtain the greatest increase of TS, that was 34%, 12 MPa to 16 MPa. The formulating method of latex with the sensitizer constituted the 3,0 p hr of n-BA/ 0,1 p hr of t-B H and 0,2 p hr of KOH, was evaluated respecting the TS of rubber plates. The electrons beam vulcanization produces the greatest reversible perturbance in the colloidal stability of latex after irradiation caused by radiolytic species absorption that promotes the increase of particle size. The antioxidant also contributes to reversible destabilization of gamma irradiated latex, because it is also adsorbed by particles surface. The relation between the latex viscosity and the TS of respective rubber plates is reverse, showing the latex stability affects the quality of rubber goods. (author)
The entry of free radicals into polystyrene latex particles
International Nuclear Information System (INIS)
Adams, M.E.; Trau, M.; Gilbert, R.C.; Napper, D.R.
1988-01-01
Mechanistic understanding of the processes governing the kinetics of emulsion polymerization has both scientific and technical interest. One component of this process that is poorly understood at present is that of free radical entry into latex particles. Measurements were made of the entry rate coefficient as a function of temperature for free radicals entering polystyrene latex particles in seeded emulsion polymerizations initiated by γ-rays. The activation energy for entry was found to be less than 24 ± 3 kJ mol -1 , consistent with entry being controlled by a physical (e.g. diffusional) rather than a chemical process. Measurement of the entry rate coefficient as a function of the γ-ray dose rate suggested that the factors that determine the entry rate when the primary free radicals are uncharged are similar to those that determine the entry rate for charged free radicals derived from chemical initiation by peroxydisulfate. This result was consistent with measurements of the entry rate coefficient of charged free radicals derived from peroxydisulfate; these data were found to be virtually independent of both the extent of the latex surface coverage by the anionic surfactant sodium dodecyl sulfate and the ionic strength of the continuous phase. The data refute several proposals given in the literature for the rate-determining step for entry, being inconsistent with control by collision of free radicals with the latex particles, surfactant desorption, and an electrostatic barrier arising from the colloidal nature of the entering free radical. The origin of the activation energy for entry remains obscure
Osmotic de-swelling and swelling of latex dispersions
International Nuclear Information System (INIS)
Bonnet-Gonnet, Cecile
1993-01-01
This research thesis reports the comparison of, on the one hand, direct measurements of de-swelling resistance of latex dispersions obtained by osmotic pressure with, on the other hand, predictions made by models of electrostatic interactions. This resistance is explained in the case of sulphate-stabilised polystyrene particles (direct repulsion between charged particles), and in the case of copolymer (ps-pba) particles covered by an amphiphilic polymer (interactions between surface macromolecules and polymers). The study of de-swelling and swelling cycles highlights the existence of thresholds beyond which the concentrated dispersion has some cohesion. This irreversibility can be modelled by a Van der Waals attraction. The role of hydrophobic forces in latex destabilisation is studied [fr
Anticancer activity of flavonol and flavan-3-ol rich extracts from Croton celtidifolius latex.
Biscaro, Fernanda; Parisotto, Eduardo Benedetti; Zanette, Vanilde Citadini; Günther, Tania Mara Fischer; Ferreira, Eduardo Antonio; Gris, Eliana Fortes; Correia, João Francisco Gomes; Pich, Claus Tröger; Mattivi, Fulvio; Filho, Danilo Wilhelm; Pedrosa, Rozangela Curi
2013-06-01
Croton celtidifolius Baill (Euphorbiaceae) is a tree found in the Atlantic Forest in Southern Brazil, where it is commonly known as "Sangue-de-Dragão". Its red latex is used traditionally for treating ulcers, diabetes and cancer. To evaluate antitumor activities of Croton celtififolius latex in vitro and in vivo. Phytochemical analyses were conducted using HPLC-DAD-MS. Cytotoxic, nuclease and pro-apoptotic properties were determined using the tetrazolium salt assay (MTT), plasmid DNA damage assay and ethidium bromide (EB)/acridine orange methods, respectively, and antitumor activity was determined in the Ehrlich ascites carcinoma (EAC) mouse model. Phytochemical studies indicated a high phenol content of flavonols (45.67 ± 0.24 and 18.01 ± 0.23 mg/mL of myricetin and quercetin, respectively) and flavan-3-ols (114.12 ± 1.84 and 1527.41 ± 16.42 mg/L of epicatechin and epigallocatechin, respectively) in latex. These compounds reduced MCF-7 and EAC cell viability in the MTT assay (IC50 = 169.0 ± 1.8 and 187.0 ± 2.2 μg/mL, respectively). Latex compounds caused significant DNA fragmentation and increased the number of apoptotic cells (negative control (NC), 12%; latex, 41%) as indicated by differential staining in the EB/acridine orange assay. The in vivo latex treatment at 3.12 mg/kg/day reduced the body weight by 7.57 ± 2.04 g and increased median survival time to 17.5 days when compared to the NC group (13.0 days). In addition, the highest latex concentration inhibited tumor growth by 56%. These results agree with ethno-pharmacological reports showing cytotoxicity and antitumor activity of C. celtidifolius latex. The mechanism of antitumor action may be related to direct DNA fragmentation that reduces survival and induces apoptosis.
Elements of the LaTeX system for the development of large publications
DEFF Research Database (Denmark)
Andersen, Esben Sloth
This document presents gives a quick overview over the LATEX system from the viewpoint of the production of books and complex papers. Thereby it provides the starting point for the author's selection of a set of LATEX packages and the development of related commands....
Directory of Open Access Journals (Sweden)
H Nabavizade
2007-07-01
Full Text Available Introduction & Objective: Allergic reactions to natural rubber latex have increased during past 10 years especially among health care workers and patients with high exposure to latex allergens. Allergic reaction to latex is related to many diseases like occupational asthma. This study was performed to determine the prevalence of allergy to natural rubber latex and potential cross reacting food in operation room staff in Shiraz hospitals. Materials & Methods: In this cross-sectional descriptive study five hundred eighty operation room staff of ten private and state hospitals in Shiraz completed latex allergy questionnaire. They were questioned about personal history and previous history of latex sensitivity, symptoms of latex reactivity and about other allergies particularly to foods that may cross react with latex. Informed consent was obtained and skin prick testing was performed with natural rubber latex. Skin prick tests were done with three potentially cross reacting food (banana, Kiwi, and potato. The obtained data were analyzed with SPSS software and Chi-square test. Results: Among the 580 operation room workers 104 (17.9 % of participants were positive to latex skin test. We found a significant association between positive skin test to latex in operation room staff and atopy, urticaria and food allergy. Positive skin test to latex related to positive kiwi skin test (p<0.05. The prevalence did not vary by sex, age, education, surgical and non surgical glove users, history of contact dermatitis or smoking status. Conclusion: Latex allergy has a high prevalence in personnel of operation room. Evaluation of present symptom and prediction of future disease necessitate screening test in individuals at risk.
Sirisomboon, Panmanas; Chowbankrang, Rawiphan; Williams, Phil
2012-05-01
Near-infrared spectroscopy in diffuse reflection mode was used to evaluate the apparent viscosity of Para rubber field latex and concentrated latex over the wavelength range of 1100 to 2500 nm, using partial least square regression (PLSR). The model with ten principal components (PCs) developed using the raw spectra accurately predicted the apparent viscosity with correlation coefficient (r), standard error of prediction (SEP), and bias of 0.974, 8.6 cP, and -0.4 cP, respectively. The ratio of the SEP to the standard deviation (RPD) and the ratio of the SEP to the range (RER) for the prediction were 4.4 and 16.7, respectively. Therefore, the model can be used for measurement of the apparent viscosity of field latex and concentrated latex in quality assurance and process control in the factory.
Glove powder's carrying capacity for latex protein: analysis using the ASTM ELISA test.
Beezhold, D; Horton, K; Hickey, V; Daddona, J; Kostyal, D
2003-01-01
Glove donning powders carry latex proteins and disperse them into the workplace environment. We have used the ASTM D6499 ELISA to quantify the amount of latex antigen bound to and carried by glove powders. We could differentiate between a small amount of protein actually bound to the powders and a larger amount carried by the powder. Enhanced binding of a major allergen, Hev b 5, to the starch powders was demonstrated by Western blot. The D6499 ELISA is able to measure total latex antigen, soluble and powder bound, simultaneously without the need to centrifuge the samples.
International Nuclear Information System (INIS)
Sofian Ibrahim; Mohd Noor Wadi Mat Lazim; Syuhada Ramli; Keong, C.C.; Khairul Hisyam Mohd Yusof; Muhammad Saiful Omar; Najib Mohd Zakey; Hafizuddin Maseri; Noor Hasni Mohd Ali
2015-01-01
The use of radiation do not only produces Radiation Pre vulcanized Natural Rubber Latex (RVNRL) that can be used for the production of nitrosamines free products, moreover, RVNRL also able to exclude type IV allergy that caused by high protein content in the products. Leaching water from production of finger coat from RVNRL and Sulphur Pre vulcanized Natural rubber Latex (SVNRL) has been collected. Extractable protein content from water samples measured according to the test protocol ASTM D5712-2010. Water from leaching process of finger coat made from RVNRL showed a higher protein content than SVNRL. This explains why RVNRL based products contain very low protein content and thus reduce the risk of Type IV allergy. (author)
Latex-mediated synthesis of ZnS nanoparticles: green synthesis approach
Energy Technology Data Exchange (ETDEWEB)
Hudlikar, Manish; Joglekar, Shreeram [University of Pune, Division of Biochemistry, Department of Chemistry (India); Dhaygude, Mayur [National Chemical Laboratory, Polymer Science and Engineering Division (India); Kodam, Kisan, E-mail: kodam@chem.unipune.ac.in [University of Pune, Division of Biochemistry, Department of Chemistry (India)
2012-05-15
A low-cost, green synthesis of ZnS nanoparticles is reported using 0.3 % latex solution prepared from Jatropha curcas L. ZnS nanoparticles were characterized by X-ray diffraction, selected area electron diffraction, transmission electron microscopy, energy dispersive analysis of X-rays, UV-vis optical absorption and photoluminescence techniques. Fourier Transform Infrared Spectroscopy was performed to find the role of cyclic peptides namely curcacycline A (an octapeptide), curcacycline B (a nonapeptide) and curcain (an enzyme) as a possible reducing and stabilizing agents present in the latex of J. curcas L. The average size of ZnS nanoparticles was found to be 10 nm. Latex of J. curcas L. itself acts as a source of sulphide (S{sup -2}) ions that are donated to Zn ions under present experimental conditions. Source of sulphide (S{sup -2}) ions is still unclear, but we speculate that cysteine or thiol residues present in enzyme curcain may be donating these sulphide (S{sup -2}) ions.
Latex-mediated synthesis of ZnS nanoparticles: green synthesis approach
Hudlikar, Manish; Joglekar, Shreeram; Dhaygude, Mayur; Kodam, Kisan
2012-05-01
A low-cost, green synthesis of ZnS nanoparticles is reported using 0.3 % latex solution prepared from Jatropha curcas L. ZnS nanoparticles were characterized by X-ray diffraction, selected area electron diffraction, transmission electron microscopy, energy dispersive analysis of X-rays, UV-vis optical absorption and photoluminescence techniques. Fourier Transform Infrared Spectroscopy was performed to find the role of cyclic peptides namely curcacycline A (an octapeptide), curcacycline B (a nonapeptide) and curcain (an enzyme) as a possible reducing and stabilizing agents present in the latex of J. curcas L. The average size of ZnS nanoparticles was found to be 10 nm. Latex of J. curcas L. itself acts as a source of sulphide (S-2) ions that are donated to Zn ions under present experimental conditions. Source of sulphide (S-2) ions is still unclear, but we speculate that cysteine or thiol residues present in enzyme curcain may be donating these sulphide (S-2) ions.
Latex-mediated synthesis of ZnS nanoparticles: green synthesis approach
International Nuclear Information System (INIS)
Hudlikar, Manish; Joglekar, Shreeram; Dhaygude, Mayur; Kodam, Kisan
2012-01-01
A low-cost, green synthesis of ZnS nanoparticles is reported using 0.3 % latex solution prepared from Jatropha curcas L. ZnS nanoparticles were characterized by X-ray diffraction, selected area electron diffraction, transmission electron microscopy, energy dispersive analysis of X-rays, UV–vis optical absorption and photoluminescence techniques. Fourier Transform Infrared Spectroscopy was performed to find the role of cyclic peptides namely curcacycline A (an octapeptide), curcacycline B (a nonapeptide) and curcain (an enzyme) as a possible reducing and stabilizing agents present in the latex of J. curcas L. The average size of ZnS nanoparticles was found to be 10 nm. Latex of J. curcas L. itself acts as a source of sulphide (S −2 ) ions that are donated to Zn ions under present experimental conditions. Source of sulphide (S −2 ) ions is still unclear, but we speculate that cysteine or thiol residues present in enzyme curcain may be donating these sulphide (S −2 ) ions.
Latex glove sensitivity amongst diagnostic imaging healthcare ...
African Journals Online (AJOL)
kemrilib
Sciences, Faculty of Health Sciences and Technology, University of Nigeria, Enugu Campus, Enugu. State, Nigeria. .... Occupation. No of .... latex protein residue and act as a hapten or .... at Work Act, 1989 and the safety, Health and Welfare at.
Incidence of latex harvesting technologies on agronomic and ...
African Journals Online (AJOL)
Incidence of latex harvesting technologies on agronomic and physiological parameters and profitability of some rapid metabolic class clones of rubber tree ( Hevea brasiliensis ) in southwestern Côte d'Ivoire.
Radiation prevulcanized natural rubber latex: Cytotoxicity and safety evaluation on animal
Energy Technology Data Exchange (ETDEWEB)
Keong, C C; Zin, W M Wan; Ibrahim, P; Ibrahim, S, E-mail: chai@nuclearmalaysia.gov.my [Malaysian Nuclear Agency, Bangi, 43000 Kajang, Selangor (Malaysia)
2010-05-15
Radiation prevulcanized natural rubber latex (RVNRL) was claimed to be more user friendly than natural rubber latex prevulcanized by sulphur curing system. The absence of Type IV allergy inducing chemicals in RVNRL make it a suitable material for manufacturing of many kinds of latex products, especially those come into direct contact with users. This paper reveals and discusses the findings of cytotoxicity test and safety evaluation on animal for RVNRL. The test was done on RVNRL films prepared by coagulant dipping method and RVNRL dipped products produced by latex dipped product manufacturers. Cytotocixity test was carried out on mammalian cell culture American Type Culture Collection CCL 81, Vero. Results indicated that no cytotoxic effect from RVNRL films and products was found on the cell culture. Two animal studies, namely dermal sensitization study and primary skin irritation study, were done on gloves made from RVNRL. Albino white guinea pigs were used as test subjects in dermal sensitization study and results showed no sensitization induced by the application of test material in the guinea pigs. Primary skin irritation study was done on New Zealand white rabbits and results showed that the product tested was not corrosive and was not a primary irritant
Radiation prevulcanized natural rubber latex: Cytotoxicity and safety evaluation on animal
International Nuclear Information System (INIS)
Keong, C C; Zin, W M Wan; Ibrahim, P; Ibrahim, S
2010-01-01
Radiation prevulcanized natural rubber latex (RVNRL) was claimed to be more user friendly than natural rubber latex prevulcanized by sulphur curing system. The absence of Type IV allergy inducing chemicals in RVNRL make it a suitable material for manufacturing of many kinds of latex products, especially those come into direct contact with users. This paper reveals and discusses the findings of cytotoxicity test and safety evaluation on animal for RVNRL. The test was done on RVNRL films prepared by coagulant dipping method and RVNRL dipped products produced by latex dipped product manufacturers. Cytotocixity test was carried out on mammalian cell culture American Type Culture Collection CCL 81, Vero. Results indicated that no cytotoxic effect from RVNRL films and products was found on the cell culture. Two animal studies, namely dermal sensitization study and primary skin irritation study, were done on gloves made from RVNRL. Albino white guinea pigs were used as test subjects in dermal sensitization study and results showed no sensitization induced by the application of test material in the guinea pigs. Primary skin irritation study was done on New Zealand white rabbits and results showed that the product tested was not corrosive and was not a primary irritant
Test trial radiation vulcanization of natural rubber latex in Jakarta Indonesia
International Nuclear Information System (INIS)
Devendra, R.; Kulatunge, S.S.; Chandralal, H.N.K.K.; Kalyani, N.M.V.; Seneviratne, J.; Wellage, S.
1994-01-01
Radiation vulcanization of natural rubber latex (RVNRL) can be used to make large quantities of specially stabilized latex. It is possible to obtain RVNRL films of tensile strength over 25 MPa. The films could be either coagulant dipped or cast. It is very important to determine the correct radiation dose which gives the maximum tensile strength. Cross linking density or prevulcanized relax modulus (PRM) at 100% is a reliable property to control the prevulcanization
Goulas, Vlasios; Manganaris, George A
2012-01-01
Triterpenic acids, such as maslinic acid and oleanolic acid, are commonly found in olive fruits and have been associated with many health benefits. The drying and extraction methods, as well as the solvents used, are critical factors in the determination of their concentration in plant tissues. Thus, there is an emerging need for standardisation of an efficient extraction protocol that determines triterpenic acid content in olive fruits. To evaluate common extraction methods of triterpenic acids from olive fruits and to determine the effect of the drying method on their content in order to propose an optimum protocol for their quantification. The efficacy of different drying and extraction methods was evaluated through the quantification of maslinic acid and oleanolic acid contents using the reversed-phase HPLC technique. Data showed that ultrasonic assisted extraction with ethanol or a mixture of ethanol:methanol (1:1, v/v) resulted in the recovery of significantly higher amounts of triterpenic acids than other methods used. The drying method also affected the estimated triterpenic acid content; frozen or lyophilised olive fruit material gave higher yields of triterpenic acids compared with air-dried material at both 35°C and 105°C. This study provides a rapid and low-cost extraction method, i.e. ultrasonic assisted extraction with an eco-friendly solvent such as ethanol, from frozen or lyophilised olive fruit for the accurate determination of the triterpenic acid content in olive fruit. Copyright © 2011 John Wiley & Sons, Ltd.
International Nuclear Information System (INIS)
Eberbeck, Dietmar; Bergemann, Christian; Hartwig, Stefan; Steinhoff, Uwe; Trahms, Lutz
2005-01-01
The ion exchange mediated binding of magnetic nanoparticles (MNP) to modified latex spheres and yeast cells was quantified using magnetorelaxometry. By fitting subsequently recorded relaxation curves, the kinetics of the binding reactions was extracted. The signal of MNP with weak ion exchanger groups bound to latex and yeast cells scales linearly with the concentration of latex beads or yeast cells whereas that of MNP with strong ion exchanger groups is proportional to the square root of concentration. The binding of the latter leads to a much stronger aggregation of yeast cells than the former MNP
Webler, G. D.; Rodrigues, W. C.; Silva, A. E. S.; Silva, A. O. S.; Fonseca, E. J. S.; Degenhardt, M. F. S.; Oliveira, C. L. P.; Otubo, L.; Barros Filho, D. A.
2018-04-01
Hydroxyapatite is one of the most important biomaterials whose application mainly extends to implants and drug delivery. This work will discuss the changes in the pore size distribution of hydroxyapatite when there are latex beads present during the synthesis. These changes were monitored using different techniques: small angle X-ray scattering, X-ray diffraction, thermal gravimetrical analysis, N2 adsorption, scanning and transmission electron microscopy. Latex beads and hydroxyapatite form a single nanocomposite with well-distinguished inorganic and organic phases. Latex bead removal in the temperature range of 300-600 °C did not modify the original crystalline structure of hydroxyapatite. However, the latex beads favored an increase in the adsorption capacity of mesopores at temperatures higher than their glassy transition (Tg). The main result of this research work consists on the increase of surface area and pore size distribution obtained after the removal of latex beads template. Latex beads have been used in a different approach changing the porosity of hydroxyapatite scaffolds not only introducing new routes for cell integration but also broadening the pore size distribution which can result in a more high efficiency for drug release in living cells.
Padgett, Pamela E; Parry, Sally D; Bytnerowicz, Andrzej; Heath, Robert L
2009-01-01
Nitric acid vapor is produced by the same photochemical processes that produce ozone. In the laboratory, concentrated nitric acid is a strong acid and a powerful oxidant. In the environment, where the concentrations are much lower, it is an innocuous source of plant nitrogen. As an air pollutant, which mode of action does dry deposition of nitric acid follow? We investigated the effects of dry deposition of nitric acid on the foliage of four tree species native to the western United States. A novel controlled environment, fumigation system enabled a four-week exposure at concentrations consistent with ambient diurnal patterns. Scanning electron microscopy and automated image analysis revealed changes in the epicuticular wax layer during fumigation. Exposure to nitric acid resulted in a reproducible suite of damage symptoms that increased with increasing dose. Each tree species tested exhibited a unique set of damage features, including cracks, lesions, and conformation changes to epicuticular crystallite structures. Dry deposition of atmospheric nitric acid caused substantial perturbation to the epicuticular surface of all four tree species investigated, consistent with the chemical oxidation of epicuticular waxes. Automated image analysis eliminated many biases that can trouble microscopy studies. Trade names and commercial enterprises or products are mentioned solely for information. No endorsements by the U.S. Department of Agriculture are implied.
International Nuclear Information System (INIS)
Mohd Noorwadi Mat Lazim; Sofian Ibrahim; Muhammad Saiful Omar
2013-01-01
Hollow toy products are very synonym to the child from the age of months since it able to stimulating each of their sense such as sight, hearing, taste, touch and smell. Most of hollow toy products are made from natural rubber latex by using moulding and casting technique. The moulding and casting technique is a manufacturing process by pored liquid latex into a mould, which contain cavity of the desired shape. The mould made from plaster of Paris able to absorbs water from latex meanwhile the presence of calcium ions from plaster of Paris will tend to diffuse into latex thus promote formation of deposit on surface of cavity mould. To improve the quality and safety of hollow toy product made from latex, Radiation Pre vulcanized Natural Rubber Latex (RVNRL) has been identified to be used because it can fulfill the standard requirement for latex and also due to its special abilities such as lower modulus (soft latex products), nitrosamines free, low in nitrosatables, free from chemical accelerators induced allergies and better biodegradability. This paper identify the problem appears from the process of making hollow toy products from RVNRL by using moulding and casting technique. (author)
Energy Technology Data Exchange (ETDEWEB)
Martins, Carlos Felipe Pinto
2005-07-01
The natural rubber latex (NRL) is industrially crosslinked by the conventional process of vulcanization, which uses sulphur and heat. Otherwise, the network can also be done by the alternative process with ionizing radiation. In this work the crosslinking of NRL was studied by the comparison of the conventional vulcanization system and the ionizing radiation process of {sup 60}C source. The products obtained, the irradiated latex, the irradiated latex with approximately 1% of soy lecithin and the sulphur vulcanized latex were tested by accelerated aging with ultraviolet (UV) and outdoor aging with compostage, tensile strength at break, swelling and gel fraction, fungi micro biota, scanning electron microscopy (SEM), infrared spectroscopy (FTIR) and thermogravimetry and differential scanning calorimetry analysis (TG and DSC). The results showed that the aging with microorganisms have a great influence in the physical properties of the samples. The thermal stability order observed showed that the sulphur vulcanized latex is more resistant, what is probably associated to a network more stable under the aging conditions. On the other hand, the irradiated latex showed intense biodegradation aspects, particularly with the presence of the soy lecithin. (author)
Rubber/clay nanocomposites by combined latex compounding and melt mixing: A masterbatch process
International Nuclear Information System (INIS)
Tan, Jinghua; Wang, Xiaoping; Luo, Yuanfang; Jia, Demin
2012-01-01
Highlights: → Rubber/Ca-montmorillonite nanocomposites were prepared by the masterbatch process. → Latex compounding method is efficient to improve the Ca-montmorillonite dispersion. → Exfoliated structure was obtained in the masterbatch by latex compounding method. → Intercalated and exfoliated structures were achieved in the vulcanizate. → The properties of vulcanizate are improved by the addition of Ca-montmorillonite. -- Abstract: Rubber/Ca-montmorillonite (Ca-MMT) nanocomposites with well exfoliated Ca-MMT layers were prepared by combination of latex compounding and melt mixing. Firstly, a high Ca-MMT content masterbatch was co-coagulated by natural rubber (NR) latex and modified Ca-MMT aqueous suspension through latex compounding. The masterbatch was added in the system of styrene butadiene rubber (SBR) and epoxidized natural rubber (ENR) by melt mixing subsequently. The X-ray diffraction (XRD) and transmission electronic microscopy (TEM) results showed that intercalated and exfoliated nanocomposites were obtained by the masterbatch technique. The effects of modified Ca-MMT introduction into the rubber matrix, via the masterbatch technique, on the properties of the resulting composites were studied. It was found that the vulcanization was hindered by the incorporation of modified Ca-MMT, while mechanical performances, thermal stability and aging resistance were improved. The increasingly glass transition temperature and the storage modulus with the loading of modified Ca-MMT were measured by dynamic mechanical analysis (DMA).
Peretti, Leandro E; Gonzalez, Verónica D G; Marcipar, Iván S; Gugliotta, Luis M
2017-07-01
The aim of this work was to obtain a reagent based on latex particles for ruling out acute toxoplasmosis in pregnant women by immunoagglutination (IA). Latex-protein complexes (LPC) were previously synthesized coupling the recombinant protein of Toxoplasma gondii P22Ag and the homogenate of the parasite to latex particles with different size, chemical functionality and charge density. LPC were tested in IA assays against a panel of 72 pregnant women serum samples. Results were analysed through receiver operating characteristic curves, determining area under the curve (AUC), sensitivity, specificity positive and negative predictive values (PPV and NPV, respectively). It was observed that the antigenicity of proteins was not affected during sensitization by either physical adsorption or covalent coupling. The best results in the sense of maximizing discrimination of low avidity sera from chronic ones were observed for the IA test based on latex particles with carboxyl functionality and the recombinant P22Ag, obtaining an AUC of 0·94, a sensitivity of 100% and a NPV of 100%. In this way, the proposed test could be useful for the toxoplasmosis diagnosis in pregnant women, with the advantages of being cheap, rapid and easy to be implemented.
Soer, W.J.; Ming, W.; Koning, C.E.; Benthem, van R.A.T.M.
2008-01-01
We report on the film formation of surfactant-free, artificial latexes based on copolymers containing maleic anhydride. Different metallic substrates, such as aluminum, steel and magnesium alloys, were coated with three different latexes. A commercial polyester based coating was used as a
Latex allergy and occupational asthma in health care workers: adverse outcomes.
Amr, Sania; Bollinger, Mary E.
2004-01-01
The prevalence of natural rubber latex (NRL) allergy has been estimated to be 5-18% in health care workers, and latex exposure has been one of the leading causes of occupational asthma in the last several years. We present the cases of two nurses who developed sensitivity to NRL, both with dermatologic symptoms and respiratory symptoms that included asthma. They were referred to the University of Maryland for evaluation of their allergies, then for occupational and environmental consults. The...
Radiation graft copolymerization of n-butyl acrylate on natural rubber latex
International Nuclear Information System (INIS)
Sundardi, F.; Kadariah, S.
1986-01-01
A method of radiation graft copolymerization of n-butyl acrylate (NBA) on natural rubber (NR) latex has been studied. The rate of conversion increases with the increase of NBA in latex. An irradiation dose of about 12 kGy is needed to obtain 90% conversion with 40 phr of NBA in latex. Tensile strength, tear strength, and elongation at break of grafted NR are found to decrease with increasing degree of grafting. The physical strength of a vulcanizate prepared from a mixture of NR and ply-NBA was found to be better than that of NBA-NR graft copolymer vulcanizate. The graft copolymerization reaction takes place in the outer layer of NR particles, and because the secondary bonds between poly-NBA molecules may be weaker than those between NR molecules, the existence of a poly-NBA layer in NR particles will decrease its physical strength
Directory of Open Access Journals (Sweden)
S. Montha
2016-01-01
Full Text Available Maillard reaction in Natural Rubber (NR latex was investigated by treating fresh NR latex with glutaraldehyde (C5H8O2 in amounts of 0, 50, 100, and 200 mmol/kg of latex. Protein cross-linking in fresh NR latex and solid NR was confirmed by using sodium dodecylsulfate polyacrylamide gel electrophoresis (SDS-PAGE and attenuated total reflection infrared (ATR-IR spectroscopy, respectively. It was found that degree of protein cross-linking in NR increased with increasing C5H8O2 concentration. Physical properties of untreated and treated NR substances in terms of gel content, initial Wallace plasticity (P0, plasticity retention index (PRI, Mooney viscosity, and tensile strength were carefully explored. Results clearly showed that the Maillard cross-linking of proteins had remarkable effect on bulk NR properties, that is, solvent resistance, hardness, resistance to oxidation, rheological behavior, and resistance to stretching out.
Oral omega-3 fatty acids treatment in computer vision syndrome related dry eye.
Bhargava, Rahul; Kumar, Prachi; Phogat, Hemant; Kaur, Avinash; Kumar, Manjushri
2015-06-01
To assess the efficacy of dietary consumption of omega-3 fatty acids (O3FAs) on dry eye symptoms, Schirmer test, tear film break up time (TBUT) and conjunctival impression cytology (CIC) in patients with computer vision syndrome. Interventional, randomized, double blind, multi-centric study. Four hundred and seventy eight symptomatic patients using computers for more than 3h per day for minimum 1 year were randomized into two groups: 220 patients received two capsules of omega-3 fatty acids each containing 180mg eicosapentaenoic acid (EPA) and 120mg docosahexaenoic acid (DHA) daily (O3FA group) and 236 patients received two capsules of a placebo containing olive oil daily for 3 months (placebo group). The primary outcome measure was improvement in dry eye symptoms and secondary outcome measures were improvement in Nelson grade and an increase in Schirmer and TBUT scores at 3 months. In the placebo group, before dietary intervention, the mean symptom score, Schirmer, TBUT and CIC scores were 7.5±2, 19.9±4.7mm, 11.5±2s and 1±0.9 respectively, and 3 months later were 6.8±2.2, 20.5±4.7mm, 12±2.2s and 0.9±0.9 respectively. In the O3FA group, these values were 8.0±2.6, 20.1±4.2mm, 11.7±1.6s and 1.2±0.8 before dietary intervention and 3.9±2.2, 21.4±4mm, 15±1.7s, 0.5±0.6 after 3 months of intervention, respectively. This study demonstrates the beneficial effect of orally administered O3FAs in alleviating dry eye symptoms, decreasing tear evaporation rate and improving Nelson grade in patients suffering from computer vision syndrome related dry eye. Copyright © 2015 British Contact Lens Association. Published by Elsevier Ltd. All rights reserved.
Evaluation of peptides release using a natural rubber latex biomembrane as a carrier.
Miranda, M C R; Borges, F A; Barros, N R; Santos Filho, N A; Mendonça, R J; Herculano, R D; Cilli, E M
2018-05-01
The biomembrane natural (NRL-Natural Rubber Latex), manipulated from the latex obtained from the rubber tree Hevea brasiliensis, has shown great potential for application in biomedicine and biomaterials. Reflecting the biocompatibility and low bounce rate of this material, NRL has been used as a physical barrier to infectious agents and for the controlled release of drugs and extracts. The aim of the present study was to evaluate the incorporation and release of peptides using a latex biomembrane carrier. After incorporation, the release of material from the membrane was observed using spectrophotometry. Analyses using HPLC and mass spectroscopy did not confirm the release of the antimicrobial peptide [W 6 ]Hylin a1 after 24 h. In addition, analysis of the release solution showed new compounds, indicating the degradation of the peptide by enzymes contained in the latex. Additionally, the release of a peptide with a shorter sequence (Ac-WAAAA) was evaluated, and degradation was not observed. These results showed that the use of NRL as solid matrices as delivery systems of peptide are sequence dependent and could to be evaluated for each sequence.
Nugraha, Tutun; Susilowati, Agustine; Aspiyanto, Lotulung, Puspa Dewi; Maryati, Yati
2017-11-01
Fermentation of spinach (Amaranthus sp) and Broccoli (Brassica oleracea) using Kombucha Culture has been shown to produce biomass that has the potential to become natural sources of folic acid. To produce the materials, following the fermentation, the biomass was filtered using membrane microfiltration (0.15 µm) at a pressure of 40 psia, at room temperature, yielding the concentrate and the permeate fractions. Following this step, freeze drying process was done on the biomass feeds, as well as on the concentrate and permeate fractions. For the freeze drying stage, the samples were frozen, and the condenser was kept at -50°C for 40 hours, while the pressure in the chamber was set at 200 Pa. Freeze drying results showed that the final products, have differences in compositions, as well as differences in the dominat monomers of folates. After water content was driven out, freeze drying increased the concentrations of folic acid in the dried products, and was found to be the highest in the concentrate fractions. Freeze drying has been shown to be capable of protecting the folates from heat and oxidative damages that typicaly occur with other types of drying. The final freeze dried concentrates of fermentation of spinach and broccoli were found to contain folic acid at 2531.88 µg/mL and 1626.94 µg/mL, total solids at 87.23% and 88.65 %, total sugar at 22.66 µg/mL and 25.13 µg/mL, total reducing sugar at 34.46 mg/mL and 15.22 mg/mL, as well as disolved protein concentrations at 0.93 mg/mL and 1.45 mg/mL. Liquid Chromatography Mass Spectometry (LC-MS) identification of the folates in the freeze dried concentrates of fermented spinach and broccoli was done using folic acid and glutamic acid standard solutions as the reference materials. The results showed the presence of folic acid and showed that the dominant monomers of molecules of folates with molecular weights of 441.44 Da. and 441.54 Da. for spinach and broccoli respectively. Moreover, the monomers of glutamic
Effect of micro-encapsulated n-3 fatty acids on quality properties of two types of dry sausages
Directory of Open Access Journals (Sweden)
Zdeněk Pavlík
2014-01-01
Full Text Available Dry sausages are popular traditional meat products. As these products are a rich source of animal fat, there is an effort to improve their fatty acid ratio. The aim of this work was to study the effect of micro-encapsulated n-3 fatty acids added into dry sausages. Samples of dry sausages (Poličan and Vysočina enriched with unsaturated fatty acids (36 g for 6 kg of mixture and rosemary extract (0.3 g·kg-1 were made along with control samples. Physicochemical, instrumental analyses were performed, fatty acid profile was measured by gas chromatography, and oxidation processes were monitored by determination of thiobarbituric acid reactive substances. No significant differences (P ≥ 0.05 in quality indicators were found between samples, however, there were differences in oxidation processes. Sausages enriched with unsaturated fatty acids showed an increase in thiobarbituric acid reactive substances (> 2 mg·kg-1 and > 3 mg·kg-1 in Poličan and Vysočina, respectively, compared to control. Sausages enriched with unsaturated fatty acids and also with rosemary extract have the similar concentration of thiobarbituric acid reactive substances as the control. An increase in the proportion of monounsaturated fatty acids and polyunsaturated fatty acids was seen in samples of Poličan supplemented with unsaturated fatty acids in combination with rosemary extract. The addition of rosemary extract had also a significant effect in increasing the proportion of unsaturated fatty acids in samples of Vysočina. From the viewpoint of quality indicators, changes in the properties of the product were not seen in any samples.
Pu, Yunfeng; Ding, Tian; Wang, Wenjun; Xiang, Yanju; Ye, Xingqian; Li, Mei; Liu, Donghong
2018-01-01
The taste of dried jujube fruit when compared with fresh ones is less palatable, as it develops bitterness during drying and storage. Therefore, identifying the methods by which bitterness occurs is essential for developing strategies for processing and storage. Bitterness in fresh jujube fruit was negligible; however, it increased by 0.9-, 1.5- and 1.8-fold during drying and storage over 6 and 12 months. The moisture significantly decreased during harvesting and drying. Free amino acids, except proline and tyrosine, significantly decreased during drying and storage. Fructose, glucose and sucrose hardly changed during harvest, drying and storage. Titratable acidity, total phenolic and total flavonoids contents were stable during harvest and drying, but increased upon storage. Additionally, protocatechuic and ellagic acids were not detected in fresh jujube fruit, however, were found to increase during drying and storage. Bitterness in fresh jujube fruit tasted negligible because of meagre amount of phytochemicals, while the condensation effect of moisture reduction, the loss of free amino acids, and the formation of protocatechuic and ellagic acids could aggravate the bitterness of jujube fruit during drying and storage. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Hussain, Javid; Liu, Yan; Lopes, Wilson A; Druzian, Janice I; Souza, Carolina O; Carvalho, Gilson C; Nascimento, Iracema A; Liao, Wei
2015-03-01
Three lipid extraction methods of hexane Soxhlet (Sox-Hex), Halim (HIP), and Bligh and Dyer (BD) were applied on freeze-dried (FD) and oven-dried (OD) Chlorella vulgaris biomass to evaluate their effects on lipid yield, fatty acid profile, and algal biodiesel quality. Among these three methods, HIP was the preferred one for C. vulgaris lipid recovery considering both extraction efficiency and solvent toxicity. It had the highest lipid yields of 20.0 and 22.0% on FD and OD biomass, respectively, with corresponding neutral lipid yields of 14.8 and 12.7%. The lipid profiling analysis showed that palmitic, oleic, linoleic, and α-linolenic acids were the major fatty acids in the algal lipids, and there were no significant differences on the amount of these acids between different drying and extraction methods. Correlative models applied to the fatty acid profiles concluded that high contents of palmitic and oleic acids in algal lipids contributed to balancing the ratio of saturated and unsaturated fatty acids and led to a high-quality algal biodiesel.
Frequent IgE sensitization to latex, cow's milk, and egg in children with short bowel syndrome.
Mazon, Angel; Solera, Eva; Alentado, Noemi; Oliver, Fernando; Pamies, Rafael; Caballero, Luis; Nieto, Antonio; Dalmau, Jaime
2008-03-01
Children with short bowel syndrome (SBS) undergo frequent operations, so they are at risk for sensitizing to latex. There have been isolated reports of sensitization to food in these children. In a cross-sectional study, we assessed sensitization to latex, cow's milk, and egg with skin prick tests (SPT) and serum-specific immunoglobulin E (IgE) in 14 children with SBS. Data were collected about the number of operations with latex devices, serum total IgE, and history of feeding with milk formula. Ten children were sensitized to latex (specific IgE median: 6.7 kU/l, range: 0.5-33). Compared with those non-sensitized, sensitized children had significantly (p range: 0.5-21.1 kU/l), and five to egg (specific IgE median: 0.68, range: 0.58-2.17 kU/l). Except for some isolated days with cow's milk formula, the children had been initially fed with a diet without intact cow's milk proteins. Sensitization to latex, cow's milk, and egg is very frequent in children with SBS. They should be treated in a latex-free environment since the very early stages of the disease, and should be routinely studied regarding food sensitization, as this might contribute as an added factor in the chronic diarrhea of these patients.
The evolution and use of a personal LaTeX metapackage
DEFF Research Database (Denmark)
Andersen, Esben Sloth
This document defines and describes esameta.sty and its variant esametaps.sty. They are personal LATEX packages that largely consist of calls of other packages. These 'metapackages' are selected to help the development of the author's complex book and paper projects-but some of his decisions migh...... be of more general relevance. The use of the LATEX system of 'literate programming' and the testing the compatibility of new commands and packages with the previously included parts of the metapackage should also be noticed....
The role of systemic and topical fatty acids for dry eye treatment.
Barabino, Stefano; Horwath-Winter, Jutta; Messmer, Elisabeth M; Rolando, Maurizio; Aragona, Pasquale; Kinoshita, Shigeru
2017-11-01
Dry eye is a prevalent condition and one of the main reasons for patients to seek ophthalmic medical care. A low systemic level of omega fatty acids is a risk factor for dry eye disease (DED). There are two groups of essential fatty acids (EFAs): the omega-6 (n-6) family and the omega-3 (n-3) family. Humans evolved on a diet in which the n-6:n-3 ratio was approximately 1:1, however the current Western diet tends to be deficient in n-3 EFAs and this ratio is typically much higher (approaching 17:1). The metabolism of EFAs generates four new families of local acting mediators: lipoxins, resolvins, protectins, and maresins. These molecules have anti-inflammatory and pro-resolution properties. We present a critical overview of animal model studies and human clinical trials that have shown that dietary modification and oral supplementation could be complementary therapeutic strategies for the treatment of dry eye. Furthermore, we discuss preliminary results of the topical application of n-3 and n-6 EFAs because these molecules may act as natural anti-inflammatory agents with positive changes of the entire ocular surface system. Copyright © 2017 Elsevier Ltd. All rights reserved.
Residual monomer reduction in polymer latex products by extraction with supercritical carbon dioxide
Aerts, M.; Meuldijk, J.; Kemmere, M.F.; Keurentjes, J.T.F.
2011-01-01
Extraction of residual monomer from a latex product with supercritical carbon dioxide ((sc)CO2) in a column was studied. Operating conditions were chosen at 35¿°C and 100 bar. For reducing the residual styrene level in a polystyrene latex from 104 ppm to 100¿ppm and from 104 ppm to 10¿ppm, a
Incidence of latex harvesting technologies on agronomic and ...
African Journals Online (AJOL)
parameters and profitability of some rapid metabolic class clones of rubber ... of hormonal stimulation had no negative influence on the vegetative growth ..... yield (2597) was obtained with the control ..... metabolic energy of latex vessels as.
Quevedo, Ivan R; Olsson, Adam L J; Tufenkji, Nathalie
2013-03-05
A clear understanding of the factors controlling the deposition behavior of engineered nanoparticles (ENPs), such as quantum dots (QDs), is necessary for predicting their transport and fate in natural subsurface environments and in water filtration processes. A quartz crystal microbalance with dissipation monitoring (QCM-D) was used to study the effect of particle surface coatings and water chemistry on the deposition of commercial QDs onto Al2O3. Two carboxylated QDs (CdSe and CdTe) with different surface coatings were compared with two model nanoparticles: sulfate-functionalized (sPL) and carboxyl-modified (cPL) polystyrene latex. Deposition rates were assessed over a range of ionic strengths (IS) in simple electrolyte (KCl) and in electrolyte supplemented with two organic molecules found in natural waters; namely, humic acid and rhamnolipid. The Al2O3 collector used here is selected to be representative of oxide patches found on the surface of aquifer or filter grains. Deposition studies showed that ENP deposition rates on bare Al2O3 generally decreased with increasing salt concentration, with the exception of the polyacrylic-acid (PAA) coated CdTe QD which exhibited unique deposition behavior due to changes in the conformation of the PAA coating. QD deposition rates on bare Al2O3 were approximately 1 order of magnitude lower than those of the polystyrene latex nanoparticles, likely as a result of steric stabilization imparted by the QD surface coatings. Adsorption of humic acid or rhamnolipid on the Al2O3 surface resulted in charge reversal of the collector and subsequent reduction in the deposition rates of all ENPs. Moreover, the ratio of the two QCM-D output parameters, frequency and dissipation, revealed key structural information of the ENP-collector interface; namely, on bare Al2O3, the latex particles were rigidly attached as compared to the more loosely attached QDs. This study emphasizes the importance of considering the nature of ENP coatings as well
Latex allergy: new insights to explain different sensitization profiles in different risk groups.
Peixinho, C; Tavares-Ratado, P; Tomás, M R; Taborda-Barata, L; Tomaz, C T
2008-07-01
Differences in latex allergen sensitization profiles have been described between children subjected to repetitive surgical interventions and health care workers (HCW). 'Major' allergens for patients with spina bifida are Hev b 1, 3 and 7, while for HCW, 'major' allergens are Hev b 2, 5, 6.01 and 13. The reason for these differential sensitization profiles is currently unknown. To investigate latex allergen profiles on internal and external surfaces of natural rubber latex gloves. Eighty-two samples of commonly used surgical gloves (41 glove brands) were used for analysis. Specific allergen levels of Hev b 1, 3, 5 and 6.02 on both surfaces of the gloves were quantified using an enzyme immunometric assay, a FITkit (FIT Biotech, Tampere, Finland). Differences in allergen levels were observed between internal and external surfaces of all glove types. Concentrations of Hev b 1 and Hev b 3 were significantly higher on external surfaces, while internal surfaces had higher allergen levels of Hev b 5 and Hev b 6.02. Analysis of surgical and examination gloves, powdered and nonpowdered gloves also showed that the content of Hev b 5 and Hev b 6.02 was significantly higher on internal surfaces while that of Hev b 1 and Hev b 3 was higher on external surfaces. Our study showed different allergen profiles on internal and external surfaces of natural rubber latex gloves. These results may suggest a relationship between latex allergen localization and sensitization routes in different risk groups.
Phalen, Robert N; Le, Thi; Wong, Weng Kee
2014-01-01
Glove movement can affect chemical permeation of organic compounds through polymer glove products. However, conflicting reports make it difficult to compare the effects of movement on chemical permeation through commonly available glove types. The aim of this study was to evaluate the effect of movement on chemical permeation of an organic solvent through disposable latex, nitrile, and vinyl gloves. Simulated whole-glove permeation testing was conducted using ethyl alcohol and a previously designed permeation test system. With exposure to movement, a significant decrease (p ≤ 0.001) in breakthrough time (BT) was observed for the latex (-23%) and nitrile gloves (-31%). With exposure to movement, only the nitrile glove exhibited a significant increase (p ≤ 0.001) in steady-state permeation rate (+47%) and cumulative permeation at 30 min (+111%). Even though the nitrile glove provided optimum chemical resistance against ethyl alcohol, it was most affected by movement. With exposure to movement, the latex glove was an equivalent option for overall worker protection, because it was less affected by movement and the permeation rate was lower than that of the nitrile glove. In contrast, the vinyl glove was the least affected by movement, but did not provide adequate chemical resistance to ethyl alcohol in comparison with the nitrile and latex gloves. Glove selection should take movement and polymer type into account. Some glove polymer types are less affected by movement, most notably the latex glove in this test. With nitrile gloves, at least a factor of three should be used when attempting to assign a protection factor when repetitive hand motions are anticipated. Ultimately, the latex gloves outperformed nitrile and vinyl in these tests, which evaluated the effect of movement on chemical permeation. Future research should aim to resolve some of the observed discrepancies in test results with latex and vinyl gloves.
Restoration of Tear Secretion in a Murine Dry Eye Model by Oral Administration of Palmitoleic Acid.
Kimura, Yuki; Mori, Daisuke; Imada, Toshihiro; Izuta, Yusuke; Shibuya, Michiko; Sakaguchi, Hisayo; Oonishi, Erina; Okada, Naoko; Matsumoto, Kenji; Tsubota, Kazuo
2017-04-05
Sea buckthorn ( Hippophae rhamnoides ) -derived products have traditionally been used as food and medicinal ingredients in Eastern countries. The purpose of this study was to investigate the effect of oral intake of sea buckthorn oil products on tear secretion using a murine dry eye model. Orally administered sea buckthorn pulp oil (not seed oil) restored aqueous tear secretion to its normal value under a dry eye condition. Palmitoleate (C16:1), a fatty acid present in sea buckthorn pulp oil, preserved tear secretion and suppressed inflammatory cytokines in the lacrimal gland to the same extent as that by pulp oil. These results suggest that an oral intake of sea buckthorn pulp oil has a potency to preserve tear secretion capacity in the dry eye state and palmitoleate, its main constituent fatty acid, is an active component of the oil. This effect may enable a potent diet-based treatment for the prevention of dry eye.
Restoration of Tear Secretion in a Murine Dry Eye Model by Oral Administration of Palmitoleic Acid
Directory of Open Access Journals (Sweden)
Shigeru Nakamura
2017-04-01
Full Text Available Sea buckthorn (Hippophae rhamnoides–derived products have traditionally been used as food and medicinal ingredients in Eastern countries. The purpose of this study was to investigate the effect of oral intake of sea buckthorn oil products on tear secretion using a murine dry eye model. Orally administered sea buckthorn pulp oil (not seed oil restored aqueous tear secretion to its normal value under a dry eye condition. Palmitoleate (C16:1, a fatty acid present in sea buckthorn pulp oil, preserved tear secretion and suppressed inflammatory cytokines in the lacrimal gland to the same extent as that by pulp oil. These results suggest that an oral intake of sea buckthorn pulp oil has a potency to preserve tear secretion capacity in the dry eye state and palmitoleate, its main constituent fatty acid, is an active component of the oil. This effect may enable a potent diet-based treatment for the prevention of dry eye.
Al-Swuailem, Abdullah S
2014-07-01
To assess the defect rates in latex examination gloves used in selected dental practices in Riyadh, Saudi Arabia. In this cross-sectional study, a total of 796 latex examination gloves were collected from 5 governmental hospitals and 5 private dental practices between April 2012 and May 2012. The gloves were assessed for presence of defects visually (VT) and using water inflation test (WIT). One and 2 sample t-tests were used to assess significant differences in defect rates among each latex brand, and between governmental hospitals and private dental practices. Defects in latex gloves were more likely to be identified using WIT compared with VT (20.2% versus 4.3%, p=0.000). Using WIT, examined latex gloves had a defect rate approximately 8 times the acceptable quality level of 2.5% (20.2%, p=0.000). Using WIT, gloves used in private dental practices had significantly higher defect rates compared with governmental dental clinics (25.6% versus 14.6%, p=0.006). Most latex examination gloves used in the sampled governmental dental clinics and private dental practices in Riyadh had significantly higher preexisting defect rates than acceptable standard levels.
Al Juhaimi, Fahad; Özcan, Mehmet Musa; Uslu, Nurhan; Ghafoor, Kashif
2018-01-01
In this study, the effect of drying temperature on antioxidant activity, phenolic compounds, fatty acid composition and tocopherol content of citrus seeds and oils were studied. Kinnow mandarin seed, dried at 60 °C, exhibited the highest antioxidant activity. Orlendo orange seed had the maximum total phenolic content and α-tocopherol content, with a value of 63.349 mg/100 g and 28.085 mg/g (control samples), respectively. The antioxidant activity of Orlendo orange seed (63.349%) was higher than seeds of Eureka lemon (55.819%) and Kinnow mandarin (28.015%), while the highest total phenolic content was found in seeds of Kinnow mandarin, followed by Orlendo orange and Eureka lemon (113.132). 1.2-Dihydroxybenzene (13.171), kaempferol (10.780), (+)-catechin (9.341) and isorhamnetin (7.592) in mg/100 g were the major phenolic compounds found in Kinnow mandarin. Among the unsaturated fatty acids, linoleic acid was the most abundant acid in all oils, which varied from 44.4% (dried at 80 °C) to 46.1% (dried at 70 °C), from 39.0% (dried at 60 °C) to 40.0% (dried at 70 °C). The total phenolic content, antioxidant activity and phenolic compounds of citrus seeds and tocopherol content of seed oils were significantly affected by drying process and varied depending on the drying temperature.
Piskin, Gamze; Akyol, Aynur; Uzar, Hatice; Tulek, Necla; Boyvat, Ayse; Gurgey, Erbak
2003-01-01
Latex hypersensitivity manifests itself most commonly with contact urticaria. In this study, we investigated the frequency of latex hypersensitivity as a possible aetiological factor in patients with chronic urticaria (CU) and compared latex hypersensitivity of CU patients (n = 50) with that of
International Nuclear Information System (INIS)
Vinh, P.Q.; Rao, V.S.; Adhikar, H.R.; Nair, P.M.
1994-01-01
Effect of gamma irradiation on the lipid and fatty acid composition of semi-dried Bombay duck (Harpodon nehcreus) and Vietnamese scad (Alepes mate) was studied. In both these dried fishes, c16:0 aand c18:1 were the predominant fatty acids and the fishes contained ignificant quantities of the n-3 polyunsaturated fatty acids (PUFAs), C20:5 and C22:6. Irradiation at a dose of 3 kGy, did not cause any alterations in the total lipid content and he overall lipid class profile in these fishes. However, in the Vietnamese scad, C18:3, C20:4 and C22:6 were significantly decreased in the irradiated samples. In spite of this decrease the irradiated semi-dried scad retained 82% of the initial amount of n-3 PUFAs
Radiation-initiated emulsion copolymerization of styrene and carboxylic acid monomers
International Nuclear Information System (INIS)
Egusa, S.; Makuuchi, K.
1982-01-01
The emulsion copolymerization of styrene and carboxylic acid monomers such as acrylic, methacrylic, and itaconic acids (AAc, MAAc, IAc) was studied by using 60 Co γ-rays as initiator and sodium dodecylsulfate as emulsifier. The polymerization behavior of these acid monomers was followed by simultaneous conductometric and potentiometric titrations for a latex sample taken in polymerization. The polymerization rate of these acid monomers increases in the following order of hydrophobicity: IAc < AAc < MAAc; this suggests that their polymerization sites are mainly the surface and/or subsurface regions of latex particles. The copolymerization rate of styrene and acid monomer increases with an increase in the acid monomer content for AAc and MAAc, whereas for IAc the rate decreases. The particle sizes determined by the stopped-flow method reveal that this variation of copolymerization rate cannot be explained by the number of growing particles and should be attributed to another factor; for instance, the transfer rate of styrene molecules from oil droplets to growing particles
Ethylene limits abscisic acid- or soil drying-induced stomatal closure in aged wheat leaves.
Chen, Lin; Dodd, Ian C; Davies, William J; Wilkinson, Sally
2013-10-01
The mechanism of age-induced decreased stomatal sensitivity to abscisic acid (ABA) and soil drying has been explored here. Older, fully expanded leaves partly lost their ability to close stomata in response to foliar ABA sprays, and soil drying which stimulated endogenous ABA production, while young fully expanded leaves closed their stomata more fully. However, ABA- or soil drying-induced stomatal closure of older leaves was partly restored by pretreating plants with 1-methylcyclopropene (1-MCP), which can antagonize ethylene receptors, or by inoculating soil around the roots with the rhizobacterium Variovorax paradoxus 5C-2, which contains 1-aminocyclopropane-1-carboxylic acid (ACC)-deaminase. ACC (the immediate biosynthetic precursor of ethylene) sprays revealed higher sensitivity of stomata to ethylene in older leaves than younger leaves, despite no differences in endogenous ACC concentrations or ethylene emission. Taken together, these results indicate that the relative insensitivity of stomatal closure to ABA and soil drying in older leaves is likely due to altered stomatal sensitivity to ethylene, rather than ethylene production. To our knowledge, this is the first study to mechanistically explain diminished stomatal responses to soil moisture deficit in older leaves, and the associated reduction in leaf water-use efficiency. © 2013 John Wiley & Sons Ltd.
Extractable protein of radiation vulcanized natural rubber latex
International Nuclear Information System (INIS)
Soebianto, Y.S.; Upul, R.M.; Makuuchi, K.; Yoshii, F.; Kume, T.
2000-01-01
A new method to reduce the protein level in the latex products by irradiation is reported. Water soluble protein (WSP) solution (10%) was added into radiation vulcanized NR latex (RVNRL) as much as 3 phr in three different processes: added to RVNRL, added to re-centrifuged RVNRL, and added to RVNRL followed by centrifugation. The protein content was determined by enhanced BCA method, and identified by SDS-PAGE analysis. Addition of WSP followed by centrifugation reduces EP up to the minimum protein detection, and shortens the leaching time to 20-30 min. SDS-PAGE analysis confirms the reduction of soluble protein in the serum phase, and disappearance of protein bands in the rubber extract. Protein-WSP interaction produces water soluble complex, and removed by centrifugation. The molecular weight of WSP dictates the efficiency of protein removal. (author)
Extractable protein of radiation vulcanized natural rubber latex
Energy Technology Data Exchange (ETDEWEB)
Soebianto, Y.S. [Center for Research and Development of Isotopes and Radiation Technology, BATAN, Jakarta (Indonesia); Upul, R.M. [Rubber Research Institute of Sri Lanka, Ratmalana (Sri Lanka); Makuuchi, K.; Yoshii, F.; Kume, T. [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment
2000-03-01
A new method to reduce the protein level in the latex products by irradiation is reported. Water soluble protein (WSP) solution (10%) was added into radiation vulcanized NR latex (RVNRL) as much as 3 phr in three different processes: added to RVNRL, added to re-centrifuged RVNRL, and added to RVNRL followed by centrifugation. The protein content was determined by enhanced BCA method, and identified by SDS-PAGE analysis. Addition of WSP followed by centrifugation reduces EP up to the minimum protein detection, and shortens the leaching time to 20-30 min. SDS-PAGE analysis confirms the reduction of soluble protein in the serum phase, and disappearance of protein bands in the rubber extract. Protein-WSP interaction produces water soluble complex, and removed by centrifugation. The molecular weight of WSP dictates the efficiency of protein removal. (author)
Rajan, V.V.; Dierkes, Wilma K.; Joseph, R.; Noordermeer, Jacobus W.M.
2006-01-01
It is observed that reclamation of natural rubber latex based rubber using 2,2'-dibenzamidodiphenyldisulphide as reclaiming agent is an optional methodology for recycling of waste latex rubber (WLR). For progressive replacement of virgin natural rubber by the reclaim, two alternatives curing system
Latex agglutination test (LAT) for the diagnosis of typhoid fever.
Sahni, Gopal Shankar
2013-06-01
The efficacy of latex agglutination test in the rapid diagnosis of typhoid fever was studied and the result compared with that of blood culture. This study included 80 children suffering from typhoid fever, among which 40 were confirmed by blood culture isolation and 40 had possible typhoid fever based on high Widal's titre (a four-fold rise in the titre of antibody to typhi "O" and "H" antigen was considered as a positive Widal's test result). Eighty children, 40 with febrile illness confirmed to be other than typhoid and 40 normal healthy children were used as negative controls. The various groups were: (i) Study group ie, group I had 40 children confirmed by culture isolation of Salmonella typhi(confirmed typhoid cases). (ii) Control groups ie, (a) group II with 40 febrile controls selected from paediatrics ward where cause other than S typhi has been established, (b) group III with 40 afebrile healthy controls that were siblings of the children admitted in paediatric ward for any reason with no history of fever and TAB vaccination in the last one year, and (c) group IV with 40 children with high Widal's titre in paired sera sample. Widal's test with paired sera with a one week interval between collections were done in all 40 patients. Latex aggtutination test which could detect 900 ng/ml of antigen as observed in checker board titration, was positive in all 40 children from group I who had positive blood culture and in 30 children from group IV who had culture negative and had high Widal's titre positive. Latex agglutination test was positive in 4 children in group II and none in group III. Using blood culture positive cases as true positive and children in groups II and III as true negative, the test had a sensitivity of 100% and specificity of 96%. Latex agglutination test was found to be significantly sensitive (100%) and specific (96%) and could detect 75% more cases in group IV (possible typhoid cases). Thus latex agglutination test can be used for rapid
Batteries - dry cell ... Acidic dry cell batteries contain: Manganese dioxide Ammonium chloride Alkaline dry cell batteries contain: Sodium hydroxide Potassium hydroxide Lithium dioxide dry cell batteries ...
Minimizing surgical skin incision scars with a latex surgical glove.
Han, So-Eun; Ryoo, Suk-Tae; Lim, So Young; Pyon, Jai-Kyung; Bang, Sa-Ik; Oh, Kap-Sung; Mun, Goo-Hyun
2013-04-01
The current trend in minimally invasive surgery is to make a small surgical incision. However, the excessive tensile stress applied by the retractors to the skin surrounding the incision often results in a long wound healing time and extensive scarring. To minimize these types of wound problems, the authors evaluated a simple and cost-effective method to minimize surgical incision scars based on the use of a latex surgical glove. The tunnel-shaped part of a powder-free latex surgical glove was applied to the incision and the dissection plane. It was fixed to the full layer of the dissection plane with sutures. The glove on the skin surface then was sealed with Ioban (3 M Health Care, St. Paul, MN, USA) to prevent movement. The operation proceeded as usual, with the retractor running through the tunnel of the latex glove. It was possible to complete the operation without any disturbance of the visual field by the surgical glove, and the glove was neither torn nor separated by the retractors. The retractors caused traction and friction during the operation, but the extent of damage to the postoperative skin incision margin was remarkably less than when the operation was performed without a glove. This simple and cost-effective method is based on the use of a latex surgical glove to protect the surgical skin incision site and improve the appearance of the postoperative scar. This journal requires that authors assign a level of evidence to each article. For a full description of these Evidence-Based Medicine ratings, please refer to the Table of Contents or the online Instructions to Authors www.springer.com/00266 .
Gamma irradiator design concepts for radiation vulcanisation of natural rubber latex
International Nuclear Information System (INIS)
Aggarwal, K.S.; Muralidharan, P.; Apte, M.G.; Kalurkar, A.R.; Shah, B.M.
1990-01-01
Radiation vulcanisation of natural rubber latex (NRL) is a new and yet unproven technology and one which involves undefined problems of consumer acceptance and high degree of radiation risk. Therefore, the designer should take care that the initial capital cost of the plant is as low as possible to keep the unit processing cost low during the initial lean period of the product requirement by the market. Three irradiators to process natural rubber latex have been designed as per capacity requirement of the user. Their salient features are described. (author). 2 tabs., 24 figs
International Nuclear Information System (INIS)
Zmuda, J.T.; Smith, P.V.
1991-01-01
Dry sorbent injection (DSI) has been successfully demonstrated on coal fired boiler applications as a means of reducing sulfur dioxide emissions. More recently, the dry sorbent injection process was applied to an existing municipal waste incinerator to provide acid gas emission controls. The results obtained from the successful demonstration of the sorbent injection system on an existing municipal incinerator are presented. Removal efficiencies of compounds such as HCl, SO 2 , SO 3 , mercury, and others by the use of sorbent injection are shown. Effects of the DSI system on downstream equipment, such as electrostatic precipitators, fabric filters, ash handling systems, and waste management is included. The impacts of the DSI system on the furnace is also discussed. In this paper a discussion of dry sorbent injection as a means of reducing acid gas and other emissions from existing municipal waste incinerators which may be affected by the regulations is presented. An application case study will outline typical exhaust conditions, expected pollution reductions, capital and operating costs, and type of available sorbents and their costs
Status RVNRL in German latex industry and its introduction to the European market
International Nuclear Information System (INIS)
Bez, W.
1996-01-01
Reasons to look for an alternative crosslinking system avoiding sulphur curing was the restrictive policy of the German Health Authorities concerning nitrosamines. It was concluded that radiation curing offers further advantages . By avoiding the accelerators, type IV allergy is excluded, cytotoxicity is minimised to a very low level, films have better clarity and when thoroughly leached higher electrical resistance. Treatment of waste give no SO sub 2 emissions by burning, no Zinc in the ashes and possibly better microbial degradation. A development was carried out to irradiate natural latex by electron beam with a Dynamitron equipment. It was found trimethylolpropanetrimethacrylate to be a suitable sensitizer. Because of to high prices this development was interrupted. For future application trials and efforts to introduce RVNRL in the market gamma ray radiated natural latex either from Batan, Indonesia or MINT, Malaysia are used. Mainly dipped goods were produce, but radiated natural latex has shown good results in other processes. During discussions with customers it has proved necessary to establish specifications for RVNRL. A serious problem using natural latex for the production of medical devices is the type I allergy. Attempts are made to dip surgical gloves, leach them thoroughly and control extractable proteins were reduced to the very low level of 6.5 μg/g. Out of 18 patients sensitive to natural latex protein wearing gloves made from RVNRL only six have shown a positive response. That means RVNRL could help to solve the protein allergy problem. Further developments on this line are scheduled
H Nabavizade; R Amin
2007-01-01
Introduction & Objective: Allergic reactions to natural rubber latex have increased during past 10 years especially among health care workers and patients with high exposure to latex allergens. Allergic reaction to latex is related to many diseases like occupational asthma. This study was performed to determine the prevalence of allergy to natural rubber latex and potential cross reacting food in operation room staff in Shiraz hospitals. Materials & Methods: In this cross-sectional descr...
Lee, M R F; Tweed, J K S; Kim, E J; Scollan, N D
2012-12-01
When fractionation of meat lipids is not required, procedures such as saponification can be used to extract total fatty acids, reducing reliance on toxic organic compounds. However, saponification of muscle fatty acids is laborious, and requires extended heating times, and a second methylation step to convert the extracted fatty acids to fatty acid methyl esters prior to gas chromatography. Therefore the development of a more rapid direct methylation procedure would be of merit. The use of freeze-dried material for analysis is common and allows for greater homogenisation of the sample. The present study investigated the potential of using freeze-dried muscle samples and a direct bimethylation to analyse total fatty acids of meat (beef, chicken and lamb) in comparison with a saponification procedure followed by bimethylation. Both methods compared favourably for all major fatty acids measured. There was a minor difference in relation to the C18:1 trans 10 isomer with a greater (Psaponification. However, numerically the difference was small and likely as a result of approaching the limits of isomer identification by single column gas chromatography. Differences (Psaponification to analyse total fatty acids from muscle samples. Copyright © 2012 Elsevier Ltd. All rights reserved.
Reslan, Mouhamad; Demir, Yusuf K; Trout, Bernhardt L; Chan, Hak-Kim; Kayser, Veysel
2017-09-01
Improving the physical stability of spray-dried proteins is essential for enabling pulmonary delivery of biotherapeutics as a noninvasive alternative to injections. Recently, a novel combination of two amino acids - l-arginine (l-Arg) and l-glutamic acid (l-Glu), has been reported to have synergistic protein-stabilizing effects on various protein solutions. Using spray-dried bovine serum albumin (BSA) reconstituted in solution as a model protein, we investigated the synergistic effect of these amino acids on the physical stability of proteins. Five BSA solutions were prepared: (1) BSA with no amino acids (control); (2) with 50 mM l-Arg; (3) with 200 mM l-Arg, (4) with 50 mM l-Glu and (5) with 25:25 mM of Arg:Glu. All solutions were spray-dried and accelerated studies at high temperatures were performed. Following accelerated studies, monomer BSA loss was measured using SE-HPLC. We found that l-Arg significantly improved the physical stability of spray-dried BSA even at low concentrations, however, when combined with l-Glu, was ineffective at reducing monomer BSA loss. Our findings demonstrate the limitations in using Arg-Glu for the stabilization of spray-dried BSA. Furthermore, we found that a low concentration of l-Glu enhanced monomer BSA loss. These findings may have significant implications on the design of future biotherapeutic formulations.
Efficacy of protection by latex gloves during orthodontic therapy.
Doll, G M; Zentner, A; Balan, R; Sergl, H G
2000-01-01
The wearing of gloves during orthodontic or dental treatment is generally indicated for reasons of hygiene and protection against infection. This study was aimed at determining the extent and localization of perforations caused by the various orthodontic treatment techniques and interrupting the infection barrier. The impermeability was tested by means of a water retention test according to European standard EN 455, Part 1, performed on 1600 Centramed (Centramed, Koblenz), Tekmedic and SafeEx non-sterile disposable latex gloves (both by Safe Med, Switzerland) and Safe Gan latex gloves with an additional acrylate coating (also by Safe Med). The perforation rate in unused gloves was between 0.5% and 7.5%, rising on average to 11% with increasing use. 36% of the total number of lesions resulted from handling removable appliances, and 57% from handling fixed appliances, especially when replacing arch wires and elastics. Most lesions were in the thumb, index finger and palm region. Only 18% of the defects were noticed by the dentists themselves. The gloves worn by beginners in their first year of postgraduate orthodontic training had about twice as many defects as those worn by qualified orthodontists. When patients with an increased risk of infection are to be treated, additional hand disinfection measures should be taken and 2 pairs of gloves worn in view of the relatively unreliable protection offered by commercially available latex gloves.
Directory of Open Access Journals (Sweden)
PR. Melo-Reis
Full Text Available Synadenium umbellatum Pax, popularly known as "cola-nota", is a medicinal plant that grows in tropical regions. The latex of this plant is used against various diseases, such as diabetes mellitus, leprosy, tripanosomiasis, leukemia, and several malignant tumors. The mutagenic, antimutagenic, and cytotoxic effects of the latex of this plant were investigated by measuring the frequency of micronuclei in mice bone marrow cells. To evaluate mutagenicity, the animals were treated with four doses of latex (10, 30, 50, and 100 mg/kg body weight. To study the antimutagenic activity, the animals were simultaneously treated with latex and mitomycin C (4 mg/kg. The cytotoxicity was evaluated by polychromatic and normochromatic erythrocytes ratio. Our results showed a significant increase of frequency of micronucleated polychromatic erythrocytes (MNPCE compared to the negative control group (p 0.05 was detected at the doses of 50 and 100 mg/kg. Under our experimental conditions, the results obtained indicate strong mutagenic and cytotoxic activity of S. umbellatum latex except the dose of 10 mg/kg and moderate antimutagenic effect at lower doses.
Effects of radio sensitizers in the vulcanization of natural rubber latex induced by gamma radiation
International Nuclear Information System (INIS)
Souza, A. de; Canavel, V.; Araujo, S.C. de; Guedes, S.M.L.
1992-01-01
The effect of C Cl 4 and n-butyl acrylate as a sensitizer for radiation vulcanization of 60% DRC natural rubber latex with gamma rays, was studied relating tensile strength of vulcanized latex. The vulcanization dose is 200 kGy for natural rubber latex and it decreases to 40 kGy and to 9 kGy in the presence of C Cl 4 / potassium laureate and n-butyl acrylate / t-butyl hydroperoxide, respectively. The H 2 O 2 as a co-sensitizer does not change the efficiency of the combination of these sensitizers. The IV spectra show the formation of C=O after the irradiation as consequence of oxidation reactions. (author)
Optical response of a flat metallic surface coated with a monolayer array of latex spheres
International Nuclear Information System (INIS)
Shi Lei; Liu Xiaohan; Yin Haiwei; Zi Jian
2010-01-01
We report on the fabrication, characterization and simulation of a structure consisting of a flat metallic surface coated with a monolayer array of latex spheres. This structure shows interesting optical response: over flat metallic surfaces a series of reflection minima appear in reflection spectra. Numerical simulations revealed that the structure can support two types of surface modes: surface plasmon-polaritons bound at the metallic surface and guided modes confined to the array of latex spheres, or their hybrids. Both experimental and theoretical results indicated that these surface modes show well-defined band structures due to the introduced periodicity by the monolayer array of latex spheres.
International Nuclear Information System (INIS)
Nadal, Jessica Mendes; Gomes, Mona Lisa Simionatto; Borsato, Débora Maria; Almeida, Martinha Antunes; Barboza, Fernanda Malaquias; Zawadzki, Sônia Faria; Kanunfre, Carla Cristine; Farago, Paulo Vitor; Zanin, Sandra Maria Warumby
2016-01-01
This paper aimed to obtain new spray-dried microparticles containing ferulic acid (FA) prepared by using a methacrylic polymer (Eudragit® L100). Microparticles were intended for oral use in order to provide a controlled release, and improved in vitro and in vivo biological effects. FA-loaded Eudragit® L100 microparticles were obtained by spray-drying. Physicochemical properties, in vitro cell-based effects, and in vivo platelet aggregation were investigated. FA-loaded Eudragit® L100 microparticles were successfully prepared by spray-drying. Formulations showed suitable encapsulation efficiency, i.e. close to 100%. Microparticles were of spherical and almost-spherical shape with a smooth surface and a mean diameter between 2 and 3 μm. Fourier-transformed infrared spectra demonstrated no chemical bond between FA and polymer. X-ray diffraction and differential scanning calorimetry analyses indicated that microencapsulation led to drug amorphization. FA-loaded microparticles showed a slower dissolution rate than pure drug. The chosen formulation demonstrated higher in vitro cytoprotection, anti-inflammatory and immunomodulatory potential and also improved in vivo anti-platelet effect. These results support an experimental basis for the use of FA spray-dried microparticles as a feasible oral drug delivery carrier for the controlled release of FA and improved cytoprotective and anti-platelet effects. - Highlights: • Ferulic acid-loaded Eudragit® L100 microparticles with high drug-loading were obtained. • Spray-dried Eudragit® L100 microparticles containing ferulic acid showed improved in vitro cytoprotective effect. • Ferulic acid spray-dried microparticles had potential as in vitro anti-inflammatory and immunomodulatory. • In vivo studies demonstrated an enhanced antiplatelet effect for ferulic acid-loaded Eudragit® L100 microparticles.
Energy Technology Data Exchange (ETDEWEB)
Nadal, Jessica Mendes; Gomes, Mona Lisa Simionatto [Postgraduate Program in Pharmaceutical Sciences, Department of Pharmacy, Federal University of Paraná (Brazil); Borsato, Débora Maria [Postgraduate Program in Pharmaceutical Sciences, Department of Pharmaceutical Sciences, State University of Ponta Grossa (Brazil); Almeida, Martinha Antunes [Postgraduate Program in Chemistry, Department of Chemistry, Federal University of Paraná (Brazil); Barboza, Fernanda Malaquias [Postgraduate Program in Pharmaceutical Sciences, Department of Pharmaceutical Sciences, State University of Ponta Grossa (Brazil); Zawadzki, Sônia Faria [Postgraduate Program in Chemistry, Department of Chemistry, Federal University of Paraná (Brazil); Kanunfre, Carla Cristine [Postgraduate Program in Biomedical Science, Department of General Biology, State University of Ponta Grossa (Brazil); Farago, Paulo Vitor, E-mail: pvfarago@gmail.com [Postgraduate Program in Pharmaceutical Sciences, Department of Pharmaceutical Sciences, State University of Ponta Grossa (Brazil); Zanin, Sandra Maria Warumby [Postgraduate Program in Pharmaceutical Sciences, Department of Pharmacy, Federal University of Paraná (Brazil)
2016-07-01
This paper aimed to obtain new spray-dried microparticles containing ferulic acid (FA) prepared by using a methacrylic polymer (Eudragit® L100). Microparticles were intended for oral use in order to provide a controlled release, and improved in vitro and in vivo biological effects. FA-loaded Eudragit® L100 microparticles were obtained by spray-drying. Physicochemical properties, in vitro cell-based effects, and in vivo platelet aggregation were investigated. FA-loaded Eudragit® L100 microparticles were successfully prepared by spray-drying. Formulations showed suitable encapsulation efficiency, i.e. close to 100%. Microparticles were of spherical and almost-spherical shape with a smooth surface and a mean diameter between 2 and 3 μm. Fourier-transformed infrared spectra demonstrated no chemical bond between FA and polymer. X-ray diffraction and differential scanning calorimetry analyses indicated that microencapsulation led to drug amorphization. FA-loaded microparticles showed a slower dissolution rate than pure drug. The chosen formulation demonstrated higher in vitro cytoprotection, anti-inflammatory and immunomodulatory potential and also improved in vivo anti-platelet effect. These results support an experimental basis for the use of FA spray-dried microparticles as a feasible oral drug delivery carrier for the controlled release of FA and improved cytoprotective and anti-platelet effects. - Highlights: • Ferulic acid-loaded Eudragit® L100 microparticles with high drug-loading were obtained. • Spray-dried Eudragit® L100 microparticles containing ferulic acid showed improved in vitro cytoprotective effect. • Ferulic acid spray-dried microparticles had potential as in vitro anti-inflammatory and immunomodulatory. • In vivo studies demonstrated an enhanced antiplatelet effect for ferulic acid-loaded Eudragit® L100 microparticles.
Development assessment of natural latex membranes: a new proposal for the treatment of amblyopia
Energy Technology Data Exchange (ETDEWEB)
Ribeiro, Jaqueline Alves; Rosa, Suelia Rodrigues Fleury, E-mail: jackalvesribeiro@gmail.com [Laboratorio de Engenharia e Biomaterial (BioEngLab), Faculdade Gama, Universidade de Brasilia (UnB), DF (Brazil); Leite, Cicilia Raquel Maia; Vasconcelos, Claudio Lopes; Soares, Joao Maria [Universidade do Estado do Rio Grande do Norte (UERN), Mossoro, RN (Brazil)
2017-05-15
The ophthalmic dysfunction amblyopia, commonly known as lazy eye, is characterized by decreased vision in one eye due to improper development in childhood. The aim of this study was to obtain and characterize natural rubber membranes and to assess their utility as an eye film capable of altering the passage of light. The latex membranes were produced using the Van Gogh method and the deposition technique and were analyzed by physical and chemical methods to determine the properties of latex in natura and of natural rubber membranes. The materials were characterized by X-ray diffractometry, scanning electron microscopy, thermogravimetry, differential scanning calorimetry, analysis of water sorption and light crossing analysis. We report here a new approach to the treatment of patients with amblyopia using latex membranes. (author)
Development assessment of natural latex membranes: a new proposal for the treatment of amblyopia
International Nuclear Information System (INIS)
Ribeiro, Jaqueline Alves; Rosa, Suelia Rodrigues Fleury; Leite, Cicilia Raquel Maia; Vasconcelos, Claudio Lopes; Soares, Joao Maria
2017-01-01
The ophthalmic dysfunction amblyopia, commonly known as lazy eye, is characterized by decreased vision in one eye due to improper development in childhood. The aim of this study was to obtain and characterize natural rubber membranes and to assess their utility as an eye film capable of altering the passage of light. The latex membranes were produced using the Van Gogh method and the deposition technique and were analyzed by physical and chemical methods to determine the properties of latex in natura and of natural rubber membranes. The materials were characterized by X-ray diffractometry, scanning electron microscopy, thermogravimetry, differential scanning calorimetry, analysis of water sorption and light crossing analysis. We report here a new approach to the treatment of patients with amblyopia using latex membranes. (author)
Directory of Open Access Journals (Sweden)
Eduardo Sanches Pereira do Nascimento
2011-01-01
Full Text Available In this study, the effect of rootstock on grafting through metabolomic analysis of latex (Hevea brasiliensis samples was verified by 1H nuclear magnetic resonance (NMR and multivariate data analysis. Sixteen metabolites present in the latex cytosol were characterized by NMR. PCA analysis showed that the latex samples of the RR and GR groups can be differentiated. The GR group samples present a metabolic profile similar to the RR group samples, while the RG group is in an intermediate position between RR and GG groups. Sucrose and formate contributed greatly to the separation obtained by PCA, presenting a good correlation between the results. 1H NMR was an efficient technique to differentiate latex samples from different types of rootstocks and grafting and in the future could be used to predict rubber production by latex analysis.
International Nuclear Information System (INIS)
Komgrit, R.; Thawat, C.; B, Tripob; Wirach, T.
2009-07-01
Full text: The vulcanization of natural rubber latex can be induced by gamma radiation, which enhances cross-linking within the rubber matrix. The purpose of this research is to investigate the effect of gamma radiation dose and sensitizers on the physical properties of irradiated natural rubber. Three sensitizers n-butyl acrylate (n-B A), tetrachloroethylene (C 2 Cl 4 ) and trichloromethane (CHCl 3 ) were mixed with natural rubber latex before irradiation with gamma ray dose varied from 14 to 22 kGy. Results showed that the mixture of three sensitizers with specific ratios effectively induced the cross-linking of natural rubber latex. The cross-linking ratio and improved physical properties increased with increasing gamma dose. Therefore, the mixture ratios of n-B A, C 2 Cl 4 and CHCl 3 have shown to be a critical parameter in the vulcanization of natural rubber latex by gamma radiation
The Synthesis and Modification of Nanosized Clickable Latex Particles
Almahdali, Sarah
2013-01-01
This research aims to add to the current knowledge available for miniemulsion polymerization reactions and to use this knowledge to synthesize multifunctional nanosized latex particles that have the potential to be used in catalysis. The physical
Amino Acid Composition of Protein-Enriched Dried Pasta: Is It Suitable for a Low-Carbohydrate Diet?
Directory of Open Access Journals (Sweden)
Rajko Vidrih
2015-01-01
Full Text Available Today, obesity is one of the major health problems, a so-called epidemic of the developed world. Obesity arises through an imbalance between energy intake and energy expenditure, so it is important for products to have a balanced nutritional composition. The aim of this study is to prepare high-protein pasta with high nutritional quality, with emphasis on its amino acid composition, as ordinary durum pasta lacks lysine and threonine. Ordinary durum wheat pasta contains, on average, 77 % carbohydrate, and can have even less than 10 % protein. It is therefore oft en excluded from normal energy-restricted diets, and especially from low-carbohydrate diets. In this study pasta that can satisfy the nutritional requirements of a low-carbohydrate diet and is suitable for daily use was developed and evaluated. Protein-enhanced pasta was produced by adding high amounts of plant protein extract (40 % dry matter without (plain high-protein pasta or with 3 % dried spinach powder (high-protein spinach pasta to durum wheat semolina. According to the sensory analysis data, the addition of 40 % of plant protein extract satisfied sensory and nutritional requirements, allowing further development and evaluation for possible marketing. This analysis shows that these high-protein neutral and spinach pasta contain 36.4 and 39.6 g of protein per 100 g of dry mass, 12.07 and 14.70 g of total essential amino acids per 100 g of dry mass, and a high content of branched-chain amino acids, i.e. 5.54 and 6.65 g per 100 g of dry mass, respectively. This therefore represents a true alternative to durum wheat pasta for low-carbohydrate diets.
Partial swelling of latex particles by two monomers
Noel, E.F.J.; Maxwell, I.A.; German, A.L.
1993-01-01
The swelling of polymeric latex particles with solvent and monomer is of great importance for the emulsion polymn. process in regard to compn. drift and rate of polymn. For the monomer combination, Me acrylate-vinyl acetate, both satn. and partial swelling were detd. exptl. Theories for satn.
Faucheu , Jenny; Chazeau , Laurent; Gauthier , Catherine; Cavaille , Jean-Yves; Goikoetxea , Monika; Minari , Roque; Asua , Jose M.
2009-01-01
International audience; Among other uses. latexes are a successful alternative to solvent-borne binders for coatings. Efforts are made to produce hybrid nanostructured latexes containing an acrylic phase and an alkyd phase, However, after the film-forming process, the surfactant used to stabilize these latexes remains in the film, and its location can have a drastic effect on the application properties. Among the processing parameters, the alkyd hydrophobicity can strongly influence this loca...
Ruiz-Moyano, Santiago; Martín, Alberto; Benito, María José; Nevado, Francisco Pérez; de Guía Córdoba, María
2008-11-01
The purpose of this study was to select lactic acid bacteria and bifibobacteria strains as potential probiotic cultures during the processing of Iberian dry fermented sausages. A total of 1000 strains were isolated from Iberian dry fermented sausages (363), and human (337) and pig faeces (300) in different culture media. Around 30% of these strains, mainly isolated from Iberian dry fermented sausages in LAMVAB agar, were pre-selected for testing as potential probiotics by their ability to grow adequately at the pH values and NaCl concentrations of these meat products during the ripening process. Of the in vitro investigations used to predict the survival of a strain in conditions present in the gastro intestinal tract, exposure to pH 2.5 showed itself to be a highly discriminating factor with only 51 out of 312 pre-selected strains resisting adequately after 1.5h of exposure. All acid-resistant isolates identified as lactobacilli originated from human faeces (Lactobacillus casei and Lactobacillus fermentum) and pig faeces (Lactobacillus reuteri, Lactobacillus animalis, Lactobacillus murinus, and Lactobacillus vaginalis). Pediococcus acidilactici strains were isolated from Iberian dry fermented sausages and pig faeces, whereas the greatest number of Enterococcus strains were identified as Enterococcus faecium, with this species being isolated from Iberian dry fermented sausages, and human and pig faeces. Most of these strains are promising probiotic meat culture candidates suitable for Iberian dry fermented sausages.
Directory of Open Access Journals (Sweden)
S. Iskandar
2011-04-01
Full Text Available To obtain the degradable plastic, the graft copolymerization of methyl methacrylate onto starch and natural rubber latex was conducted by a simultaneous irradiation technique. Gamma-ray from cobalt-60 source was used as the initiator. The grafted copolymer of starch-polymethyl methacrylate and the grafted copolymer of natural rubber-polymethyl methacrylate were mixed in the blender, and dried it in the oven. The dried grafted copolymer mixture was then molded using hydraulic press machine. The effect of irradiation dose, composition of the grafted copolymer mixture, film forming condition and recycle effect was evaluated. The parameters observed were tensile strength, gel fraction and soil burial degradability of grafted copolymer mixture. It was found that the tensile strength of grafted copolymer mixture increased by -ray irradiation. Increasing of the grafted copolymer of natural rubber-polymethyl methacrylate content, the gel fraction and tensile strength of the grafted copolymer mixture increased. The tensile strength of the grafted copolymer mixture was increased from 18 MPa to 23 MPa after recycled (film forming reprocessed 3 times. The grafted copolymer mixture was degraded completely after soil buried for 6 months
Chen, Li-Chun; Chung, Yun-Chin; Chang, Chen-Tien
2012-12-15
An acidic peroxidase isoform, POD-A, with a molecular mass of 69.4 kDa and an isoelectric point of 3.5 was purified from papaya latex. Using o-phenylenediamine (OPD) as a hydrogen donor (citrate-phosphate as pH buffer), the optimum pH for the function of POD-A was 4.6, and the optimum temperature was 50°C. The peroxidase activity of POD-A toward hydrogen donors was both pH- and concentration-dependent. Under optimal conditions, POD-A catalysed the oxidation of OPD at higher rates than pyrogallol, catechol, quercetin and 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid) (ABTS). The chemical modification reagents N-bromosuccinimide and sodium azide significantly inhibited POD-A activity. The results of kinetic studies indicated that POD-A followed a ping-pong mechanism and had a K(m) value of 2.8mM for OPD. Using CPC silica-immobilised POD-A for the determination of micromolar H(2)O(2) in milk, the lower limit of determination was 0.1 μM, and the recoveries of added H(2)O(2) were 96-109%. Copyright © 2012 Elsevier Ltd. All rights reserved.
Extractable proteins from field radiation vulcanized natural rubber latex
Energy Technology Data Exchange (ETDEWEB)
Parra, Duclerc F. [Chemical and Environmental Centre, Nuclear Energy Research Institute, Av. Lineu Prestes, 2242-CEP Sao Paulo (Brazil)]. E-mail: dfparra@ipen.br; Pinto Martins, Carlos Felipe [Chemical and Environmental Centre, Nuclear Energy Research Institute, Av. Lineu Prestes, 2242-CEP Sao Paulo (Brazil); Collantes, Hugo D.C. [Chemical and Environmental Centre, Nuclear Energy Research Institute, Av. Lineu Prestes, 2242-CEP Sao Paulo (Brazil); Lugao, Ademar B. [Chemical and Environmental Centre, Nuclear Energy Research Institute, Av. Lineu Prestes, 2242-CEP Sao Paulo (Brazil)
2005-07-01
The type I allergy associated with the use of natural rubber latex (NRL) products is caused by the NRL proteins leached by the sweat or other body fluids. Makuuchi's group proposed for the first time the proteins removal by the addition of water-soluble polymers (WSP) on radiation vulcanization of natural rubber latex (RVNRL) that is a promising process under development in many countries. In this study, Brazilian field natural rubber was irradiated with a {sup 60}Co gamma source to reduce the content of WSP in the final product. WSP was used as additive to improve the extraction of protein. After irradiation the RVNRL was centrifuged to extract the WSP and proteins. The analytical methodology for protein content was based on the modified Lowry method according to ASTM D5712. Protein determination was carried out in serum of latex and in the extracts of the gloves. The concentration of extractable water-soluble proteins in serum of irradiated field NRL (NRL1), not irradiated one (NRL2); of twice centrifuged sample with polymer additive NRL (NRL3) and of the glove manufactured (NRLG) are compared with commercial glove (CG). The irradiation process increases the extractable water-soluble proteins, EP, as reported in the literature. In this study the use of polymeric additive on the bi-centrifugation process to remove protein was successful and the EP of the glove obtained in NRL3 was at around 40% of the commercial glove.
Abdullah, Sriyana; Razak Shaari, Abdul; Hajar Rukunudin, Ibni; Syarhabil Ahmad, Muhammad
2018-03-01
The objective of this work was to investigate the effects of drying temperature on the concentration of O rthosiphon stamineus biomarker compounds which were rosmarinic acid (RA) and sinensetin (SEN). The thin layer drying approach was used to dry O. stamineus leaves at various temperatures of 30, 40 and 50°C using a laboratory scale hot air dryer. The dried leaves were then extracted using 60% aqueous methanol prior to quantification. The RA and SEN concentrations in the dried leaves extracts were quantified by the high performance liquid chromatography. The concentration of RA for the dried leaves at 30 and 40°C were higher as compared to that of the fresh leaves. This may due to the response of the plant cells to abiotic stress. The concentration of RA also showed a significant reduction when the temperature was increased to 50°C. In contrast, the SEN concentration in O. stamineus dried leaf extract was lower than that of the fresh samples. The concentrations of SEN depicted insignificant effects by drying at 30 and 50°C, and the highest value was obtained in the samples dried at 40°C. Results showed that the drying process was found to affect the concentration of both compounds; therefore suitable drying conditions should be adopted to enhance the medicinal values of the plant species.
International Nuclear Information System (INIS)
Faridi-Majidi, Reza; Sharifi-Sanjani, Naser
2007-01-01
Functionalized crosslinked polystyrene-co-divinylbenzene-co-chloromethylstyrene magnetic latex particles were prepared via emulsifier-free miniemulsion polymerization using 2, 2' azobis (2-amidinopropane) dihydrochloride (V-50) as an initiator and in the presence of magnetite nanoparticles in the monomers. Transmission electron microscopy (TEM) proved the presence of magnetite nanoparticles in polymer particles. Differential scanning calorimetery (DSC) analysis of the product showed an exothermic signal due to crosslinking of chains through electrophilic aromatic substitution of phenyl groups with chloromethyl groups in the presence of the dispersed Fe 3 O 4 as Lewis acid. This was proven by thermogravimetric analysis (TGA) via the loss of gaseous HCl. The results were also compared with those of magnetite-free miniemulsion polymerization using V-50
Energy Technology Data Exchange (ETDEWEB)
Faridi-Majidi, Reza [School of Chemistry, University College of Science, Tehran University, Tehran (Iran, Islamic Republic of)]. E-mail: refaridi@khayam.ut.ac.ir; Sharifi-Sanjani, Naser [School of Chemistry, University College of Science, Tehran University, Tehran (Iran, Islamic Republic of)
2007-04-15
Functionalized crosslinked polystyrene-co-divinylbenzene-co-chloromethylstyrene magnetic latex particles were prepared via emulsifier-free miniemulsion polymerization using 2, 2' azobis (2-amidinopropane) dihydrochloride (V-50) as an initiator and in the presence of magnetite nanoparticles in the monomers. Transmission electron microscopy (TEM) proved the presence of magnetite nanoparticles in polymer particles. Differential scanning calorimetery (DSC) analysis of the product showed an exothermic signal due to crosslinking of chains through electrophilic aromatic substitution of phenyl groups with chloromethyl groups in the presence of the dispersed Fe{sub 3}O{sub 4} as Lewis acid. This was proven by thermogravimetric analysis (TGA) via the loss of gaseous HCl. The results were also compared with those of magnetite-free miniemulsion polymerization using V-50.
[Anaphylactic reaction to latex during spinal anesthesia: a case report].
Ueda, Narumi; Kitamura, Rie; Wakamori, Takeshi; Nakamura, Kumi; Konishi, Keisuke
2008-05-01
A 46-year-old man, with a history of atopic dermatitis and bronchial asthma, underwent surgery for an inguinal hernia. Forty-three minutes subsequent to spinal anesthesia, the patient complained suddenly of dyspnea with wheezing. Blood pressure decreased and skin eruption was observed on his chest. Postoperative laboratory tests revealed high IgE concentration, and a skin test confirmed an allergy to latex. The patient's allergic reaction was easily overlooked because of his history of bronchial asthma and the possibility that the hypotension was caused by the high spinal anesthesia. Latex allergy should be considered in any suspicious case presenting with these symptoms during surgery. After recovery, a skin test should be used to confirm the allergy to avoid repeated allergic episodes.
Zhang, Hua; Wang, Zhen-Yu; Yang, Xin; Zhao, Hai-Tian; Zhang, Ying-Chun; Dong, Ai-Jun; Jing, Jing; Wang, Jing
2014-03-15
The objective of this study was to investigate the level of 18 trace elements of two freeze-dried samples from the Blueberry (Vaccinium corymbosum) and the Strawberry (Fragaria × Ananassa). The total free amino acid composition in the blueberry and strawberry was determined by an Amino Acid Analyzer. Eleven free amino acids were found in both berries. The trace elements in each dried fruit sample were determined by ICP-MS with microwave digestion. The linearity range of the standard curves was 0-1250.0 μg L(-1) (Mg, P, K, Ca),while in all cases, except for B, Na, Al, Cr, Mn, Fe, Ni, Cu, Zn, Se, Cd, Pb, Ge and As, which was 125.0 μg mL(-1), all related coefficients were above 0.9999; recovery was in the range of 79.0-106.8%. Minor concentrations of nutritional elements were found in each freeze-dried berry. In sum, the toxic trace element analysis found the content of toxic trace elements in each freeze-dried berry sample was safe for human consumption and that the overall quality of the blueberry surpassed that of the strawberry. The results certify that the two freeze-dried berries have potential for human consumption in value-added products and have a certain theoretical and practical significance. Crown Copyright © 2013. Published by Elsevier Ltd. All rights reserved.
Radiation vulcanization of natural rubber latex using 250 keV electron beam machine
Energy Technology Data Exchange (ETDEWEB)
Chirinos, H.; Yoshii, F.; Makuuchi, K.; Lugao, A. E-mail: ablugao@net.ipen.br
2003-08-01
The sensitized radiation vulcanization of natural rubber latex has been carried out with 250 keV electrons. Latex was irradiated over a range of the beam current from 5 to 20 mA in the presence of sensitizers like the n-butyl acrylate (n-BA). The vulcanization dose decreases with increasing beam current condition. The rate of vulcanization (R{sub vul}) depends on the beam current (I) as given by the equation R{sub vul}=kI{sup 0.6}.
Dry flue gas desulfurization byproducts as amendments for reclamation of acid mine spoil
International Nuclear Information System (INIS)
Dick, W.A.; Stehouwer, R.C.; Beeghly, J.H.; Bigham, J.M.; Lal, R.
1994-01-01
Development of beneficial reuses of highly alkaline, dry flue gas desulfurization (FGD) byproducts can impact the economics of adopting these FGD technologies for retrofit on existing powerplants. Greenhouse studies were conducted to evaluate the use of two dry FGD byproducts for reclamation of acid mine spoil (pH, 3.1 to 5.8). Treatment rates of FGD ranges from 0% to 32% by dry weight and most treatments also included 6% by dry weight of sewage sludge. Fescue (Festuca arundinacea Schreb.) was harvested monthly for a total of six harvests. Plant tissue composition and root growth were determined after the sixth harvest. Leachate analyses and pH determination of mixes were done at the beginning and end of the experiments. Both FGD byproducts were effective in raising the spoil pH and in improving fescue growth. At the highest FGD application rate, fescue growth decreased from the optimum due to high pH and reduced rooting volume caused by cementation reactions between the FGD and spoil. Trace elements, with the exception of B, were decreased in the fescue tissue when FGD was applied. Leachate pH, electrical conductivity, dissolved organic carbon, Ca, Mg, and S tended to increase with increased FGD application rate; Al, Fe, Mn, and Zn decreased. pH was the most important variable controlling the concentrations of these elements in the leachate. Concentrations of elements of environmental concern were near or below drinking water standard levels. These results indicate that FGD applied at rates equivalent to spoil neutralization needs can aid in the revegetation of acid spoil revegetation with little potential for introduction of toxic elements into the leachate water or into the food chain
Abdoel, Theresia H.; Pastoor, Rob; Smits, Henk L.; Hatta, Mochammad
2007-01-01
A latex agglutination assay for the serodiagnosis of typhoid fever was evaluated on samples collected from patients with clinical suspicion of typhoid fever in South Sulawesi, Indonesia, where the disease is endemic. The latex assay is very easy to use, gives a rapid result and may be used as a
Energy Technology Data Exchange (ETDEWEB)
Barreto, Alaide de Sa; Amaral, Ana Claudia F. [Fundacao Inst. Oswaldo Cruz (FIOCRUZ), Rio de Janeiro, RJ (Brazil). Instituto de Tecnologia em Farmacos -Farmanguinhos. Lab. de Plantas Medicinais e Derivados; Silva, Jefferson Rocha de A. [Universidade Federal do Amazonas, Manaus, AM (Brazil). Dept. de Quimica]. E-mail: jrocha_01@ufam.edu.br; Schripsema, Jan [Universidade Estadual do Norte Fluminense (UENF), Campos dos Goytacazes, RJ (Brazil). Setor de Quimica de Produtos Naturais; Rezende, Claudia M.; Pinto, Angelo C. [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Inst. de Quimica
2007-09-15
Himatanthus sucuuba and Plumeria rubra are used in folk medicine in Brazil to treat various ailments. The isolation of the new iridoid 15-demethylisoplumieride from the bark of Plumeria rubra L. var. acutifolia (Ait) Woodson and latex of Himatanthus sucuuba (Spruce) Woodson is reported. Other iridoid glycosides were obtained from both plants. The structures of these substances were elucidated by spectral analysis and comparison with data already reported. (author)
Short Communication : Enhancing the Quality and Activity of ...
African Journals Online (AJOL)
Effects of application of benzoic acid, sodium benzoate and sodium metabisulfite, prior to sun drying of papaya latex, on enzymic activity, colour appearance and smell of the crude papain produced were investigated. The preservatives improved appearance/colour, smell and enzymic activity with respect to control sample ...
Parunović, N.; Radović, Č.; Savić, R.
2017-09-01
In this study, the parallel examinations on fatty acid profiles and sensory properties of fermented dry sausages are presented. Three types of kulen and sremska sausages were made, which varied depending on the percentage of meat and fat derived from different pig breeds: autochthonous (Swallow-Belly Mangalitsa and Moravka) and commercial (Swedish Landrace). In sausages made from meat of commercial pig breed, the highest cholesterol content was detected. However, sausage made from the Mangalitsa pork meat contained higher levels of monounsaturated fatty acid (MUFA) and unsaturated fatty acid (USFA), and lower saturated fatty acid levels (SFA).The level of polyunsaturated (PUFA) in sausage made of Landrace pork meat was significantly higher than levels in other types. These differences between fatty acids were mostly deriving by higher total n-6 PUFA content. In a sausage made of Mangulitsa meat, the values of atherogenic (IA) and thrombogenic (IT) health lipid indexes are lower. Kulen and sremska sausages made from the Mangalitsa pork meat was superior in terms of colour, odour, taste, after taste and overall acceptability. This study demonstrate that pig breed have an effect on the chemical content, fatty acids profiles and sensory properties of dry fermented sausages.
Low field NMR study of the latex derived from Brosimum parinarioides - Moraceae
International Nuclear Information System (INIS)
Miguez, Eduardo; Tavares, Maria Ines B.
2009-01-01
Brosimum parinarioides is a tree found in the Amazonia forest and its latex (Leite de Amapa) is often used like food and by the popular medicine in the treatment of tuberculosis and asthma. Being swallowed in nature, its necessary determinate the stability degree of this latex in the storage conditions in which is used in Amazonia. The analyses of T 2 data showed that the limit of stability is not longer than six month in the storage conditions used by the population of Amazonia. The Low field NMR proved to be an efficient method for this kind of study. (author)
Nutritional and fatty acid profiles of sun-dried edible black ants (Polyrhachis vicina Roger
Directory of Open Access Journals (Sweden)
Duo Li
2010-03-01
Full Text Available Determination of the nutritional composition of sun-dried edible black ants (Polyrhachis vicina Roger cultivated in Zhejiang and Guizhou Provinces, China, was carried out. The Zhejiang and Guizhou ants contained 31.5% and 41.5% protein, 15.7% and 15.9% lipid, and 25.4% and 26.4% fibre respectively. Monounsaturated fatty acids were the most predominant fatty acids (71.472.7% of total fatty acids found in both ant samples, followed by saturated fatty acids (23.825.5% and polyunsaturated fatty acids (3.13.7%. A significant amount of n-3 fatty acids was detected: 87.4 mg/100g and 145.6 mg/100g in Zhejiang and Guizhou ants respectively. Phosphorus, iron and calcium were the main minerals found in the ant samples. A small amount of selenium was also found.
Directory of Open Access Journals (Sweden)
Qi Kangru
2017-12-01
Full Text Available High quality probiotic powder can lay the foundation for the commercial production of functional dairy products. The freeze-drying method was used for the preservation of microorganisms, having a deleterious effect on the microorganisms viability. In order to reduce the damage to probiotics and to improve the survival rate of probiotics during freeze-drying, the Response Surface Methodology (RSM was adopted in this research to optimize lyoprotectant composed of amino acids (glycine, arginine and salts (NaHCO3 and ascorbic acid. Probiotic used was Bifidobacterium bifidum BB01. The regression model (p<0.05 was obtained by Box–Behnken experiment design, indicating this model can evaluate the freeze-drying survival rate of B. bifidum BB01 under different lyoprotectants. The results indicated these concentrations as optimal (in W/V: glycine 4.5%, arginine 5.5%, NaHCO3 0.8% and ascorbic acid 2.3%, respectively. Under these optimal conditions, the survival rate of lyophilized powder of B. bifidum BB01 was significantly increased by 80.9% compared to the control group (6.9±0.62%, the results were agreement with the model prediction value (88.7%.
Georgakopoulos, Constantine D; Makri, Olga E; Pagoulatos, Dionisios; Vasilakis, Panagiotis; Peristeropoulou, Politimi; Kouli, Vasiliki; Eliopoulou, Maria I; Psachoulia, Caterina
2017-01-01
The objective of this study was to investigate the effect of dietary supplementation with omega-3 fatty acids on ocular surface and tear film in patients with type 2 diabetes suffering from dry eye. Thirty-six patients suffering from type 2 diabetes and moderate to severe dry eye syndrome were included in the study. Patients were assigned to receive omega-3 long-chain polyunsaturated fatty acids for 3 months. Tear film break-up time test, Schirmer-I test, and conjunctival impression cytology analysis were performed on all patients at baseline and after 1 and 3 months. The subjective symptoms of dry eye were evaluated with the Ocular Surface Disease Index (OSDI) questionnaire at the same time points. Patients' average age was 65.57 ± 4.27 years and the mean duration of diabetes was 14.85 ± 5.4 years. There was a statistically significant increase in Schirmer-I test results and tear break-up time score after 3 months of supplementary intake of omega-3 fatty acids compared to baseline (p dry eye syndrome in patients with type 2 diabetes.
Directory of Open Access Journals (Sweden)
J. Cornejo Tueros
2012-01-01
Full Text Available The paper discusses the application of rubber from latex binary coagulating agent consisting of cotton - textile waste and polymeric quaternary ammonium salts. The influence on the process of extracting rubber from latex flow coagulating agent temsperatury and concentration of the dispersed phase.
Institute of Scientific and Technical Information of China (English)
无
2008-01-01
A group of heterogeneous latexes poly(butyl acrylate)/poly(styrene-co-methyl methacrylate)(PBA/P(St-co-MMA))were prepared by a semi-continuous seeded emulsion polymerization process under monomer starved conditions.The glass transition temperature(Tg)and the mechanical properties of the film formed from the composite latex changed with the evolution of the particle morphology.A photon transmission method was used to monitor the phase structure evolution of films which were prepared from core-shell PBA/P(St-co-MMA)latex at room temperature and annealed at 383 K above Tg of the polymers.In addition,the changes of the surface of the film formed from the composite latex with time at 383 K were observed by AFM.The evidence illustrated that the film formed from the core-shell latex particles was metastable.The rearrangement of the phases could occur under proper conditions.
Nitrogen removal from concentrated latex wastewater by land treatment
Directory of Open Access Journals (Sweden)
Vikanda Thongnuekhang
2004-05-01
Full Text Available Most of the concentrated latex factories in the South of Thailand discharge treated wastewater that contains high level of nitrogen to a nearby river or canals leading to a water pollution problem. A study of land treatment system was conducted to treat and utilize nitrogen in treated wastewater from the concentrated latex factory. The experimental pilot-scale land treatment system was constructed at the Faculty of Engineering, Prince of Songkla University, Hat Yai Campus. It consisted of water convolvulus (Ipomea aquatica, I. Reptans, tropical carpet grass (Axonopus compresus (Swartz Beav. and control unit (no plantation. The treated wastewater from the stabilization pond system of the selected concentrated latex factoryin Songkhla was used to irrigate each experimental unit. Influent and effluent from the experimental units were analyzed for TKN, NH3-N, Org-N, NO3 --N, NO2 --N, BOD5, sulfate, pH and EC. The land treatment system resulted a high removal efficiency for nitrogen. Tropical carpet grass provided higher removal efficiency than other units for all parameters. The removal efficiency of water convolvulus and control unit were not significantly different. The average removal efficiency of TKN, NH3-N, Org-N, BOD5 and sulfate for tropical carpet grass unit were 92, 97, 61, 88 and 52%, for water convolvulus unit were 75, 80, 43, 41 and 30%, and for control unit were 74, 80, 41, 31 and 28%, respectively. Mass balance of nitrogen transformation was conducted. It revealed that plant uptake was the major mechanism for nitrogen removal in land treatment.
Characteristics of Red Algae Bioplastics/Latex Blends under Tension
Directory of Open Access Journals (Sweden)
M. Nizar Machmud
2013-10-01
Full Text Available Cassava, corn, sago and the other food crops have been commonly used as raw materials to produce green plastics. However, plastics produced from such crops cannot be tailored to fit a particular requirement due to their poor water resistance and mechanical properties. Nowadays, researchers are hence looking to get alternative raw materials from the other sustainable resources to produce plastics. Their recent published studies have reported that marine red algae, that has been already widely used as a raw material for producing biofuels, is one of the potential algae crops that can be turned into plastics. In this work, Eucheuma Cottonii, that is one of the red alga crops, was used as raw material to produce plastics by using a filtration technique. Selected latex of Artocarpus altilis and Calostropis gigantea was separately then blended with bioplastics derived from the red algae, to replace use of glycerol as plasticizer. Role of the glycerol and the selected latex on physical and mechanical properties of the red algae bioplastics obtained under a tensile test performed at room temperature are discussed. Tensile strength of some starch-based plastics collected from some recent references is also presented in this paperDoi: 10.12777/ijse.5.2.81-88 [How to cite this article: Machmud, M.N., Fahmi, R., Abdullah, R., and Kokarkin, C. (2013. Characteristics of Red Algae Bioplastics/Latex Blends under Tension. International Journal of Science and Engineering, 5(2,81-88. Doi: 10.12777/ijse.5.2.81-88
Amino Acid Composition of Protein-Enriched Dried Pasta: Is It Suitable for a Low-Carbohydrate Diet?
Filip, Sebastjan; Vidrih, Rajko
2015-09-01
Today, obesity is one of the major health problems, a so-called epidemic of the developed world. Obesity arises through an imbalance between energy intake and energy expenditure, so it is important for products to have a balanced nutritional composition. The aim of this study is to prepare high-protein pasta with high nutritional quality, with emphasis on its amino acid composition, as ordinary durum pasta lacks lysine and threonine. Ordinary durum wheat pasta contains, on average, 77% carbohydrate, and can have even less than 10% protein. It is therefore often excluded from normal energy-restricted diets, and especially from low-carbohydrate diets. In this study pasta that can satisfy the nutritional requirements of a low-carbohydrate diet and is suitable for daily use was developed and evaluated. Protein-enhanced pasta was produced by adding high amounts of plant protein extract (40% dry matter) without (plain high-protein pasta) or with 3% dried spinach powder (high-protein spinach pasta) to durum wheat semolina. According to the sensory analysis data, the addition of 40% of plant protein extract satisfied sensory and nutritional requirements, allowing further development and evaluation for possible marketing. This analysis shows that these high-protein neutral and spinach pasta contain 36.4 and 39.6 g of protein per 100 g of dry mass, 12.07 and 14.70 g of total essential amino acids per 100 g of dry mass, and a high content of branched-chain amino acids, i.e. 5.54 and 6.65 g per 100 g of dry mass, respectively. This therefore represents a true alternative to durum wheat pasta for low-carbohydrate diets.
Tensile properties of latex paint films with TiO2 pigment
Hagan, Eric W. S.; Charalambides, Maria N.; Young, Christina T.; Learner, Thomas J. S.; Hackney, Stephen
2009-05-01
The tensile properties of latex paint films containing TiO2 pigment were studied with respect to temperature, strain-rate and moisture content. The purpose of performing these experiments was to assist museums in defining safe conditions for modern paintings held in collections. The glass transition temperature of latex paint binders is in close proximity to ambient temperature, resulting in high strain-rate dependence in typical exposure environments. Time dependence of modulus and failure strain is discussed in the context of time-temperature superposition, which was used to extend the experimental time scale. Nonlinear viscoelastic material models are also presented, which incorporate a Prony series with the Ogden or Neo-Hookean hyperelastic function for different TiO2 concentrations.
LaTeX - Know what you are missing
Directory of Open Access Journals (Sweden)
Gunther Maier
2016-11-01
Full Text Available This article gives a brief introduction to \\LaTeX\\ and related tools. The aim is to give an overview, to demonstrate the flexibility and versatility of the software, and to assist the reader taking first steps using it. The article links to a number of valuable resources for further information.
Radiation vulcanization of natural rubber latex
International Nuclear Information System (INIS)
Wan Manshol bin Wan Zin; Norjanah binti Mohid
1994-01-01
This paper describes the experimental techniques and the results of radiation vulcanization of natural rubber latex carried out on several high ammonia latices available in the country. The efficiency of various sensitisers and stabilisers used were evaluated in terms of the gamma radiation dose required to produce the maximum tensile strengths. The extent of crosslinking of RVNRL sample films were estimated by equilibrium swelling ratio measurements. The stability of pre-irradiated and post-irradiated samples were monitored using viscosity measurements as the parameter
Marine bacterial prodigiosin as dye for rubber latex, polymethyl ...
African Journals Online (AJOL)
Prodigiosin is known for its immunomodulatory, antibacterial, antimycotic, antimalarial, algicidal and anticancer activities. Here, we reported the evaluation of prodigiosin pigment as a dyeing agent in rubber latex, paper and polymethyl methacrylate (PMMA) so that it can be considered as an alternative to synthetic pigments.
Assessment of adverse reactions to latex gloves use among nurses ...
African Journals Online (AJOL)
... to latex is a common problem among nurses and other health care workers. ... There was significant association between family history and occurrence of ... These effects may vary in severity from skin problems to anaphylactic shock.
Namork, Ellen; Kurup, Viswanath P; Aasvang, Gunn Marit; Johansen, Bjørn V
2004-11-01
The authors collected ambient air along two highways in Oslo to investigate the annual variations in particulate matter (PM10) and the presence of latex as an outdoor allergen. PMI, was monitored for a period of five years, during which time the use of studded winter tires was reduced. The presence of latex and of common aeroallergens was examined directly on the collection filters with immunoelectron microscopy visualized in a scanning electron microscope. The annual variation in PM10 was similar over the five years of sampling, with increased mass concentrations in winter. Statistical analysis indicated no major effect from the change to nonstudded tires. The most important factors influencing the PM10 concentration were meteorological parameters like wind and rain. Immnunolabeling of the filters showed latex as an outdoor allergen that adhered to carbon aggregates from vehicle emission. The results also indicated cross-reactive epitopes among the common allergens investigated, which for sensitized subjects may add to the risk of developing latex allergy.
Directory of Open Access Journals (Sweden)
Toong Long Jeng
2015-12-01
Full Text Available Caffeoylquinic acid (CQA derivatives are known to possess antioxidative potential and have many beneficial effects on human health. The present study compared the CQA contents and antioxidant activities of aerial parts of sweet potato plants. The effects of drying methods (freeze drying, and drying at 30°C, 70°C, and 100°C on these two parameters of the first fully expanded leaves were also assessed. The results indicated that the CQA derivatives were detectable in leaves, stem, and flowers of sweet potato plants (varied from 39.34 mg/g dry weight to 154.05 mg/g dry weight, with the leaves (particularly expanding and first fully expanded leaves containing more CQA derivatives than other aerial plant parts. The expanding and first fully expanded leaves also exhibited greater antioxidant activities than other aerial plant parts, possibly due to their higher contents of CQA derivatives. Drying method significantly affected the content of CQA derivatives in dried sweet potato leaf tissues. Drying treatments at both 70°C and 100°C significantly reduced the CQA derivative content and antioxidant activity in the first fully expanded leaves. Among the tested drying methods, the freeze-drying method demonstrated the preservation of the highest amount of CQA derivatives (147.84 mg/g and antioxidant property. However, 30°C cool air drying was also a desirable choice (total CQA derivative content was reduced to only 129.52 mg/g, compared to 70°C and 100°C hot air drying, for commercial-scale processing of sweet potato leaves, if the higher operation cost of freeze drying was a major concern.
The construction and commissioning of MINT's latex irradiator
International Nuclear Information System (INIS)
Razali Hamzah; Muhd Khairi Muhd Said; Muhd Ariff Hamzah; Wan Manshol Wan Zin; Taiman Kadni
1996-01-01
The construction and installation of MINT's automatic continuous latex irradiator is described. MINT cooperated with NUKEM to design the plant. Construction was done by local building consultants and local contractor. The installation of the plant includes local fabrication components and imported components. The plant is automatically controlled by a computer system. Features of plant is described
Directory of Open Access Journals (Sweden)
Jae-Woong Han
2015-10-01
Full Text Available We evaluated the strength and durability characteristics of latex-polymer-modified, pre-packed pavement repair concrete (LMPPRC with a rapid-set binder. The rapid-set binder was a mixture of rapid-set cement and silica sand, where the fluidity was controlled using a latex polymer. The resulting mix exhibited a compressive strength of ¥21 MPa and a flexural strength of ¥3.5 MPa after 4 h of curing (i.e., the traffic opening term for emergency repairs of pavement. The ratio of latex polymer to rapid-set binder material was varied through 0.40, 0.33, 0.29, and 0.25. Mechanical characterization revealed that the mechanical performance, permeability, and impact resistance increased as the ratio of latex polymer to rapid-set binder decreased. The mixture exhibited a compressive strength of ¥21 MPa after 4 h when the ratio of latex polymer to rapid-set binder material was ¤0.29. The mixture exhibited a flexural strength of ¥3.5 MPa after 4 h when the ratio of latex polymer to rapid-set binder material was ¤0.33. The permeability resistance to chloride ions satisfied 2000 C after 7 days of curing for all ratios. The ratio of latex polymer to rapid-set binder material that satisfied all conditions for emergency pavement repair was ¤0.29.
Study of glucoamylase immobilization in butadiene nitrile latex membrane
International Nuclear Information System (INIS)
Miller, E.
1992-01-01
Attempts have been undetaken to immobilize glucoamylaze by means of butadiene nitrile latex in the presence of a chemical initiator and 60 Co γ-radiation. The activity, stability of conjugates in the membrane and permeability of oxygen in these membranes were determined. (author) 14 refs.; 5 figs
Directory of Open Access Journals (Sweden)
Echenique Manrique, Alejandro
2015-04-01
Full Text Available Objective: To determine the prevalence and clinical impact of sensitization to latex and to five tropical fruits (banana, avocado, kiwi, pineapple and passion fruit in dentistry students. Methods: Analytical cross-sectional study of 128 dentistry students at University of Antioquia in Medellín, Colombia. Information was collected by means of a questionnaire and skin prick tests with latex and fruits were done. Results: All students reported having had contact with latex. Nine of them informed at least one episode of adverse reaction to contact with latex without proof of sensitization to it. Five reported at least one reaction with one of the fruits, but skin prick tests were negative. Four of the 14 students who reported gastrointestinal symptoms were sensitized to latex or to one of the tested fruits. Overall, latex sensitization rate was 3.1%. Conclusion: This percentage of sensitization to latex is lower than that in other studies; this may be due to the expression of immune mechanisms other than IgE mediation. We failed to demonstrate a higher sensitization rate to latex as students advanced in their career. The association between gastrointestinal symptoms and sensitization to both fruit and latex is to be emphasized.
Oral omega-3 fatty acid treatment for dry eye in contact lens wearers.
Bhargava, Rahul; Kumar, Prachi
2015-04-01
The aim of this study was to evaluate the effect of dietary omega-3 fatty acid (O3FA) supplementation on dry eye symptoms, tear film tests, and conjunctival impression cytology in patients with contact lens wear-associated dry eye. In this randomized, double-blind, multicentric trial, contact lens wearers (n = 496) were randomized to receive either O3FAs or placebo capsules (corn oil) twice daily for 6 months. Subjects underwent examinations at baseline, 3 months, and 6 months. At each visit, a questionnaire of dry eye symptoms and lens wear comfort was administered. Subjects further underwent measurement of tear film break-up time (TBUT) and a Schirmer test. Conjunctival impression cytology was performed by the transfer method. Improvement in symptoms and lens wear comfort were primary outcome measures. Changes from baseline in TBUT, Schirmer, and Nelson grade at 6 months were secondary outcome measures. The mean improvement in symptom score in the O3FA group was 4.7 ± 2 (2.0) as compared with 0.5 ± 2 (0.9) in the placebo group (P dry eye symptoms, improving lens wear comfort, and cytological changes in contact lens wearers.
Mechanical and morphological properties of kenaf powder filled natural rubber latex foam
Energy Technology Data Exchange (ETDEWEB)
Karim, Ahmad Fikri Abdul, E-mail: a.fikri-89@yahoo.com; Ariff, Zulkifli Mohamad [School of Materials and Mineral Resources Engineering, Engineering Campus, Universiti Sains Malaysia, 14300 Nibong Tebal, Pulau Pinang (Malaysia); Ismail, Hanafi [Cluster for Polymer Composites (CPC), Science and Engineering Research Centre, Engineering Campus, Universiti Sains Malaysia,14300 Nibong Tebal, Pulau Pinang (Malaysia)
2015-07-22
This research is carried out by incorporate kenaf powder with natural rubber latex (NRL) compound and is foamed to make natural rubber latex foam (NRLF) by using a well known technique called Dunlop method. Different loading of kenaf powder was added to NRL compound and was foamed to make NRLF. The tensile properties, and morphology of kenaf filled NRLF was studied. Increase in kenaf loading reduced the tensile strength and elongation at break and of a compound. Modulus at 100% elongation of the compound increased with increased in filler loading. The morphological and micro structural characterization has been performed by using scanning electron microscopy (SEM)
Mechanical and morphological properties of kenaf powder filled natural rubber latex foam
International Nuclear Information System (INIS)
Karim, Ahmad Fikri Abdul; Ariff, Zulkifli Mohamad; Ismail, Hanafi
2015-01-01
This research is carried out by incorporate kenaf powder with natural rubber latex (NRL) compound and is foamed to make natural rubber latex foam (NRLF) by using a well known technique called Dunlop method. Different loading of kenaf powder was added to NRL compound and was foamed to make NRLF. The tensile properties, and morphology of kenaf filled NRLF was studied. Increase in kenaf loading reduced the tensile strength and elongation at break and of a compound. Modulus at 100% elongation of the compound increased with increased in filler loading. The morphological and micro structural characterization has been performed by using scanning electron microscopy (SEM)
A LaTeX graphics routine for drawing Feynman diagrams
International Nuclear Information System (INIS)
Levine, M.J.S.
1990-01-01
FEYNMAN is a LaTeX macropackage which allows the user to construct a versatile range of Feynman diagrams within the text of a document. Diagrams of publication quality may be drawn with relative ease and rapidity. (orig.)
Radiation-induced grafting polymerization of MMA onto polybutadiene rubber latex
International Nuclear Information System (INIS)
Peng Jing; Wang Maolin; Qiao Jinliang; Wei Genshuan
2005-01-01
The grafting of methyl methacrylate (MMA) onto polybutadiene rubber latex by the direct radiation method was carried out. The effects of monomer concentration, absorbed dose and dose rate of gamma rays on the grafting yield were investigated. The graft copolymers were characterized by transmission electron microscopy (TEM), FTIR spectroscopy, and differential scanning calorimetry. TEM photographs revealed that the core-shell structures of latex particles are formed at low MMA content, and with the increasing of MMA content, the semi-IPN-like structure with core-shell could be developed due to the high gel fraction of polybutadiene (PBD) seed particles. In addition, infrared analysis confirmed that MMA could be grafted onto PBD molecular chains effectively under appropriate irradiation conditions. The interfacial adhesion between PBD rubber (core) and PMMA (shell) phases could be enhanced with the increase of MMA concentration
Latex allergy in an infant with acquired hydrocephalus | Ehiozw ...
African Journals Online (AJOL)
We report the case of a 3 month old male infant with acquired hydrocephalus undergoing ventriculo-peritoneal shunt insertion who developed wheals and suffered a respiratory arrest following contact with latex gloves. The need for anaesthetists to effectively diagnose and properly manage this rare clinical entity is ...
Dry Matter Production and Leaf Elemental Concentrations of Rambutan Grown on an Acid Ultisol
Little is known about the adaptability of rambutan (Nephelium lappaceum) to highly acidic soils rich in aluminum (Al). A 2-yr field study was conducted to determine the effects of various levels of soil Al on dry matter production, plant growth, and nutrient concentration in the leaves of four cult...
Jeng, Toong Long; Lai, Chia Chi; Liao, Ting Chen; Lin, Su Yue; Sung, Jih Min
2015-12-01
Caffeoylquinic acid (CQA) derivatives are known to possess antioxidative potential and have many beneficial effects on human health. The present study compared the CQA contents and antioxidant activities of aerial parts of sweet potato plants. The effects of drying methods (freeze drying, and drying at 30°C, 70°C, and 100°C) on these two parameters of the first fully expanded leaves were also assessed. The results indicated that the CQA derivatives were detectable in leaves, stem, and flowers of sweet potato plants (varied from 39.34 mg/g dry weight to 154.05 mg/g dry weight), with the leaves (particularly expanding and first fully expanded leaves) containing more CQA derivatives than other aerial plant parts. The expanding and first fully expanded leaves also exhibited greater antioxidant activities than other aerial plant parts, possibly due to their higher contents of CQA derivatives. Drying method significantly affected the content of CQA derivatives in dried sweet potato leaf tissues. Drying treatments at both 70°C and 100°C significantly reduced the CQA derivative content and antioxidant activity in the first fully expanded leaves. Among the tested drying methods, the freeze-drying method demonstrated the preservation of the highest amount of CQA derivatives (147.84 mg/g) and antioxidant property. However, 30°C cool air drying was also a desirable choice (total CQA derivative content was reduced to only 129.52 mg/g), compared to 70°C and 100°C hot air drying, for commercial-scale processing of sweet potato leaves, if the higher operation cost of freeze drying was a major concern. Copyright © 2014. Published by Elsevier B.V.
International Nuclear Information System (INIS)
Rogero, Sizue O.; Spencer, Patrick J.; Campos, Vania E.; Lusvarghi, Fabio M.; Higa, Olga Z.
1997-01-01
Several proteins in natural rubber latex (NRL) have been assigned to be significant allergens. It is known that proteins submitted to ionizing radiation suffer denaturation and immunochemical modification resulting in low antigenic reactivity. The aim of this study was to extract and compare water extractable proteins from NRL films vulcanized by conventional and by ionizing radiation methods. SDS-polyacrylamide gel electrophoresis (SDS--PAGE) and high pressure liquid chromatography (HPLC) showed a diffuse protein band of about 14 KDa, which we believe is rubber elongation factor (REF), in both eluates, but smaller in latex film vulcanized by ionizing radiation. REF has been suggested to be a major latex allergen. These data suggest that ionizing radiation vulcanization could be an useful method for the production of NRL goods with low antigenicity. (author). 8 refs., 2 figs., 1 tab
The polymerization of aniline in polystyrene latex particles
Czech Academy of Sciences Publication Activity Database
Blinova, Natalia V.; Reynaud, S.; Roby, F.; Trchová, Miroslava; Stejskal, Jaroslav
2010-01-01
Roč. 160, 15/16 (2010), s. 1598-1602 ISSN 0379-6779 R&D Projects: GA AV ČR IAA400500905; GA ČR GA203/08/0686; GA ČR GA202/09/1626 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyaniline * polystyrene latex * polyaniline-polystyrene composite Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.871, year: 2010
Cai, Qiuxing; Wu, Yanyan; Li, Laihao; Wang, Yueqi; Yang, Xianqing; Zhao, Yongqiang
2017-10-01
Lipid oxidation in salt-dried yellow croaker ( Pseudosciaena polyactis) was evaluated during processing with commonly used analytical indices, such as the peroxide value (POV), the thiobarbituric acid reactive substances (TBARS) value, and oxidative-relative lipoxygenase (LOX) activity. Additionally, fatty acids were analyzed using gas chromatography-mass spectrometry. Both POV and TBARS increased significantly ( P acids were identified. Combined eicosapentaenoic acid (EPA; C20:5n3) and docosahexaenoic acid (DHA; C22:6n3) content varied between (19.20 ± 0.37) mg g-1 and (23.45 ± 1.05) mg g-1. The polyunsaturated fatty acid/saturated fatty acid (PUFA/SFA) ratio in yellow croaker was 0.73-1.10, and the n-6/n-3 PUFA ratio was approximately 0.13-0.20. The contents of most fatty acids varied significantly ( P acids are potential markers for evaluating lipid oxidation in fish muscle because there was a significant correlation between these markers and TBARS and LOX activity ( P 0.931.
Tiwari, Sudhanshu; Singh, A
2005-11-01
To know the short- as well as long-term effect of aqueous latex extracts of Euphorbia tirucalli on carbohydrate and protein metabolism, the snail Lymnaea acuminata was exposed to sublethal doses of 0.37 and 0.55 mg/L for a 24-h and 0.20 and 0.31 mg/L for a 96-h exposure period. Significant (P<0.05) alterations in the glycogen, pyruvate, lactate, total protein, and free amino acid level, as well as in the activity of enzyme lactic dehydrogenase, succinic dehydrogenase, cytochrome oxidase, protease, aspartate aminotransaminase, and alanine aminotransaminase were observed in the nervous, hepatopancreatic, and ovotestis tissues of the freshwater vector snail L. acuminata exposed to sublethal doses of E. tirucalli latex extract. The alterations in all biochemical parameters were significantly (P<0.05) time and dose dependent. After the 7th day of the withdrawal of treatment, there was significant (P<0.05) recovery in glycogen, pyruvate, lactate, total protein, and the free amino acid level and in the activity of the lactic dehydrogenase, succinic dehydrogenase, cytochrome oxidase, protease, aspartate aminotransaminase and alanine aminotransaminase enzymes in all three of the studied tissues of the snail, which supports the view that the plant product is safe for use as a molluscicide for the control of harmful freshwater vector snails in the aquatic environment.
Nettis, E; Assennato, G; Ferrannini, A; Tursi, A
2002-03-01
It has been established that there are type I and type IV allergens in latex gloves. The purpose of the study was to establish the prevalence of rubber glove-induced skin symptoms among health care workers in one Italian hospital. Health care workers (n = 1584) were evaluated using a written questionnaire and 295 respondents with glove-induced skin symptoms were tested. We performed: skin prick test with latex glove extract and commercial latex, and environmental and food allergens; glove use test; patch tests with a rubber additive series; and RASTs. Hospital employees who used or had used latex gloves at work were 1294. Three hundred and sixteen (24.4%) reported glove-induced symptoms, namely, cutaneous symptoms in all the cases and non-cutaneous symptoms in 105 subjects (8.1%). Twenty-seven of the 295 symptomatic employees tested (9.1%) were latex sensitive. Thirty-one patients (10.5%) exhibited positive patch test to rubber-related allergens. The most positive readings were obtained from the Thiuram mix and the Carba mix, with 12 and 9 positivities, respectively. The risk factors for latex skin sensitization were: a previous history of atopy and asthma; history of surgery; pre-existing hand dermatitis; work-related symptoms; and positive skin tests to common inhalant and certain foods (P skin complaints of latex gloves are related to skin irritation rather than to allergy. The immediate allergy to latex and the delayed allergy to rubber chemicals suggest that all the health care workers with glove-related dermatitis should undergo both skin prick test and glove use test to detect type I hypersensitivity to latex, and patch test to detect type IV hypersensitivity to rubber chemicals.
Directory of Open Access Journals (Sweden)
Hamidah Harahap
2015-06-01
Full Text Available The purpose of this research was to study the effect of drying time on the mechanical properties of natural rubber latex filled with cassava peel waste modified alkanolamide. Cassava peel is a waste, containing cellulose which is potential as fillers in natural rubber latex products. Cassava peel waste was dried and milled until the size of 100 mesh. Alkanolamide is one type of non-ionic surfactant which is synthesized from RBDPS (Refined Bleached Deodorized Palm Stearin and diethanolamine. Alkanolamide has polar group which can modified cassava peel waste and make strong chemical bonding with natural rubber latex. The production of natural rubber latex products was started from pre-vulcanization at 70°C until the system was cured and the chloroform number has reached number 3. Natural rubber latex was formed into films by coagulant dipping and drying method at 120°C for 10 minutes and 20 minutes. Results show that longer drying time will improve the crosslink density and tensile strength of natural rubber latex products until the addition of 15 phr cassava peel waste powder
Content of Asthmagen Natural Rubber Latex Allergens in Commercial Disposable Gloves.
Bittner, C; Garrido, M V; Krach, L H; Harth, V
The use of natural rubber latex (NRL) gloves in many occupations may lead to latex sensitization, allergic asthma, and skin reactions. Due to their good properties and environmental safety NRL gloves are still being used in the healthcare setting, but also in the food industry, by hairdressers, cleaners, etc. The aim of our study was to assess the protein and NRL allergen content in commercial gloves by different methods, including a new assay. Twenty commercially available NRL gloves were analyzed. Protein extraction was performed according to the international standard ASTM D-5712. Total protein content was measured with a modified Lowry method, NRL content with the CAP Inhibition Assay, the Beezhold ELISA Inhibition Assay, and an innovative ELISA with IgY-antibodies extracted from eggs of NRL-immunized hens (IgY Inhibition Assay). We found a high protein content in a range of 215.0-1304.7 μg/g in 8 out of the 20 NRL gloves. Seven of the 20 gloves were powdered, four of them with a high protein content. In gloves with high protein content, the immunological tests detected congruently high levels of NRL allergen. We conclude that a high percentage of commercially available NRL gloves still represent a risk for NRL allergy, including asthma. The modified Lowry Method allows to infer on the latex allergen content.
Drying-induced physico-chemical changes in cranberry products.
Michalska, Anna; Wojdyło, Aneta; Honke, Joanna; Ciska, Ewa; Andlauer, Wilfried
2018-02-01
Sugar-free cranberry juice (XAD) and juice with 15% of maltodextrin were dried by freeze-, vacuum and spray drying methods. Total phenolics (589-6435mg/kg dry matter) including 5 flavonols, 3 phenolic acids, 2 procyanidins and 5 anthocyanins were stronger affected by juice formulation than by drying methods. Spray drying of juice, regardless of its formulation, was competitive to freeze drying in terms of polyphenols' retention. Increase in temperature up to 100°C during vacuum drying of XAD extracts resulted in degradation of polyphenolics (down to 4%), except chlorogenic acid. Its content increased with rise in temperature and accelerated hydroxymethylfurfural formation. The stronger the impact of drying, the more chlorogenic acid is present in cranberry products. In all powders analysed, formation of furoylmethyl amino acids was noted. Antioxidant capacity of cranberry products was influenced by juice formulation and was linked to content of polyphenols. Copyright © 2017 Elsevier Ltd. All rights reserved.
Restoration of Tear Secretion in a Murine Dry Eye Model by Oral Administration of Palmitoleic Acid
Nakamura, Shigeru; Kimura, Yuki; Mori, Daisuke; Imada, Toshihiro; Izuta, Yusuke; Shibuya, Michiko; Sakaguchi, Hisayo; Oonishi, Erina; Okada, Naoko; Matsumoto, Kenji; Tsubota, Kazuo
2017-01-01
Sea buckthorn (Hippophae rhamnoides)–derived products have traditionally been used as food and medicinal ingredients in Eastern countries. The purpose of this study was to investigate the effect of oral intake of sea buckthorn oil products on tear secretion using a murine dry eye model. Orally administered sea buckthorn pulp oil (not seed oil) restored aqueous tear secretion to its normal value under a dry eye condition. Palmitoleate (C16:1), a fatty acid present in sea buckthorn pulp oil, pr...
Foliar loading and metabolic assimilation of dry deposited nitric acid air pollutants by trees
Pamela E. Padgett; Hillary Cook; Andrzej Bytnerowicz; Robert L. Heath
2009-01-01
Dry deposition of nitric acid vapor (HNO(3)) is a major contributor to eutrophication of natural ecosystems. Although soil fertilization by nitrogen deposition is considered to be the primary pathway for changes in plant nutrient status and shifts in ecological structure, the aerial portion of plants offer many times the surface area in which to...
International Nuclear Information System (INIS)
Utama, Marga; Herwinarni, S.; Halik, H.M.; Siswanto; Suharyanto; Syamsu, Y.; Handoko, B.
2006-01-01
Four tons fresh field natural rubber latex (FNRL) with total solid content 30% were added with 2 phr (part hundred ratio of rubber) normal butyl acrylate (nBA) then irradiated by gamma rays at 25 kGy. The irradiated FNRL was centrifuged, then the properties of irradiated centrifuged natural rubber latex (INRL) and its film were measured before and after storage for 5 months. It is found that the INRL is stable latex during storage in 5 months, with lowest protein, and free nitrosamine content. The tensile strength of INRL film was 24-27 MPa, and modulus 600% was 1,5-2,0 MPa, elongation at break was 900%, and hardness was 27-29 Shore A, while the extractable protein content less than 100 μg/g. (author)
Directory of Open Access Journals (Sweden)
Luiz Henrique de Sousa
2011-01-01
Full Text Available PURPOSE: To evaluate the morphological aspects of the behavior of 4 types of latex biomembranes implanted in preperitoneal videolaparoscopic inguinoplasty. METHODS: Sixteen inguinoplasties were performed in 12 dogs: group 1 received an impermeable latex biomembrane in the right inguinal region and a prolene prosthesis, as control, in the contralateral inguinal region; groups 2, 3 and 4 received latex biomembranes respectively containing impermeable polyamide, 1-mm thick porous polyamide and 0.5-mm thick porous polyamide. Macro- and microscopic evaluations of the inguinal region and of the removed implants were made on the 7th, 14th, 21st and 28th days in group 1 and on the 28th postoperative day in the other groups. RESULTS: We observed absence of hematoma, seroma and infection; presence of tortuosities; induction of vascular neoformation, inflammatory reaction and collagen deposition, and full encystment of the latex biomembranes, except that with fine porous polyamide, which was partially incorporated, with the formation of microcysts. No latex biomembrane induced fibrosis as observed in the prolene control group. CONCLUSIONS: The biomembranes maintain induction of the healing process without fibrosis, are fully encysted and, except for the one with fine porous polyamide, are not incorporated into adjacent tissues. The latex biomembrane, with or without polyamide, is not recommended as a separate material for preperitoneal inguinoplasty.OBJETIVO: Avaliar aspectos morfológicos do comportamento de 4 tipos de biomembranas de latex, colocadas pré-peritonealmente em cães, por inguinoplastia videolaparoscópica. MÉTODOS: Dezesseis inguinoplastias em 12 cães: grupo 1, com biomembrana de latex impermeável inguinal direita em quatro cães e prótese de prolene, como controle, contra-lateral; grupos 2, 3 e 4, com biomembrana de latex respectivamente de poliamida impermeável, poliamida porosa com 1mm de espessura e poliamida porosa com 0,5mm de
Institute of Scientific and Technical Information of China (English)
Wen-jiao Ji; Yi-ming Jiang; Bo-tian Li; Wei Deng; Cheng-you Kan
2012-01-01
Soap-free hydrophilic-hydrophobic core-shell latex particles with high carboxyl content in the core of the particles were synthesized via the seeded emulsion polymerization using methyl methacrylate (MMA),butyl acrylate (BA),methacrylic acid (MAA),styrene (St) and ethylene glycol dimethacrylate (EGDMA) as monomers,and the influences of MMA content used in the core preparation on polymerization,particle size and morphology were investigated by transmission electron microscopy,dynamic light scattering and conductometric titration.The results showed that the seeded emulsion polymerization could be carried out smoothly using "starved monomer feeding process" when MAA content in the core preparation was equal to or less than 24 wt%,and the encapsulating efficiency of the hydrophilic P(MMA-BA-MAA-EGDMA) core with the hydrophobic PSt shell decreased with the increase in MAA content.When an interlayer of P(MMA-MAA-St) with moderate polarity was inserted between the P(MMA-BA-MAA-EGDMA) core and the PSt shell,well designed soap-free hydrophilic-hydrophobic core-shell latex particles with 24 wt% MAA content in the core preparation were obtained.
Kand'ár, Roman; Záková, Pavla; Jirosová, Jana; Sladká, Michaela
2009-01-01
The determination of branched chain amino acids [BCAA; valine (Val), leucine (Leu), isoleucine (Ile)], alpha-keto acids derived from BCAA [BCKA; alpha-ketoisovaleric acid (KIV), alpha-ketoisocaproic acid (KIC), alpha-ketomethylvaleric acid (KMV)], methionine (Met), phenylalanine (Phe) and tyrosine (Tyr) is currently the most reliable approach for the diagnosis of maple syrup urine disease (MSUD), hypermethioninemia, phenylketonuria (PKU) and tyrosinemia. The aim of this study was to develop rapid and simple HPLC methods for measurement of BCAA, Met, Phe, Tyr and BCKA in plasma and dried blood samples. Samples of peripheral venous blood with EDTA as anticoagulant were obtained from a group of healthy blood donors (n=70, 35 females, 27-41 years of age and 35 males, 28-43 years of age). Blood-spot samples from a group of newborns (n=80, 40 girls and 40 boys 3-5 days of age) were collected onto #903 Specimen Collection Paper and allowed to dry for at least 24 h before analysis. Prior to separation, the amino acids (AA) were derivatized with o-phthaldialdehyde (OPA) and BCKA with o-phenylenediamine (OPD). Reverse phase column chromatography (LiChroCart 125-4 Purospher RP-18e, 5 microm) was used for separation and fluorescence detection used to monitoring of effluent. For AA analysis, 25 mmol/L sodium hydrogenphosphate-methanol (90:10, v/v), pH 6.5+/-0.1 was used as mobile phase A and 100% methanol was used as mobile phase B. Measurement of BCKA used a mixture of methanol and deionized water (55:45, v/v) as mobile phase A and mobile phase B consisted of 100% methanol. Analytical performance of these methods was satisfactory for the determination of all AA and BCKA. The intra-assay and inter-assay coefficients of variation were below 10% and recovery ranged from 90%-110%. We have developed simple, rapid and selective HPLC methods with fluorescence detection for the determination of BCAA, Met, Phe, Tyr and BCKA in plasma and dried blood samples.
Polybutadiene latex particle size distribution analysis utilizing a disk centrifuge
Verdurmen, E.M.F.J.; Albers, J.G.; German, A.L.
1994-01-01
Polybutadiene (I) latexes prepd. by emulsifier-free emulsion polymn. and having particle diam. 50-300 nm for both unimodal and bimodal particles size distributions were analyzed by the line-start (LIST) method in a Brookhaven disk centrifuge photosedimentometer. A special spin fluid was designed to
Drying kinetics and quality aspects during heat pump drying of onion (Allium cepa L.
Directory of Open Access Journals (Sweden)
Nihar Ranjan Sahoo
2012-10-01
Full Text Available Normal 0 false false false MicrosoftInternetExplorer4 A prototype heat pump dryer has been developed for drying of fruits and vegetables at low temperature and relative humidity to maintain the quality of dried product. Onions, of Nasik red variety were peeled, trimmed and sliced to 2 mm thickness. The onion slices were dried in the heat pump dryer at 35ºC (32 % R.H., 40ºC (26 % R.H., 45ºC (19 % R.H. and 50ºC (15 % R.H.. Samples were also dried in a hot air dryer at 50ºC (52 % R.H. for comparison. The drying rate increased with increase in drying air temperature, associated with reduced R.H., in the heat pump dryer. Drying took place mainly under the falling rate period. The Page equation, resulting in a higher coefficient of determination and lower root mean square error, better described the thin-layer drying of onion slices than the Henderson and Pabis equation. Heat pump drying took less drying time of 360 min and yielded better quality dried product, with higher retention of ascorbic acid and pyruvic acid and lower colour change, as compared to a hot air dryer at the same drying air temperature of 50ºC.
Galanti, L M; Cornu, C; Masson, P L; Robert, A R; Becheanu, D; Lamy, M E; Cambiaso, C L
1991-05-01
An assay of anti-HBs antibodies based on agglutination of latex particles coated with recombinant HBs-antigen was compared with Abbott radioimmunoassay (Abbott-RIA), which uses a human plasma-derived antigen. The population examined consisted of 76 Abbott-RIA anti-HBs-negative prevaccinated subjects and 1044 serum samples anti-HBs found positive by Abbott-RIA, including 283 samples of subjects vaccinated either with a human plasma-derived vaccine (group A; n = 180) or with a recombinant vaccine (group B; n = 103). Correlation coefficients between the two techniques were respectively r = 0.89 for the whole population (n = 1044), r = 0.98 in group A and r = 0.74 in group B. Anti-HBs titres were higher with latex than with RIA in group B as shown by the regression slopes: latex = 508 + 1.11 RIA in group A and latex = -1138 + 3.97 RIA in group B, suggesting that some vaccinated subjects from group B produced antibodies against epitopes proper to the recombinant antigen. In the prevaccinated population and in group A, the latex results were compared with those of radioimmunoassays (Abbott, Sorin) and enzyme immunoassays (Behring, Roche, Pasteur). Only the Roche-EIA detected anti-HBs in the prevaccinated subjects. The correlation between the various immunoassays was r greater than 0.96 only for values higher than 100 IU/l.
Fombong, Forkwa Tengweh; Van Der Borght, Mik; Vanden Broeck, Jozef
2017-09-16
The longhorn grasshopper, Ruspolia differens (Serville), plays an important role as a food source across Sub-Saharan Africa, where it is consumed as a delicacy in both rural and urban areas. The effect of two drying methods (freeze-drying and oven-drying), employed after blanching, on the proximate, fatty acid and mineral composition of the two most common morphs was determined. Ruspolia differens grasshoppers were harvested in Uganda and Kenya from wild swarms during the rainy periods of November-December 2016. Based on cuticular coloration, we identified three morphs, green, brown and purple, which occurred at a ratio of 65:33:2, respectively. Results indicated that these insects have a high lipid content of 36%, as well as significant protein levels ranging between 33% and 46% dry matter. Oleic acid (44%) and palmitic acid (28%) were the two most abundant fatty acids; while the presence of arachidonic acid (0.6%) and docosahexaenoic acid (0.21%) suggests that Ruspolia differens is also a source of polyunsaturated fatty acids. The observed amino acid profile showed similar trends in all morphs, and all essential amino acids were present. Calcium (896-1035 mg/100 g), potassium (779-816 mg/100 g) and phosphorus (652-685 mg/100 g) were quite high among the minerals. The presence of the trace elements iron (217-220 mg/100 g), zinc (14.2-14.6 mg/100 g), manganese (7.4-8.3 mg/100 g) and copper (1.66 mg/100 g) suggests that inclusion of these grasshoppers in human diets may aid in combatting micronutrient deficiencies. Oven-drying Ruspolia differens delivered the same nutritional quality as freeze-drying. Hence, both drying approaches can be adequately used to formulate insect-based food products without noticeable nutritional changes.
Directory of Open Access Journals (Sweden)
Forkwa Tengweh Fombong
2017-09-01
Full Text Available The longhorn grasshopper, Ruspolia differens (Serville, plays an important role as a food source across Sub-Saharan Africa, where it is consumed as a delicacy in both rural and urban areas. The effect of two drying methods (freeze-drying and oven-drying, employed after blanching, on the proximate, fatty acid and mineral composition of the two most common morphs was determined. Ruspolia differens grasshoppers were harvested in Uganda and Kenya from wild swarms during the rainy periods of November–December 2016. Based on cuticular coloration, we identified three morphs, green, brown and purple, which occurred at a ratio of 65:33:2, respectively. Results indicated that these insects have a high lipid content of 36%, as well as significant protein levels ranging between 33% and 46% dry matter. Oleic acid (44% and palmitic acid (28% were the two most abundant fatty acids; while the presence of arachidonic acid (0.6% and docosahexaenoic acid (0.21% suggests that Ruspolia differens is also a source of polyunsaturated fatty acids. The observed amino acid profile showed similar trends in all morphs, and all essential amino acids were present. Calcium (896–1035 mg/100 g, potassium (779–816 mg/100 g and phosphorus (652–685 mg/100 g were quite high among the minerals. The presence of the trace elements iron (217–220 mg/100 g, zinc (14.2–14.6 mg/100 g, manganese (7.4–8.3 mg/100 g and copper (1.66 mg/100 g suggests that inclusion of these grasshoppers in human diets may aid in combatting micronutrient deficiencies. Oven-drying Ruspolia differens delivered the same nutritional quality as freeze-drying. Hence, both drying approaches can be adequately used to formulate insect-based food products without noticeable nutritional changes.
Clonal stability of latex yield in eleven clones of Hevea brasiliensis Muell. Arg.
Directory of Open Access Journals (Sweden)
K.O. Omokhafe
2003-01-01
Full Text Available Eleven Hevea brasiliensis clones were evaluated for clonal stability of latex yield. A randomized complete block design was used with four replicates, two locations, seven years and three periods per year. Stability analysis was based on clone x year and clone x year x location interactions. Five stability parameters viz environmental variance, shukla's stability variance, regression of clonal latex yield on environmental index, variance due to regression and variance due to deviation from regression were applied. There was significant clone x environment effect at the two levels of interaction. Among the eleven clones, C 162 was outstanding for clonal stability and it can serve as donor parent for stability alleles. Three clones (C 76, C 150 and C 154 were also stable. The four stable clones (C 76, C 150, C 154 and C 162 are suitable for broad-spectrum recommendation for latex yield. Five clones (C 83, C 143, C 163, C 202 and RRIM 600 will require environment-specific recommendation because of their unstable phenotype. The stability feature of two clones (C 145 and C 159 was not clear and this will be investigated in subsequent studies.
Safety Evaluation Test on Human for Radiation Pre vulcanised Natural Rubber Latex (RVNRL)
International Nuclear Information System (INIS)
Pairu Ibrahim; Wan Manshol Wan Zain; Chai, Chee Keong; Sofian Ibrahim; Saadiah Sulaiman; Sharifah Ismail
2010-01-01
This paper discussed about clinical test conducted to determine safety evaluations on human for latex examination gloves and latex films made from Radiation Vulcanized Natural Rubber Latex (RVNRL). Two types of test were being adopted which are i) Modified Draize-95 test and ii) Patch Test on Sensitized Individuals. Modified Draize-95 test was conducted on 200 non-sensitized human subjects and Patch Test on Sensitized Individuals was conducted on 25 individuals who are allergic to the defined major chemical sensitizer presents in natural rubber product. It was found that Modified Draize-95 test has prove that there is no clinical evidence on the presence of residual chemical additives at the level that may induce Type IV allergy in the un sensitized general user population in the RVNRL gloves. Meanwhile Patch Test on Sensitized Individuals has proved that the patch test conducted using the test article on 25 individuals who are allergic to the defined major chemical sensitizers present in natural rubber products, thiuram, carbamates or thiazoles produced a negative response, meeting the pre requirement for the claim of reduced reaction-inducing potential. (author)
Trial Production of Surgical Gloves from Irradiated Natural Rubber Latex on Factory Scale
Directory of Open Access Journals (Sweden)
M. Utama
2005-07-01
Full Text Available Trial production of surgical gloves from irradiated natural rubber latex at the PT. Laxindo Utama Serang Banten glove factory has been carried out. The variation of heating temperature and leaching time during processing were evaluated. The physical and mechanical properties and the protein allergen respond of surgical gloves using ELISA method were measured. The results showed that the physical and mechanical of surgical gloves such as tensile strength, modulus, and elongation at break arefound to meet the requirements of the ISO or SNI standard for surgical gloves. While the allergic response through clinical tested latex-sensitive protein allergen known as ELISA test is found to be negative.
Al-Niaimi, F; Chiang, Y Z; Chiang, Y N; Williams, J
2013-01-01
Healthcare workers and patients are often exposed to natural rubber latex (NRL) through contact with gloves and various healthcare products, which can potentially cause allergic reactions, with varying degrees of severity. In 2008, the Royal College of Physicians published their first evidence-based guidance on occupational health interventions for latex allergy, which emphasized the importance of healthcare workers having knowledge of latex allergy. This study aimed to survey the knowledge of healthcare workers (n = 156) about latex gloves and NRL allergy, routine prevention practice and the appropriate use of gloves in patient care. Healthcare workers in a large teaching hospital were surveyed using a standard questionnaire. We found that only 1% of healthcare workers were able to correctly match the appropriate gloves to the specifically designed procedure. More than half (n = 74.53%) were unable to recognize the presentation of type 1 allergy to NRL. Of the 156 participants, 131 (84%) considered that they would benefit from training about NRL allergy and the use of different types of gloves in clinical care. This survey indicates the importance of education regarding appropriate use of gloves and prevention of NRL allergy among healthcare workers, and dermatologists should play an important role in facilitating this. © The Author(s). CED © 2012 British Association of Dermatologists.
Negim, El-Sayed; Kozhamzharova, Latipa; Gulzhakhan, Yeligbayeva; Khatib, Jamal; Bekbayeva, Lyazzat; Williams, Craig
2014-01-01
This paper investigates the physicomechanical properties of mortar containing high volume of fly ash (FA) as partial replacement of cement in presence of copolymer latexes. Portland cement (PC) was partially replaced with 0, 10, 20, 30 50, and 60% FA. Copolymer latexes were used based on 2-hydroxyethyl acrylate (2-HEA) and 2-hydroxymethylacrylate (2-HEMA). Testing included workability, setting time, absorption, chemically combined water content, compressive strength, and scanning electron microscopy (SEM). The addition of FA to mortar as replacement of PC affected the physicomechanical properties of mortar. As the content of FA in the concrete increased, the setting times (initial and final) were elongated. The results obtained at 28 days of curing indicate that the maximum properties of mortar occur at around 30% FA. Beyond 30% FA the properties of mortar reduce and at 60% FA the properties of mortar are lower than those of the reference mortar without FA. However, the addition of polymer latexes into mortar containing FA improved most of the physicomechanical properties of mortar at all curing times. Compressive strength, combined water, and workability of mortar containing FA premixed with latexes are higher than those of mortar containing FA without latexes.
Saleh, Amir M; Abdalla, Hamid S; Satti, Abdelsalam B; Babiker, Suad M; Gasim, Gasim I; Adam, Ishag
2014-03-06
Trichomoniasis is the most common sexually transmitted disease. However, limited data are available on an effective technique for the diagnosis of Trichomonas vaginalis. A cross-sectional study was conducted to evaluate the accuracy of wet mount microscopy, latex agglutination, Diamond's media, and polymerase chain reaction (PCR) for detection of T. vaginalis among symptomatic women who attended the gynecological clinic at Khartoum, Sudan. Of the 297 women studied, 252 (84.8%) were positive for T. vaginalis by wet mount microscopy, 257 (86.5%) by latex agglutination, 253 (85.2%) by Diamond's media, and 253 (85.2%) by PCR. The sensitivity and specificity of wet mount microscopy were 99.2% and 97.7%, respectively, compared with PCR. The sensitivity and specificity of latex agglutination and Diamond's media were 99.6% and 88.6%, and 100.0% and 86.4%, respectively, compared with PCR. In this study, wet mount microscopy, latex agglutination, and Diamond's media were found to be highly sensitive and specific. However, the availability and cost effectiveness might limit the use of Diamond's media and PCR in routine practice. The virtual slide(s) for this article can be found here: http://www.diagnosticpathology.diagnomx.eu/vs/7859723851211496.
Directory of Open Access Journals (Sweden)
Bakhshali Massoumi
2013-06-01
Full Text Available Poly (vinylacetate-co-butylmethacrylate was prepared in presence of potassium persulphate as an oxidizing agent in aqueous solution of dodecylbenzene sulfonate sodium as an emulsifying agent. Then, aniline was polymerized by chemical oxidation method at three different concentrations of aniline monomer (0.1, 0.2 and 0.3 M in toluene in presence of poly(vinylacetate-co-butylmethacrylate in order to obtain polyaniline/poly(vinylacetate-co-butylmethacrylate. To prepare conducting-latex of polyanisidine/poly(vinylacetate-co-butylmethacrylate the same method was employed as above for aniline monomer in obtaining conducting polyaniline/poly(vinylacetate-co-butylmethacrylate latex. In addition, the purification of conducting-latex polymers, polyaniline/poly(vinylacetate-co-butylmethacrylate and polyanisidine/poly(vinylacetate-co-butylmethacrylate was conducted and preparation of tin layer films of conducting-latex polymers was carried out by casting method on glassy lames. The electroactivity properties of the prepared latex-polymers, polyaniline/poly(vinylacetate-co-butylmethacrylate and polyanisidine/poly(vinylacetate-co-butylmethacrylate were investigated by cyclic voltammetery (CV. The voltamogrames showed that the latex films were electroactive. Because of conductivity and electroactivity, the obtained films may find applications in anti-corrosion coatings. The anti-corrosion properties of conducting-latex polymers were studied on aluminum surface by impedance technique. The structure of the prepared conducting-latex polymers was confirmed by Fourier transform infrared (FTIR. Finally, the electrical conductivity of synthesized conducting-latex polymers, polyaniline/poly(vinylacetate-co-butylmethacrylate and polyanisidine/poly(vinylacetate-co-butylmethacrylate was measured by four probe technique.
DEFF Research Database (Denmark)
Jiménez-Martín, Estefanía; Gharsallaoui, Adem; Pérez-Palacios, Trinidad
2015-01-01
Microencapsulation of ω-3 fatty acids by spray drying was studied using both monolayered (lecithin) and multilayered (lecithin-chitosan) fish oil emulsions with maltodextrin as wall material. Stability of the multilayered emulsions was higher than the monolayered ones, and increased...... with the highest concentration of chitosan (1 % w/w), being related with lower detection of TBARS at high storage temperatures. Overall, this study shows the suitability of microencapsulating ω-3 fatty acids by spray drying using both monolayered and multilayered fish oil emulsions with maltodextrin as wall...... material. Multilayered microcapsules prepared with lecithin-chitosan emulsions provide a great protective effect against lipid oxidation of fish oil during storage at moderate to high temperatures (30 °C and 60 °C). These multilayered microcapsules could be therefore successfully used as a fish oil...
Energy Technology Data Exchange (ETDEWEB)
Jesus, M.C. de; Dominguez, R.; Cantalapiedra, J.; Iglesias, A.; Lorenzo, J.M.
2016-07-01
The effect of including chestnuts in the formulation of the feed (0, 15 and 25% chestnut) on the fatty acids of dry-cured lacon from Celta pigs was studied. The inclusion of chestnuts decreases the saturated fatty acid content (SFA) and the monounsaturated fatty acid content (MUFA). With regards to the polyunsaturated fatty acids (PUFA), the lacon from animals fed with chestnuts presented higher values of total PUFA, n6 PUFAs and n3 PUFAs. This is related to the fact that chestnut diets had the highest amounts of essential fatty acids (C18:2n6 and C18:3n3), therefore the lacon from chestnut-fed animals also presented higher amounts of these fatty acids. According to nutritional ratios, lacon obtained from chestnut-fed pigs was healthier than the one obtained from pigs fed on commercial feed. The main conclusion is that including chestnuts in the diet allows us to obtain healthier dry-cured meat products. (Author)
Heterofermentative process in dry fermented sausages - a case report
Directory of Open Access Journals (Sweden)
Josef Kameník
2013-01-01
Full Text Available In certain circumstances the fermentation process in dry fermented sausages converts to heterofermentation pathway leading to acetic acid and carbon dioxide beside lactic acid. The study describes two cases of undesirable heterofermentation in dry sausages from two different producers. In the sausage samples (n = 7 the pH value and the content of lactic and acetic acids were measured. Microbial analysis focused on quantitative and qualitative detection of lactic acid bacteria. The acetic acid content varied from 24.28 to 67.41 µmol·g-1 dry matter, in the case of samples from the second producer the content of acetic acid (48.45 to 67.41 µmol·g-1 dry matter was higher than the lactic acid content (20.98 to 29.02 µmol·g-1 dry matter. The lactobacilli strains from the sausages were assigned to the corresponding species by Matrix-Assisted Laser Desorption-Ionization – Time of Flight Mass Spectrometry (MALDI-TOF MS and classified to three groups according to the sugar fermentation pattern (obligately homofermentative, facultatively heterofermentative and obligately heterofermentative and they caused the heterofermentation process in the samples of dry fermented sausages. The description of the case of heterofermentation process in dry sausages is unique and there is little information about this topic.
Directory of Open Access Journals (Sweden)
Maria Iorizzi
2008-06-01
Full Text Available Dragon’s blood (Sangre de drago, a viscous red sap derived from Croton lechleri Muell-Arg (Euphorbiaceae, is extensively used by indigenous cultures of the Amazonian basin for its wound healing properties. The aim of this study was to identify the minor secondary metabolites and test the antioxidant activity of this sustance. A bioguided fractionation of the n-hexane, chloroform, n-butanol, and aqueous extracts led to the isolation of 15 compounds: three megastigmanes, four flavan-3-ols, three phenylpropanoids, three lignans, a clerodane, and the alkaloid taspine. In addition to these known molecules, six compounds were isolated and identified for the first time in the latex: blumenol B, blumenol C, 4,5-dihydroblumenol A, erythro-guaiacyl-glyceryl-β-O-4’- dihydroconiferyl ether, 2-[4-(3-hydroxypropyl-2-methoxyphenoxy]-propane-1,3-diol and floribundic acid glucoside. Combinations of spectroscopic methods (1H-, 13C- NMR and 2D-NMR experiments, ESI-MS, and literature comparisons were used for compound identification. In vitro antioxidant activities were assessed by DPPH, total antioxidant capacity and lipid peroxidation assays. Flavan-3-ols derivatives (as major phenolic compounds in the latex exhibited the highest antioxidant activity.
Energy Technology Data Exchange (ETDEWEB)
Leveque, P; Puig, J R; Roudeix, H [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1968-07-01
After briefly reviewing the main research carried out on the radio-vulcanization of latex and elastomers, a description is given of 4 types of cell which have been used successively with a view to industrial irradiation. They have made it possible to acquire the information necessary for resolving the main problem arising during irradiation - the formation of coagulum. The first two cell are designed for irradiation by a horizontal beam ('Dynamitron'), the two others use a vertical beam ('Circe'). The study of the properties of the rubber obtained shows it to compare favorably with 'Revultex'. In the appendix are given some characteristics of natural latex and information about its processing. (authors) [French] Apres un rappel des principales etudes sur la radio-vulcanisation du latex et des elastomeres, on decrit les quatre types de cellules successivement essayes en vue de l'irradiation industrielle. Ils ont permis d'acquerir les informations necessaires a la resolution du probleme principal pose par l'irradiation, la formation de coagulum au cours de celle,-ci. Les deux premiers sont concus pour l'irradiation par un faisceau horizontal ('Dynamitron'), les derniers par un faisceau vertical ('Circe'). L'etude des proprietes du caoutchouc obtenu montre qu'il se compare favorablement au 'Revultex'. Un apercu est donne en annexe des caracteristiques du latex naturel et de sa mise en oeuvre. (auteurs)
Synthesis and characterization of novel fluoroalkyl-terminated hyperbranched polyurethane latex
Xu, Wei; Zhao, Weijia; Hao, Lifen; Wang, Sha; Pei, Mengmeng; Wang, Xuechuan
2018-04-01
Waterborne polyurethane (PU) emulsions are widely used in various fields and the demand for them is ever-increasing over the years. However, the hydrophilic chain extender inevitably bonded into the PU backbone can affect the water tolerance of PU. Thus, it is of great importance to improve PU water resistance effectively. Herein, novel fluoroalkyl-terminated hyperbranched polyurethane (HBPUF) latex was accordingly synthesized by graft reaction of perfluorohexyl ethyl alcohol and hyperbranched polyurethane (HBPU), which was previously obtained from interaction between hydroxyl-terminated hyperbranched polymer and PU prepolymer manufactured via the acetone process, as well as using neutralization, adding water, and high-speed stirring operations. We characterized the resultants and investigated its surface properties by IR, NMR, TEM, XRD, TGA, DSC, FE-SEM, AFM, XPS, and contact angle measurements, etc. IR and NMR tests confirmed that the fluorinated fragments had been grafted onto the tail end of HBPU. TEM, XRD, DSC, and FE-SEM results all accounted for the fact that there were multi-crystals in PU, HBPU and HBPUF. TGA results showed that thermal stabilities of the PU, HBPU, and HBPUF latex films were enhanced in turn. XPS and AFM analyses demonstrated that the fluorine-containing segments from the HBPUF terminals were prone to migrate and enrich on the film-air surface of the HBPUF latex film, which made water contact angle and water absorption of the HBPUF film be as 113.9° and 11.1%, respectively, compared to those of the PU film (77.8° and 136.2%). This research indicates that water resistance of the PU film can be efficiently enhanced by fluorinated polyurethane with novel fluoroalkyl-terminated hyperbranched structure.
n-3 Fatty Acid Supplementation for the Treatment of Dry Eye Disease.
Asbell, Penny A; Maguire, Maureen G; Pistilli, Maxwell; Ying, Gui-shuang; Szczotka-Flynn, Loretta B; Hardten, David R; Lin, Meng C; Shtein, Roni M
2018-05-03
Dry eye disease is a common chronic condition that is characterized by ocular discomfort and visual disturbances that decrease quality of life. Many clinicians recommend the use of supplements of n-3 fatty acids (often called omega-3 fatty acids) to relieve symptoms. In a multicenter, double-blind clinical trial, we randomly assigned patients with moderate-to-severe dry eye disease to receive a daily oral dose of 3000 mg of fish-derived n-3 eicosapentaenoic and docosahexaenoic acids (active supplement group) or an olive oil placebo (placebo group). The primary outcome was the mean change from baseline in the score on the Ocular Surface Disease Index (OSDI; scores range from 0 to 100, with higher scores indicating greater symptom severity), which was based on the mean of scores obtained at 6 and 12 months. Secondary outcomes included mean changes per eye in the conjunctival staining score (ranging from 0 to 6) and the corneal staining score (ranging from 0 to 15), with higher scores indicating more severe damage to the ocular surface, as well as mean changes in the tear break-up time (seconds between a blink and gaps in the tear film) and the result on Schirmer's test (length of wetting of paper strips placed on the lower eyelid), with lower values indicating more severe signs. A total of 349 patients were assigned to the active supplement group and 186 to the placebo group; the primary analysis included 329 and 170 patients, respectively. The mean change in the OSDI score was not significantly different between the active supplement group and the placebo group (-13.9 points and -12.5 points, respectively; mean difference in change after imputation of missing data, -1.9 points; 95% confidence interval [CI], -5.0 to 1.1; P=0.21). This result was consistent across prespecified subgroups. There were no significant differences between the active supplement group and the placebo group in mean changes from baseline in the conjunctival staining score (mean difference in
International Nuclear Information System (INIS)
Pairu Ibrahim; Wan Manshol Wan Zain; Keong, C.C.; Mohd Noorwadi Mat Lazim
2011-01-01
Radiation vulcanization of natural rubber latex has great potential for the production of nuclear power plant gloves due to its low ash and mineral content. And this is in-line with the role played by Malaysian Nuclear Agency as Technical Supporting Organization for Nuclear Power Program. This paper discussed the evaluation done to determine ash content in RVNRL and SVNRL films. Both samples were prepared using casting technique and the properties were compared. Films prepared from raw latex without any vulcanizing agent were regarded as a control. (author)
Study on grafting of monomer onto natural rubber latex by radiation technique
International Nuclear Information System (INIS)
Nguyen Tan Man; Le Hai; Tran Thi Tam; Le Huu Tu, Pham Thi Sam; Dao Minh Phuong; Ha Thuc Huy
2004-01-01
Radiation vulcanization of natural rubber latex has been extensively developed through programmers assisted by the IAEA and UNDP under RCA in Asia and Pacific Region. R-D has been done in most of the Member States with technical assistance from Japan's Takasaki Radiation Chemistry Establishment. Radiation vulcanized natural rubber latex (RVNRL) has many advantages over the conventional sulfur vulcanized latex, such as absence of nitrosamine and low cytotoxicity. Radiation crosslinking is a room temperature process, itself an important cost advantage, it is easily controlled and desired extend of crosslinking is easily achieved by controlling the dose (irradiation time). Disadvantages of RVNRL to be improved are poor physical properties of film such as low tensile strength and tear strength. The research groups of Japan, Thailand and Indonesia concentrated on the improvement of physical properties of RVNRL using radiation grafted PMMA as additive [2]. F. Sundardi and W. Sofiarti have reported that tensile strength and hardness increased by radiation grafting of styrene onto NR [5]. Ono et al have reported the grafting of MMA onto NR by gamma irradiation at a dose of 5 kGy for producing thermoplastic elastomers [4]. The objective of this project is to report the results of studies of radiation graft-copolymerization of methyl methacrylate (MMA) or styrene (St) onto natural rubber latex in order to improve their physico-mechanical properties and evaluation of grafted material using Small-Angle Neutron Scattering through FNCA Project. The grafting degree of MMA and St onto NR increased with the increase of irradiation dose and monomer concentration. The alteration of grafted products structure was determined by IR method. Tensile strength, Shore A hardness, 100% modulus of grafted products increased with the increase of monomer concentration and irradiation dose while elongation at break decreased. The grafted products were characterized by Transmission Electron
Directory of Open Access Journals (Sweden)
El-Sayed Negim
2014-01-01
Full Text Available This paper investigates the physicomechanical properties of mortar containing high volume of fly ash (FA as partial replacement of cement in presence of copolymer latexes. Portland cement (PC was partially replaced with 0, 10, 20, 30 50, and 60% FA. Copolymer latexes were used based on 2-hydroxyethyl acrylate (2-HEA and 2-hydroxymethylacrylate (2-HEMA. Testing included workability, setting time, absorption, chemically combined water content, compressive strength, and scanning electron microscopy (SEM. The addition of FA to mortar as replacement of PC affected the physicomechanical properties of mortar. As the content of FA in the concrete increased, the setting times (initial and final were elongated. The results obtained at 28 days of curing indicate that the maximum properties of mortar occur at around 30% FA. Beyond 30% FA the properties of mortar reduce and at 60% FA the properties of mortar are lower than those of the reference mortar without FA. However, the addition of polymer latexes into mortar containing FA improved most of the physicomechanical properties of mortar at all curing times. Compressive strength, combined water, and workability of mortar containing FA premixed with latexes are higher than those of mortar containing FA without latexes.
Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.
Liggieri, Constanza; Obregon, Walter; Trejo, Sebastian; Priolo, Nora
2009-02-01
Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain c-II) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain c-II was the minor proteolytic component in the latex, but showed higher specific activity than asclepain c-I, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain c-II displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain c-II is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The Nterminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-alpha-CBZ-L-Gln-p-nitrophenyl ester as substrate: K(m)=0.1634 mM, k(cat)=121.48 s(-1), and k(cat)/K(m)=7.4 x 10(5) s(-1)/mM.
Energy Technology Data Exchange (ETDEWEB)
Leal, Ana Paula Pinho Rodrigues; Barros, Glaucione Gomes de [Brasilia Univ., DF (Brazil). Inst. de Quimica; Guedes, Selma M.L. [Instituto de Pesquisa em Energia Nuclear, Sao Paulo, SP (Brazil)
1999-07-01
Vulcanization of natural rubber latex by ionization radiation produces the crosslink in disperse latex particles. Advantages over conventional process of vulcanization are: the absence of carcinogenic nitrosamines, low cytotoxicity and better degradation at room conditions, due to mainly to the absence of sulfur, zinc oxide and dithiocarbamates. Thermogravimetric analysis (TG) is the measurement of the weight change of a material as a function of temperature and time. TG data different heat speed provide an alternative model of the kinetics of degradation of polymeric materials. The kinetic studies of this material showed a single degradation process at least for 76,5% of mass loss. The activation energy was 49 Kcal/mol. For higher mass loss (85%) the degradation was characterized by associate mechanism. (author)
Directory of Open Access Journals (Sweden)
Nykyforchyn, H.M.
2016-01-01
Full Text Available The recipes of rapid-hardening bitumen-latex emulsions and coatings on its base are created, in-laboratory tests of their physical, chemical and anticorrosive properties are carried out. The technology of anticorrosive protection and the installation technical documentation for making of aqueous bitumen-latex emulsion is developed, installation is mounted and a pilot lot of rapid-hardening emulsion is produced. Experimental-industrial approbation of the technology of coating formation on pipes in oil and gas industry is carried out.
Isolation of natural inhibitors of papain obtained from Carica papaya latex
Directory of Open Access Journals (Sweden)
Rubens Monti
2004-09-01
Full Text Available Studies were carried out to natural papain inhibitor from papaya latex. Fresh latex from green fruits of Carica papaya was collected and immediately transported in ice bath to the lab, from which three fractions with inhibitor effect of esterase papain activity were isolated by latex dialysis, Sephadex G-25 gel filtration and ionic exchange chromatography in SP-Sephadex C-25. The isolated fractions, identified as inhibitors I and II, showed a negative reaction with ninhydrin; however, the fraction identified as P-III showed positive reaction with ninhydrin. Kinetics data showed non-competitive inhibition (inhibitor I and uncompetitive (inhibitors II and P-III.Este trabalho apresenta novos dados sobre inibidores naturais de papaína. O látex fresco de frutos verdes de Carica papaya foi coletado pela manhã em plantações da região de Araraquara, SP, Brasil e imediatamente transportado ao laboratório em banho de gelo. Três frações com efeito inibitório da atividade esterásica da papaína foram isoladas a partir do látex fresco, através de diálise, filtração em Sephadex G-25 e cromatografia em SP-Sephadex C-25. As frações isoladas identificadas como inibidores I e II, mostraram reação negativa à ninidrina; entretanto, a fração identificada como P-III mostrou reação positiva. Dados cinéticos revelaram inibição não-competitiva (inibidor I e incompetitiva (inibidores II e P-III.
Directory of Open Access Journals (Sweden)
Juferi Idris
2013-01-01
Full Text Available The effectiveness of dragon fruit foliage as a natural coagulant for treatment of concentrated latex effluent was investigated and compared with ferric sulfate, a chemical coagulant. Dragon fruit is a round and often red-colored fruit with scales-like texture and is native to south American countries which is also cultivated and heavily marketed in southeast Asian countries. Its foliage represents a part of its overall plant system. Latex effluent is one of the main byproduct from rubber processing factories in Malaysia. Three main parameters investigated were chemical oxygen demand (COD, suspended solids (SS, and turbidity of effluent. Coagulation experiments using jar test were performed with a flocculation system where the effects of latex effluent pH as well as coagulation dosage on coagulation effectiveness were examined. The highest recorded COD, SS, and turbidity removal percentages for foliage were observed for effluent pH 10 at 94.7, 88.9, and 99.7%, respectively. It is concluded that the foliage showed tremendous potential as a natural coagulant for water treatment purposes. The foliage could be used in the pretreatment stage of Malaysian latex effluent prior to secondary treatment.
International Nuclear Information System (INIS)
Anil Kumar, M R; Nagaswarupa, H P; Gurushantha, K; Pratapkumar, C; Prashantha, S C; Shashishekar, T R; Anantharaju, K S; Nagabhushana, H; Sharma, S C; Vidya, Y S; Daruka Prasad, B; Vivek Babu, C S; Vishnu Mahesh, K R
2015-01-01
MgO nanoparticles (MNPs) were prepared by a solution combustion route using banyan tree (BT) latex and glycine as fuels. The powder x-ray diffraction results indicate the formation of a single cubic phase and the crystallite size obtained from transmission electron microscopy was found to be ∼10–15 nm. Scanning electron microscopy result reveals spherical-shaped particles obtained with BT latex. However, in a chemical route, porous and agglomerated particles were obtained. The energy band gap of MNPs obtained using BT latex and a chemical route were found to be in the range 4.85–5.0 eV. Photoluminescence peaks observed at 473, 514, and 588 nm when excited at 433 nm, which were attributed to surface defects. The enhanced photocatalytic activities of spherical MgO were due to smaller crystallite size, higher surface defects, dye sensitization, and capability to reduce the electron–hole pair recombination. Further, green-synthesized MNPs exhibit superior antifungal activity against various plant pathogens. The present studies demonstrated a green engineering route for the synthesis of multifunctional MNPs using BT latex. (paper)
Physiological responses of Vetiver plant (Vetiver zizanioides to municipal waste leachate
Directory of Open Access Journals (Sweden)
Sasan Mohsenzadeh
2016-06-01
Full Text Available Vetiver plant is tolerant to acidity and temperature variations. Has rapid growth for biomass production and has high tolerance to organic and non-organic compounds in municipal waste leachate for example heavy metals. So this plant is good for landfill cultivation. In this study, physiological responses to municipal waste leachate were studied. Statistical design was a randomized complete block and each block treated with different concentrations of latex at levels of zero, 15, 30, 45 and 60 percent compared to the original latex waste. The leachate collected from the Shiraz landfill and brought into the greenhouse. The physiological characterization including leaf area, dry weight, chlorophyll, anthocyanin, proline, soluble sugars and total protein were measured. The result indicated that the dry weight, chlorophyll and anthocyanin decrease with increasing of latex concentration. The leaf area, leaf relative water, soluble sugars and total protein increased with increasing latex concentration. Proline concentration at 15 percent of leachate increased significantly compared to controls, whereas at higher concentrations decreased. According to the results, it is recommended that 45 percent of leachate in a landfill can be used to irrigate Vetiver. This is the maximum concentration of leachate that Vetiver plant can survive as green space. Primary filtration of leachate before using is recommended. If the aim is more growth or perfume application from root, less concentration of leachate is better.
International Nuclear Information System (INIS)
Sabharwal, S.; Chaudhari, C.V.; Bhardwaj, Y.K.; Majali, A.B.; Das, T.N.
1996-01-01
In order to understand the role of n-butyl acrylate (nBA) in radiation vulcanization of natural rubber latex, pulse radiolysis technique has been utilized to study the reactions of the transient species produced by reaction of OH . , e- aq and H . atoms with nBA in aqueous solutions. The results show that transients produced by reaction of e- aq with nBA alone are capable of propagating the polymerization reaction and enhance the vulcanization process. These results have been further confirmed by studying the effect of electron scavengers on the vulcanization behaviour of natural rubber latex in presence of nBA. (author). 3 refs., 3 figs
Effects of spray-drying on w/o/w multiple emulsions prepared from a stearic acid matrix
CSIR Research Space (South Africa)
Mlalila, N
2014-12-01
Full Text Available , 75, and 100 mg of stearic acid, 2% and 3% w/v polyvinyl alcohol, 5% w/v lactose, and 0.2% w/v chitosan. The emulsions were immediately spray-dried based on an optimized model of inlet temperature and pump rate, and characterized for optimized...
Effects of spray-drying on w/o/w multiple emulsions prepared from a stearic acid matrix
Directory of Open Access Journals (Sweden)
Mlalila N
2014-12-01
Full Text Available Nichrous Mlalila,1 Hulda Swai,2 Lonji Kalombo,2 Askwar Hilonga3 1School of Life Sciences and Bioengineering, Nelson Mandela African Institution of Science and Technology, Arusha, Tanzania; 2Materials Science and Manufacturing, Council for Scientific and Industrial Research, Pretoria, South Africa; 3Department of Materials Science and Engineering, Nelson Mandela African Institution of Science and Technology, Arusha, Tanzania Abstract: The goal of this study was to explore the effects of spray-drying on w/o/w double emulsions of methyltestosterone (MT loaded in a stearic acid matrix. MT-loaded nanoparticles were formulated by a water-in-oil-in-water emulsion technique using 50, 75, and 100 mg of stearic acid, 2% and 3% w/v polyvinyl alcohol, 5% w/v lactose, and 0.2% w/v chitosan. The emulsions were immediately spray-dried based on an optimized model of inlet temperature and pump rate, and characterized for optimized responses with regard to particle size, polydispersity index, and zeta potential, for both emulsion and powder samples. Dynamic light scattering analysis shown that the nanoparticles increased in size with increasing concentrations of polyvinyl alcohol and stearic acid. Scanning electron microscopy indicated that the MT-loaded nanoparticles were spherical in shape, had a smooth surface, and were in an amorphous state, which was confirmed by differential scanning calorimetry. These MT-loaded nanoparticles are a promising candidate carrier for the delivery of MT; however, further studies are needed in order to establish the stability of the system and the cargo release profile under normal conditions of use. Keywords: double emulsions, nanoparticles, pump rate, spray-drying, testosterone
Properties and Characterization of Kenaf-Filled Natural Rubber Latex Foam
Directory of Open Access Journals (Sweden)
Ahmad Fikri Abdul Karim
2015-12-01
Full Text Available Kenaf powder was incorporated with natural rubber latex (NRL compound and foamed to make natural rubber latex foam (NRLF by using a well known technique called the Dunlop method. Different loadings of kenaf powder were added to NRL compound and was foamed to make NRLF. The mechanical properties, density, compression, thermal, and micro-structural characterization of control NRLF and kenaf incorporated NRLF were studied. Increasing content of kenaf reduced the tensile strength, elongation at break, and compressive strength of a NRLF. Modulus at 100% elongation and density of the NRLF increased with an increase in filler loading. Higher kenaf loading indicated higher elasticity of kenaf-filled NRLF, but the recovery percentage of kenaf-filled NRLF decreased with increasing kenaf loading. From thermogravimetric analysis (TGA result, an increase in the amount of kenaf loading from 1 to 7 phr increased the thermal stability of kenaf-filled NRLF. Morphological and micro-structural characterization performed by using scanning electron microscopy (SEM showed that kenaf powder filled up the micro-sized pores in the open cell structure of kenaf-filled NRLF.
Li, Qiangqiang; Ma, Yunfeng; Du, Boying; Wang, Qi; Hu, Qiongqiong; Bian, Yushan
2018-02-01
In this study, continuous kitchen waste fermentation and anaerobic digestion experiments were conducted to analyze the gas production potential, and to study the correlation between gas production rate and volatile fatty acid (VFAs) and its component concentration. During the experiment, the total solid(TS) concentration of the reaction system was increased by adding the kitchen waste, analysis of kitchen waste dry fermentation process to start, run, imbalance and imbalance after recovery and the parameters in the process of realizing the change trend and influencing factors of dry fermentation process, pH and ammonia concentration.
texreg: Conversion of Statistical Model Output in R to LATEX and HTML Tables
Directory of Open Access Journals (Sweden)
Philip Leifeld
2013-11-01
Full Text Available A recurrent task in applied statistics is the (mostly manual preparation of model output for inclusion in LATEX, Microsoft Word, or HTML documents usually with more than one model presented in a single table along with several goodness-of-fit statistics. However, statistical models in R have diverse object structures and summary methods, which makes this process cumbersome. This article first develops a set of guidelines for converting statistical model output to LATEX and HTML tables, then assesses to what extent existing packages meet these requirements, and finally presents the texreg package as a solution that meets all of the criteria set out in the beginning. After providing various usage examples, a blueprint for writing custom model extensions is proposed.
Dry Mouth Treatment: Tips for Controlling Dry Mouth
... mouthwashes that contain alcohol because they can be drying. Stop all tobacco use if you smoke or ... also help your condition: Avoid sugary or acidic foods and drinks because they increase your risk of ...
Heitz, James W; Bader, Stephen O
2010-09-01
The prevalence of latex allergy is increasing in surgical patient populations. Avoidance of exposure to the allergen is essential to minimizing perioperative complications in patients suspected to be at risk. Natural rubber latex has historically been ubiquitous in medical devices containing rubber. In 1998, the Food and Drug Administration (FDA) began to require the labeling of medical devices made from natural rubber latex; since that time substantial progress has been made in identifying latex-free alternatives. However, the rubber stoppers commonly found in pharmaceutical vial closures are exempt from FDA labeling requirements. Examination of the clinical and basic science literature regarding pharmaceutical vial closures supports limiting the rubber stopper to a single needle puncture as a safer practice, with the caveat that no strategy exists for the complete elimination of risk as long as stoppers made from natural rubber latex are used in pharmaceutical vials intended for human use. Copyright © 2010 Elsevier Inc. All rights reserved.
Dynamics of ballistically injected latex particles in living human endothelial cells
Li, Y.; Vanapalli Veera, V.S.A.R.; Vanapalli, Srinivas; Duits, Michael H.G.
2009-01-01
We studied the dynamics of ballistically injected latex particles (BIP) inside endothelial cells, using video particle tracking to measure the mean squared displacement (MSD) as a function of lag time. The MSD shows a plateau at short times and a linear behavior at longer times, indicating that the
The criteria and the design of MINT's latex irradiator
International Nuclear Information System (INIS)
Razali Hamzah; Muhd Khairi Muhd Said; Muhd Ariff Hamzah; Wan Manshol Wan Zin; Wan Abd Hadi Wan Abu Bakar; Muhd Noor Muhd Yunus
1996-01-01
The demand for RVNRL is continually on the upsurge and the present irradiation technique at the present SINAGAMA plant is not sufficient and practical to meet the demand. A number of conceptual designs were evolved to design according to the requirements of cost-effective and highly efficient plant. The number of options are described. In 1994 MINT work with NUKEM to build an automatic continuous latex irradiation plant
Vetráková, Ľubica; Vykoukal, Vít; Heger, Dominik
2017-09-15
The concept of "pH memory" has been established in the literature for the correlation between the pH of a pre-lyophilization solution and the ionization state of freeze-dried powder (lyophile). In this paper, the concept of "pH memory" is explored for the system of an aqueous solution, a frozen solution, and a lyophile. Sodium and potassium phosphate buffers in the pH range of 5-9 were frozen and lyophilized with sulfonephthalein indicators as acidity probes, and their Hammett acidity functions were compared to the initial pH of the aqueous solution. The results show that the acidities of the lyophiles are somewhat changed compared to the initial pHs, but the acidities in the frozen state differ more substantially. The Hammett acidity functions of the frozen buffers were found to be markedly dissimilar from the initial pH, especially in the sodium phosphate frozen at 233K, where an increase in the initial pH led to a decrease in the Hammett acidity function of the frozen state at a certain pH range. The large acidification observed after freezing the sodium phosphate buffer was not detected in the lyophiles after the sample had been dried; the phenomenon is explained considering the formed crystals analyzed by X-ray powder diffraction. The results suggest that monitoring the final acidity of a lyophile is not sufficient to predict all the acidity changes throughout the whole lyophilization process. The importance of well-controlled freezing and lyophilization conditions follows from the results of the research. Copyright © 2017 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Angélica G. Couto
2012-11-01
Full Text Available The anti-inflammatory and antiallodynic effects of spray dried powders starting from leaves, stems, roots, the mixture of leaves and stems, as well as the whole plant aqueous solutions of Phyllanthus niruri L., Phyllanthaceae, were assessed. Gallic acid, used as chemical marker, was quantified by HPLC in the spray dried powders. Carrageenan-induced inflammatory and allodynic responses in the mouse paw were used as pharmacological models. Quantitative and qualitative differences among chemical composition of different herb parts were observed. The oral administration of leaves or leaves plus stems spray dried powders (100 mg/kg significantly inhibited the carrageenan-induced allodynic effect (42±5 and 54±3%, respectively. Additionally, the spray dried powders of leaves significantly reduced carrageenan-induced paw oedema (35±6%. The spray dried powders of roots, stems, or the mixture of leaves, stems and roots (100 mg/kg, p.o. did not exhibit antiallodynic or antioedematogenic effect in the same model. In conclusion, differences in the chemical composition of spray dried powders from P. niruri are reflected in their in vivo pharmacological actions. Despite of a direct relationship of anti-inflammatory and antiallodynic effects with the gallic acid content had been observed, especially in the spray dried powders of leaves, the use of spray dried powders of leaves plus stems showed to be more effective, suggesting a synergic effect between their constituents.
Directory of Open Access Journals (Sweden)
Angélica G. Couto
2013-02-01
Full Text Available The anti-inflammatory and antiallodynic effects of spray dried powders starting from leaves, stems, roots, the mixture of leaves and stems, as well as the whole plant aqueous solutions of Phyllanthus niruri L., Phyllanthaceae, were assessed. Gallic acid, used as chemical marker, was quantified by HPLC in the spray dried powders. Carrageenan-induced inflammatory and allodynic responses in the mouse paw were used as pharmacological models. Quantitative and qualitative differences among chemical composition of different herb parts were observed. The oral administration of leaves or leaves plus stems spray dried powders (100 mg/kg significantly inhibited the carrageenan-induced allodynic effect (42±5 and 54±3%, respectively. Additionally, the spray dried powders of leaves significantly reduced carrageenan-induced paw oedema (35±6%. The spray dried powders of roots, stems, or the mixture of leaves, stems and roots (100 mg/kg, p.o. did not exhibit antiallodynic or antioedematogenic effect in the same model. In conclusion, differences in the chemical composition of spray dried powders from P. niruri are reflected in their in vivo pharmacological actions. Despite of a direct relationship of anti-inflammatory and antiallodynic effects with the gallic acid content had been observed, especially in the spray dried powders of leaves, the use of spray dried powders of leaves plus stems showed to be more effective, suggesting a synergic effect between their constituents.
Directory of Open Access Journals (Sweden)
Ying-Ping Gai
2017-08-01
Full Text Available Biotic stresses are major constraints limiting the leaf quality and productivity of mulberry. MLX56 is a unique chitin-binding protein isolated from Shin-Ichinose (Morus alba latex that displays toxicity against lepidopteran caterpillars. In this study, the full-length cDNA encoding MLX56 was isolated from Husang 32 (M. multicaulis and designated HMLX56. Amino acid sequence analysis and protein modeling of three MLX56 proteins showed that they were highly conserved among Morus species. Tissue expression pattern analysis showed that the HMLX56 gene was strongly expressed in mulberry bark and leaves but only slightly expressed in fruits. In addition, analysis of GUS expression indicated that the promoter of HMLX56 showed higher transcriptional activity along the vascular strands, and its activity can be regulated by various environmental factors. Like the MLX56 protein from M. alba, the HMLX56 protein showed toxicity to Plutella xylostella. Moreover, when the HMLX56 gene was ectopically expressed in Arabidopsis, the transgenic plants showed enhanced resistance to aphids, the fungal pathogen Botrytis cinerea and the bacterial pathogen Pseudomonas syringae pv. tomato DC3000. Our data suggest that the HMLX56 protein has a lectin-like molecular structure consisting of two hevein-like chitin-binding domains which provide not only chitin-binding activities but also other mechanisms of defense. The information provided here improves our understanding of the potential functions and defense mechanisms of MLX56 proteins, enabling in-depth functional analysis of latex exudates and perhaps facilitating mulberry genetic improvement in the future.
Expression of VEGF and collagen using a latex biomembrane as bladder replacement in rabbits
Directory of Open Access Journals (Sweden)
André Luís Alonso Domingos
2012-08-01
Full Text Available OBJECTIVE: To investigate the VEGF expression and collagen deposition using a latex biomembrane as bladder replacement in rabbits. MATERIALS AND METHODS: After partial cystectomy, a patch of a non-vulcanized latex biomembrane (2 x 2 cm was sewn to the bladder of rabbits with 5/0 monofilament polydioxanone sulfate sutures in a watertight manner. Groups of 5 animals were killed at 15, 45 and 90 days after surgery and the bladder was removed. Sections of 5µm were cut and stained with picrosirius-red in order to estimate the amount of extracellular matrix in the graft. To confirm the presence of VEGF in tissues, protein expression was determined by immunohistochemistry. RESULTS: No death, urinary leakage or graft extrusion occurred in any group. All bladders showed a spherical shape. A progressive reduction in the amount of collagen occurred in the graft area and was negatively and linearly correlated with time (p < 0.001. VEGF expression was higher in grafted areas when compared to controls at 15 and 45 days after surgery and decreased with time (p < 0.001. CONCLUSION: The latex biomembrane as a matrix for partial bladder replacement in rabbits promotes temporary collagen deposition and stimulates the angiogenic process.
Directory of Open Access Journals (Sweden)
Tellez-Vazquez J
2016-04-01
Full Text Available Jesús Tellez-Vazquez On behalf of the Dry Eye In Glaucoma Study Group (DEIGSG Glaucoma Section, Ophthalmology Department, Hospital de la Santa Creu i Sant Pau, Barcelona, Spain Purpose: The purpose of this study is to assess the effectiveness and tolerability of a dietary supplement with a combination of omega-3 fatty acids and antioxidants on dry eye symptoms caused by chronic instillation of antihypertensive eye drops in patients with glaucoma. Patients and methods: A total of 1,255 patients with glaucoma and dry eye symptoms related to antiglaucoma topical medication participated in an open-label, uncontrolled, prospective, and multicenter study and were instructed to take three capsules a day of the nutraceutical formulation (Brudypio® 1.5 g for 12 weeks. Dry eye symptoms (graded as 0–3 [none to severe, respectively], conjunctival hyperemia, tear breakup time, Schirmer I test, Oxford grading scheme, and intraocular pressure were assessed. Results: After 12 weeks of administration of the dietary supplement, all dry eye symptoms improved significantly (P<0.001 (mean 1.3 vs 0.6 for scratching, 1.4 vs 0.7 for stinging sensation, 1.6 vs 0.7 for grittiness, 1.0 vs 0.4 for tired eyes, 1.1 vs 0.5 for grating sensation, and 0.8 vs 0.3 for blurry vision. The Schirmer test scores and the tear breakup time also increased significantly. There was an increase in the percentage of patients grading 0–I in the Oxford scale and a decrease in those grading IV–V. Compliance was recorded in 62.5% of patients. In compliant patients, the mean differences at 12 weeks vs baseline of dry eye symptoms were statistically significant as compared to noncompliant patients. Conclusion: Dietary supplementation with Brudypio® may be a clinically valuable additional option for the treatment of dry eye syndrome in patients with glaucoma using antiglaucoma eye drops. These results require confirmation with an appropriately designed randomized controlled study
The effects of temperature and pH bacterial degradation of latex ...
African Journals Online (AJOL)
The goal of this study was to integrate the activities of paint deterioration of microbial communities (microcosms) on the basis of environmental factors. The effect of temperature and pH on bacterial degradation of latex paint under humid condition by bacterial isolates was studied. Results obtained revealed that paint ...
Energy Technology Data Exchange (ETDEWEB)
Chandrasekhar, M. [Prof. C.N.R. Rao Centre for Advanced Materials, Tumkur University, Tumkur 572 103 (India); Department of Physics, Acharya Institute of Technology, Bangalore 560 107 (India); Nagabhushana, H., E-mail: bhushanvlc@gmail.com [Prof. C.N.R. Rao Centre for Advanced Materials, Tumkur University, Tumkur 572 103 (India); Sharma, S.C. [B.S. Narayan Centre of Excellence for Advanced Materials, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); Department of Mechanical Engineering, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); Sudheer kumar, K.H. [Department of Environmental Science, Kuvempu University, Shankarghatta, Shimoga 577 451 (India); Department of Chemistry, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); B.S. Narayan Centre of Excellence for Advanced Materials, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); Dhananjaya, N. [Department of Physics, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); B.S. Narayan Centre of Excellence for Advanced Materials, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); Sunitha, D.V. [Prof. C.N.R. Rao Centre for Advanced Materials, Tumkur University, Tumkur 572 103 (India); Shivakumara, C. [Solid State and Structural Chemistry Unit, Indian Institute of Science, Bangalore 560 012 (India); Nagabhushana, B.M. [Department of Chemistry, M.S. Ramaiah Institute of Technology, Bangalore 560 054 (India)
2014-01-25
Highlights: • ZnO:Eu{sup 3+} phosphors were prepared by green synthesis route. • Morphology and particle size was tuned by varying the concentration of plant latex. • The phosphor show excellent chromaticity coordinates in the white region. -- Abstract: Efficient ZnO:Eu{sup 3+} (1–11 mol%) nanophosphors were prepared for the first time by green synthesis route using Euphorbia tirucalli plant latex. The final products were well characterized by powder X-ray diffraction (PXRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), UV–visible spectroscopy (UV–Vis), Fourier transform infrared spectroscopy (FTIR), etc. The average particle size of ZnO:Eu{sup 3+} (7 mol%) was found to be in the range 27–47 nm. With increase of plant latex, the particle size was reduced and porous structure was converted to spherical shaped particles. Photoluminescence (PL) spectra indicated that the peaks situated at ∼590, 615, 648 and 702 nm were attributed to the {sup 5}D{sub 0} → {sup 7}F{sub j(j=1,2,3,4)} transitions of Eu{sup 3+} ions. The highest PL intensity was recorded for 7 mol% with Eu{sup 3+} ions and 26 ml plant latex concentration. The PL intensity increases with increase of plant latex concentration up to 30 ml and there after it decreases. The phosphor prepared by this method show spherical shaped particles, excellent chromaticity co-ordinates in the white light region which was highly useful for WLED’s. Further, present method was reliable, environmentally friendly and alternative to economical routes.
Directory of Open Access Journals (Sweden)
Prasanthi Narra
2014-04-01
Full Text Available The plant Ipomoea staphylina has been used in diverse traditional medication for the treatment of diseases and illness of human beings. The crude latex extract obtained from the stem of Ipomea staphylina was evaluated for cytotoxic, antimicrobial and wound healing properties. Cell viability and cytotoxicity assays such as Colony Formation method and Enzyme based methods that determined cell viability with a colorimetric method were performed to evaluate the medicinal properties of Ipomea staphylina. Similarly Microbiological Antibiotic Assay to determine the antimicrobial properties and wound healing properties were tested by determining the potent anti-inflammatory molecules that inhibited COX and LOX enzymes. Results showed that the latex crude extract of Ipomea staphylina showed potent Antimicrobial and Antiinflamatory properties, but the viability of the cells were unaffected.
Directory of Open Access Journals (Sweden)
Athanasia O. Matemu
2017-11-01
Full Text Available Wild fruits are commonly consumed in the rural communities of South Africa. The information on their nutritionally important fatty acids is, however, limited. Three wild fruit species, Diospyros blancoi, Landolphia kirkii and Sclerocarya birrea from Limpopo Province were selected for evaluation of fatty acid content. Fatty acids composition of dried fruits of Diospyros blancoi (Db, Landolphia kirkii (Lk and ripe and/or overripe Sclerocarya birrea (Sb were evaluated by a gas chromatography-time of flight-mass spectrometer (GC-TOF-MS. Hexadecanoic acid (C16:0 was found in highest abundance in L. kirkii (57.73–73.55%, followed by S. birrea (55.92–71.31% and D. blancoi (46.31–62.05%, respectively. Octadecanoic acid (C18:0 was of second highest abundance, with 24.71–100% in D. blancoi, L. kirkii (31.03–41.60% and S. birrea (9.11–17.0%. The 9-octadecenoic acid (C18:1n-9 was the major unsaturated fatty acid in both S. birrea (5.33–18.82%, D. blancoi (8.22–8.92%, and L. kirkii (3.84–8.63%. The 9,-12-octadecadienoic acid (C18:2n-6 was the major unsaturated fatty acid in D. blancoi (22.34%. The 9,-12,-15-octadecatrienoic acid (C18:3n-3 was found in L. kirkii (3.51% and S. birrea (2.79%. From the results, saturated fatty acids were the most dominant, whereas mono- and poly-unsaturated fatty acids were the minor constituents. Therefore, presence of nutritionally important essential fatty acids from S. birrea, D. blancoi and L. kirkii has been shown.
Adsorption of immunoglobulin G on core-shell latex particles precoated with chaps
Giacomelli, CE; Vermeer, AWP; Norde, W
2000-01-01
The aim of this work is to investigate the adsorption behavior of a monoclonal antibody (immunoglobulin G, IgG) on latex particles, possessing reactive chloromethyl groups, precoated with 3-([3-cholamidopropyl]dimethylammonio-1-propansulfonate (Chaps). The amount and reactivity of the surface
Adsorption of immunoglobulin G on core-shell latex particles precoated with chaps
Giacomelli, C.E.; Vermeer, A.W.P.; Norde, W.
2000-01-01
The aim of this work is to investigate the adsorption behavior of a monoclonal antibody (immunoglobulin G, IgG) on latex particles, possessing reactive chloromethyl groups, precoated with 3-([3-cholamidopropyl]dimethylammonio-1-propanesulfonate (Chaps). The amount and reactivity of the surface
Extended release of hyaluronic acid from hydrogel contact lenses for dry eye syndrome.
Maulvi, Furqan A; Soni, Tejal G; Shah, Dinesh O
2015-01-01
Current dry eye treatment includes delivering comfort enhancing agents to the eye via eye drops, but low residence time of eye drops leads to low bioavailability. Frequent administration leads to incompliance in patients, so there is a great need for medical device such as contact lenses to treat dry eye. Studies in the past have demonstrated the efficacy of hyaluronic acid (HA) in the treatment of dry eyes using eye drops. In this paper, we present two methods to load HA in hydrogel contact lenses, soaking method and direct entrapment. The contact lenses were characterized by studying their optical and physical properties to determine their suitability as extended wear contact lenses. HA-laden hydrogel contact lenses prepared by soaking method showed release up to 48 h with acceptable physical and optical properties. Hydrogel contact lenses prepared by direct entrapment method showed significant sustained release in comparison to soaking method. HA entrapped in hydrogels resulted in reduction in % transmittance, sodium ion permeability and surface contact angle, while increase in % swelling. The impact on each of these properties was proportional to HA loading. The batch with 200-μg HA loading showed all acceptable values (parameters) for contact lens use. Results of cytotoxicity study indicated the safety of hydrogel contact lenses. In vivo pharmacokinetics studies in rabbit tear fluid showed dramatic increase in HA mean residence time and area under the curve with lenses in comparison to eye drop treatment. The study demonstrates the promising potential of delivering HA through contact lenses for the treatment of dry eye syndrome.
Prevolnik, Maja; Škrlep, Martin; Janeš, Lucija; Velikonja-Bolta, Spela; Škorjanc, Dejan; Čandek-Potokar, Marjeta
2011-06-01
The capability of near infrared (NIR) spectroscopy was examined for the purposes of quality control of the traditional Slovenian dry-cured ham "Kraški pršut." Predictive models were developed for moisture, salt, protein, non-protein nitrogen, intramuscular fat and free amino acids in biceps femoris muscle (n = 135). The models' quality was assessed using statistical parameters: coefficient of determination (R(2)) and standard error (se) of cross-validation (CV) and external validation (EV). Residual predictive deviation (RPD) was also assessed. Best results were obtained for salt content and salt percentage in moisture/dry matter (R(CV)(2)>0.90, RPD>3.0), it was satisfactory for moisture, non-protein nitrogen, intramuscular fat and total free amino acids (R(CV)(2) = 0.75-0.90, RPD = 2.0-3.0), while not so for protein content and proteolysis index (R(CV)(2) = 0.65-0.75, RPD<2.0). Calibrations for individual free amino acids yielded R(CV)(2) from 0.40 to 0.90 and RPD from 1.3 to 2.9. Additional external validation of models on independent samples yielded comparable results. Based on the results, NIR spectroscopy can replace chemical methods in quality control of dry-cured ham. Copyright © 2011 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Haque, M.E.
2003-09-01
The efficiency of 1,9- Nonane-diol-diacrylate (NDDA) as a radiation vulcanization accelerator (RVA) for natural rubber latex (NRL) was investigated. Both gamma rays and electron beam (EB) were used for vulcanizing NRL with NDDA. The radiation dose of gamma rays, concentration of NDDA required to vulcanize the latex were optimized. 20 kGy radiation dose of gamma rays and 5 phr concentration of NDDA were found optimum to get maximum tensile and related properties. NRL was vulcanized under EB to find out the optimum condition of irradiation with this RVA. The defoamer concentrations, length of irradiation time under EB, concentration of RVA were optimizer by changing various parameters of the EB machine with a constant set of the others. 0.2 phr defoamer concentration, 30 minutes irradiation time and 5 phr concentration of NDDA were found optimum for irradiation of NRL under the EB machine. Effect of low current and optimum volume of latex charged in the reaction vessel suitable for vulcanization at a time were found out. (author)
Radiation vulcanised natural rubber latex (RVNRL) market and challenges
International Nuclear Information System (INIS)
Wan Manshol Wan Zin; Najib Mohamad Zakey; Chai Chee Keong
2000-01-01
RVNRL has the required properties and proven useful for the manufacturing of examination gloves, balloons and finger cots at industrial scale. To date only RVNRL finger cots are available in the market. Problems and challenges for the market of other products are identified. Further success in the on going research activities will be the reference for more applications of RVNRL in the relevant industry to produce natural rubber latex products of more competitive values
Romero, P.; Otiniano, M.
2014-01-01
The present work propose the replacement of the three stages of the activation process of bentonite with sulfuric acid by the only stage spray drying. El presente trabajo propone reemplazar tres etapas del proceso de activación de la bentonita con ácido sulfúrico por una sola etapa, la del secado por atomización.
De Koster, J; Hostens, M; Van Eetvelde, M; Hermans, K; Moerman, S; Bogaert, H; Depreester, E; Van den Broeck, W; Opsomer, G
2015-07-01
The objective of the present research was to determine the insulin response of the glucose and fatty acid metabolism in dry dairy cows with a variable body condition score (BCS). Ten pregnant Holstein Friesian dairy cows (upcoming parity 2 to 5) were selected based on BCS at the beginning of the study (2mo before expected parturition date). During the study, animals were monitored weekly for BCS and backfat thickness and in the last 2wk, blood samples were taken for determination of serum nonesterified fatty acid (NEFA) concentration. Animals underwent a hyperinsulinemic euglycemic clamp test in the third week before the expected parturition date. The hyperinsulinemic euglycemic clamp test consisted of 4 consecutive insulin infusions with increasing insulin doses: 0.1, 0.5, 2, and 5mIU/kg per minute. For each insulin infusion period, a steady state was defined as a period of 30min where no or minor changes of the glucose infusion were necessary to keep the blood glucose concentration constant and near basal levels. During the steady state, the glucose infusion rate [steady state glucose infusion rate (SSGIR) in µmol/kg per minute] and NEFA concentration [steady state NEFA concentration (SSNEFA) in mmol/L] were determined and reflect the insulin response of the glucose and fatty acid metabolism. Dose response curves were created based on the insulin concentrations during the steady state and the SSGIR or SSNEFA. The shape of the dose response curves is determined by the concentration of insulin needed to elicit the half maximal effect (EC50) and the maximal SSGIR or the minimal SSNEFA for the glucose or fatty acid metabolism, respectively. The maximal SSGIR was negatively associated with variables reflecting adiposity of the cows (BCS, backfat thickness, NEFA concentration during the dry period, and absolute weight of the different adipose depots determined after euthanasia and dissection of the different depots), whereas the EC50 of the glucose metabolism was
International Nuclear Information System (INIS)
Lopez Saldana, I.R.
1993-01-01
At the present research, were studied the changes in natural rubber latex structure, due to electron beam by a 3 MeV, 25 m A Dynamitron electron accelerator. The natural rubber latex was irradiated at 30, 40 and 50 kGy/s dose rate, over a total dose range from 150 to 250 kGy, for each dose rate used. From natural rubber latex irradiated films were prepared by casting with 0.7 mm. thickness. In the main part, the study was made by positron annihilation lifetime (PAL), this technique is unique in the determination of free-volume properties due to the fact that positronium atom (Ps) is found to be preferentially localized in the free-volume region of polymeric materials. The positron lifetime measurements were performing using a gamma-gamma coincidence system. These results were analyzed by PATFIT-88 program computer into three components, the long-lived component for orthopositronium (o-Ps) with parameters lifetime (τ 3 ) and formation intensity (I 3 ), were plotted and analyzed for each dose rate and total dose used. Besides with τ 3 were calculated the mean free-volume size based on the spherical model for the free-volume bubble, found that the free-volume decrease slightly with the total dose due to the crosslinking of natural rubber latex. Besides was studied the effect of dose rate on tensile strength, the tensile strength is increased with the total dose although there was not a clear effect due to the dose rate. Also the films were subjected to aging in order to determined the thermal stability of natural rubber latex irradiated, the results show that the films have good stability. Besides was used the infrared spectroscopy to determine the changes due to the crosslinking by variations in the characteristically absorption bands for cis 1,4-polyisoprene. (Author)
Energy Technology Data Exchange (ETDEWEB)
Boclet, K; Laurent, H [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1958-07-01
Because of the thinners of latex or neoprene gloves and the high intensity of Bremsstrahlung radiation, manipulation of pure high-energy {beta}{sup -} emitters is impossible in ordinary dry-boxes. There are many types of box equipped with heavy lead or steel protection, but their use for radioelements such as {sup 32}P, {sup 90}Sr, {sup 90}Y is not justified. We have devised units known as 'tong boxes' which, while retaining much of the flexibility of operation found in dry-boxes, provide adequate protection. 1 curie of {sup 32}P placed in the centre of the enclosure gives about 15 mR/ 8 h. at the part of the wall closest to the source. (author) [French] La faible epaisseur des gants de latex ou de neoprene et l'importance du rayonnement de freinage rendent impossible la manipulation des emetteurs {beta}{sup -} purs energiques dans des boites a gants normales. Il existe de nombreux types d'enceintes dotees d'une forte protection de plomb ou d'acier dont l'emploi n'est pas justifie pour des radioelements tels que {sup 32}P, {sup 90}Sr, {sup 90}Y. Nous avons realise des ensembles appeles 'Boites a Pinces', qui tout en conservant une grande partie de la souplesse d'utilisation des boites a gants sont dotees d'une protection suffisante. 1 curie de {sup 32}P place au centre de l'enceinte donne environ 15 mR/ 8 h au contact de la paroi la plus rapprochee de la source. (auteur)
Aarif, Ovais; Aggarwal, Anjali
2016-03-01
This study aimed to evaluate the impact of evaporative cooling during late gestation on physiological responses, blood gas and acid base balance and subsequent milk production of Murrah buffaloes. To investigate this study sixteen healthy pregnant dry Murrah buffaloes (second to fourth parity) at sixty days prepartum were selected in the months of May to June and divided into two groups of eight animals each. One group of buffaloes (Cooled/CL) was managed under fan and mist cooling system during dry period. Group second buffaloes (Noncooled/NCL) remained as control without provision of cooling during dry period. The physiological responses viz. Rectal temperature (RT), Respiratory rate (RR) and Pulse rate were significantly ( P Milk yield, FCM, fat yield, lactose yield and total solid yield was significantly higher ( P < 0.05) in cooled group of Murrah buffaloes.
Krzemińska, Sylwia; Rzymski, Władysław M; Malesa, Monika; Borkowska, Urszula; Oleksy, Mariusz
2016-09-01
Resistance to permeation of noxious chemical substances should be accompanied by resistance to mechanical factors because the glove material may be torn, cut or punctured in the workplace. This study reports on glove materials, protecting against mineral oils and mechanical hazards, made of carboxylated acrylonitrile-butadiene rubber (XNBR) latex. The obtained materials were characterized by a very high resistance of the produced materials to oil permeation (breakthrough time > 480 min). The mechanical properties, and especially tear resistance, of the studied materials were improved after the addition of modified bentonite (nanofiller) to the XNBR latex mixture. The nanocomposite meets the requirements in terms of parameters characterizing tear, abrasion, cut and puncture resistance. Therefore, the developed material may be used for the production of multifunctional protective gloves.
Costs and return analysis in rubber latex production in Edo State ...
African Journals Online (AJOL)
The study examined the costs and return analysis in rubber latex production in Edo Sate, Nigeria. Multi-stage sampling method was adopted to select 96 smallholder rubber framers for the study. The first stage was a purposive sampling of two LGAs and then simple random sampling of 6 villages each from the two LGA.
Energy Technology Data Exchange (ETDEWEB)
Yu Haibo [Department of Applied Chemistry, College of Chemistry and Molecular Engineering, Peking University, Beijing 100871 (China); Peng Jing [Department of Applied Chemistry, College of Chemistry and Molecular Engineering, Peking University, Beijing 100871 (China)], E-mail: jpeng@pku.edu.cn; Zhai Maolin; Li Jiuqiang; Wei Genshuan [Department of Applied Chemistry, College of Chemistry and Molecular Engineering, Peking University, Beijing 100871 (China); Qiao Jinliang [Department of Applied Chemistry, College of Chemistry and Molecular Engineering, Peking University, Beijing 100871 (China); SINOPEC Beijing Research Institute of Chemical Industry, Beijing 100013 (China)
2007-11-15
A series of latex interpenetrating polymer networks (LIPNs) were prepared via a two-stage emulsion polymerization of methyl methacrylate (MMA) or mixture of MMA and n-butyl acrylate (n-BA) on crosslinked poly(n-butyl acrylate)(PBA) seed latex using {sup 60}Co {gamma}-ray radiation. The particles of resultant latex were produced with diameters between 150 and 250 nm. FTIR spectra identified the formation of crosslinked copolymers of PMMA or P(MMA-co-BA). Dynamic light scattering (DLS) showed that with increasing n-BA concentration in second-stage monomers, the particle size of LIPN increased. Transmission electron microscope(TEM) photographs showed that the morphology of resultant acrylate interpenetrating polymer network (IPN) latex varied from the distinct core-shell structure to homogenous particle structure with the increase of n-BA concentration, and the morphology was mainly controlled by the miscibility between crosslinked PBA seed and second-stage copolymers and polarity of P(MMA-co-BA)copolymers. In addition, differential scanning calorimeter (DSC) measurements indicated the existence of reinforced miscibility between PBA seed and P(MMA-co-BA)copolymer in prepared LIPNs.
Chanra, J.; Budianto, E.; Soegijono, B.
2018-03-01
Hybrid polymer latex based on combination of organic-inorganic materials, poly(methyl methacrylate-co-butyl acrylate) (PMMBA) and organo-montmorillonite (OMMT) were synthesized via miniemulsion polymerization technique. Modification of montmorillonite (MMT) through the incorporation of myristyltrimethylammonium bromide (MTAB) into the clay’s interlayer spaces were investigated by Small-Angle X-ray Scattering (SAXS), Fourier Transform Infrared Spectroscopy (FTIR), Thermogravimetric Analysis (TGA) and Transmission Electron Microscopy (TEM). Barrier property and thermal stability of polymer latex film sample were investigated through its Water Vapor Transmission Rate (WVTR) and Thermogravimetric Analysis (TGA). The results indicated that addition of OMMT as filler in PMMBA increased the barrier property and thermal stability of the latex film. Addition of 8.0% (wt) OMMT increased the barrier property and thermal stability. Miniemusion polymerization process with higher addition (>8.0 wt%) of OMMT resulting in high latex viscosity, particle size, and high amount of coagulum. The utilization of this hybrid polymer could benefits paper and board industries to produce high quality barrier paper for food packaging.
Directory of Open Access Journals (Sweden)
Flávia Sukekava
2007-01-01
Full Text Available As reações alérgicas ao látex vêm aumentando em profissionais da saúde e se manifestam como um incômodo local ou sintomatologia sistêmica. Para conhecer a freqüência das manifestações alérgicas nos usuários de luvas de látex foi realizada busca entre os profissionais da odontologia via aplicação de questionários. Foram aplicados 450questionários e, dentre os respondedores (140, 19% relataram manifestar reações locais ao contato com as luvas de látex e 5% reações sistêmicas a outros produtos de látex. Cerca de 2,5% declararam dermatite de contato e reações sistêmicas (anafiláticas, 1,5% apenas dermatite de contato e 1% sintomas de anafilaxia ao uso das luvas. Vinte por cento dos profissionais atenderam pacientes com alergia ao látex e 29% declararam questionar, durante a anamnese, a respeito de alergia ao látex. As reações alérgicas a luvas de látex foram freqüentes e é objeto de preocupação entre os profissionais da odontologia.Allergic reactions to natural rubber latex have increased in dental practice affecting both the professional and the patients. Allergic reactions may range from skin disease to asthma and anaphylaxis. This study aimed at determining the incidence of latex gloves allergy amongdental care workers. 450 allergy questionnaires were used to collect information on latex gloves reactions and 140 dental works answered them. Latex gloves reaction occurred in 19% of them and 5% reported allergic reactions to other latex products. 2.5% reported symptoms suggesting contact dermatitis and anaphylaxis hypersensitivities, 1.5% contact dermatitis, and 1% reported anaphylaxis symptoms when wearing them. 20% of them had patients who presented symptoms suggestive of anaphylaxis hypersensitivity to rubber gloves latex. Our study confirms that rubber latex gloves reactions are frequent among dental care workers, and dentists must be aware of the latex allergy in dental practice.
Nosrati, Rahimeh; Olad, Ali; Nofouzi, Katayoon
2015-08-01
The commercial grade polyacrylic latex was modified in order to prepare a self-cleaning coating. TiO2/Ag-exchanged-zeolite-A nanocomposite was prepared and used as additive in the matrix of polyacrylic latex to achieve a hydrophilic and photocatalytic coating. FTIR and UV-visible spectroscopy, X-ray diffraction patterns and FESEM were used to characterize the composition and structure of the nanocomposites and coatings. The acrylic coatings, were prepared by using of TiO2/Ag-exchanged-zeolite-A additive, had better UV and visible light absorption, hydrophilic, degradation of organic pollutants, stability in water and antimicrobial properties than pristine commercial grade polyacrylic latex coating. According to the results, the modified polyacrylic based coating containing 0.5 wt% of TiO2/Ag-exchanged-zeolite-A nanocomposite additive with TiO2 to Ag-exchanged-zeolite-A ratio of 1:2 was the best coating considering most of useful properties such as small band gap and low water contact angle. The water contact angle for unmodified polyacrylic latex coating was 68° which was decreased to less than 10° in modified coating after 24 h LED lamp illumination.
Directory of Open Access Journals (Sweden)
Maria Vitória Carmo Penhavel
Full Text Available Objective : to evaluate the effect of topical delivery of latex cream-gel in acute cutaneous wounds induced on the back of rats. Methods : we subjected sixteen rats to dermo-epidermal excision of a round dorsal skin flap, with 2.5cm diameter. We divided the animals into two groups: Latex Group: application of cream-gel-based latex throughout the wound bed on postoperative days zero, three, six and nine; Control group: no treatment on the wound. Photographs of the lesions were taken on the procedure day and on the 6th and 14th postoperative days, for analyzing the area and the larger diameter of the wound. We carried out euthanasia of all animals on the 14th postoperative day, when we resected he dorsal skin and the underlying muscle layer supporting the wound for histopathological study. Results : there was no statistically significant difference in the percentage of wound closure, in the histopathological findings or in the reduction of the area and of the largest diameter of the wounds among the groups studied on the 14th postoperative day. Conclusion : according to the experimental conditions in which the study was conducted, latex cream-gel did not interfere in the healing of acute cutaneous wounds in rats.
International Nuclear Information System (INIS)
Nosrati, Rahimeh; Olad, Ali; Nofouzi, Katayoon
2015-01-01
Graphical abstract: - Highlights: • A novel nanocomposite coating based on polyacrylic was prepared. • Nanostructured TiO 2 /Ag-exchanged-zeolite-A composite material was prepared. • Prepared nanocomposite used as additive for modification of polyacrylic latex. • Modified coatings show self-cleaning and antibacterial properties. • Modified coatings show better stability in water in versus of unmodified polymer. - Abstract: The commercial grade polyacrylic latex was modified in order to prepare a self-cleaning coating. TiO 2 /Ag-exchanged-zeolite-A nanocomposite was prepared and used as additive in the matrix of polyacrylic latex to achieve a hydrophilic and photocatalytic coating. FTIR and UV–visible spectroscopy, X-ray diffraction patterns and FESEM were used to characterize the composition and structure of the nanocomposites and coatings. The acrylic coatings, were prepared by using of TiO 2 /Ag-exchanged-zeolite-A additive, had better UV and visible light absorption, hydrophilic, degradation of organic pollutants, stability in water and antimicrobial properties than pristine commercial grade polyacrylic latex coating. According to the results, the modified polyacrylic based coating containing 0.5 wt% of TiO 2 /Ag-exchanged-zeolite-A nanocomposite additive with TiO 2 to Ag-exchanged-zeolite-A ratio of 1:2 was the best coating considering most of useful properties such as small band gap and low water contact angle. The water contact angle for unmodified polyacrylic latex coating was 68° which was decreased to less than 10° in modified coating after 24 h LED lamp illumination
Mann, S; Leal Yepes, F A; Overton, T R; Lock, A L; Lamb, S V; Wakshlag, J J; Nydam, D V
2016-02-01
The objective was to investigate the effect of different dry cow feeding strategies on the volume, concentration of IgG and insulin, as well as fatty acid composition of colostrum. Our hypothesis was that different dry period diets formulated to resemble current feeding practices on commercial dairy farms and differing in plane of energy would have an effect on IgG and insulin concentration, as well as composition of fatty acid of colostrum. Animals (n=84) entering parity 2 or greater were dried off 57 d before expected parturition and fed either a diet formulated to meet, but not greatly exceed energy requirements throughout the dry period (CON), or a higher energy density diet, supplying approximately 150% of energy requirements (HI). A third group received the same diet as group CON from dry-off until 29 d before expected parturition. After this time point, from 28 d before expected parturition until calving, they received a diet formulated to supply approximately 125% of energy requirements (I-med). Concentration of IgG and insulin in colostrum were measured by radial immunodiffusion and RIA, respectively. Composition of fatty acids was determined by gas-liquid chromatography. The IgG concentration was highest in colostrum of cows in group CON [96.1 (95% CI: 83.3-108.9) g/L] and lowest in group HI [72.4 (60.3-84.5) g/L], whereas insulin concentration was highest in group HI [1,105 (960-1,250) μU/mL] and lowest in group CON [853 (700-1,007) μU/mL]. Colostrum yield did not differ between treatments and was 5.9 (4.5-7.4), 7.0 (5.6-8.4), and 7.3 (5.9-8.7) kg in groups CON, I-med, and HI, respectively. A multivariable linear regression model showed the effect of dietary treatment group on IgG concentration was independent of the effect of dry matter. Cows in groups CON, I-med, and HI had an average colostral fat percentage of 5.0 (4.1-5.9), 5.6 (4.8-6.4), and 6.0 (5.2-6.8) and an average fat yield of 289 (196-380), 406 (318-495), and 384 (295-473) g, respectively
Kuznetsov, Petr; Kuznetsova, Alsu; Foght, Julia M; Siddique, Tariq
2015-02-01
Bitumen extraction from oil sands ores after surface mining produces different tailings waste streams: 'froth treatment tailings' are enriched in pyrite relative to other streams. Tailings treatment can include addition of organic polymers to produce thickened tailings (TT). TT may be further de-watered by deposition into geotechnical cells for evaporative drying to increase shear strength prior to reclamation. To examine the acid rock drainage (ARD) potential of TT, we performed predictive analyses and laboratory experiments on material from field trials of two types of thickened froth treatment tailings (TT1 and TT2). Acid-base accounting (ABA) of initial samples showed that both TT1 and TT2 initially had net acid-producing potential, with ABA values of -141 and -230 t CaCO₃ equiv. 1000 t(-1) of TT, respectively. In long-term kinetic experiments, duplicate ~2-kg samples of TT were incubated in shallow trays and intermittently irrigated under air flow for 459 days to simulate evaporative field drying. Leachates collected from both TT samples initially had pH~6.8 that began decreasing after ~50 days (TT2) or ~250 days (TT1), stabilizing at pH~2. Correspondingly, the redox potential of leachates increased from 100-200 mV to 500-580 mV and electrical conductivity increased from 2-5 dS m(-1) to 26 dS m(-1), indicating dissolution of minerals during ARD. The rapid onset and prolonged ARD observed with TT2 is attributed to its greater pyrite (13.4%) and lower carbonate (1.4%) contents versus the slower onset of ARD in TT1 (initially 6.0% pyrite and 2.5% carbonates). 16S rRNA gene pyrosequencing analysis revealed rapid shift in microbial community when conditions became strongly acidic (pH~2) favoring the enrichment of Acidithiobacillus and Sulfobacillus bacteria in TT. This is the first report showing ARD potential of TT and the results have significant implications for effective management of pyrite-enriched oil sands tailings streams/deposits. Copyright © 2014
Directory of Open Access Journals (Sweden)
Omokhafe, KO.
2001-01-01
Full Text Available The correlative path analysis between tree dryness and four latex parameters was studied in eleven clones of Hevea brasiliensis. The latex parameters used for evaluation were initial volume, initial flow rate, final volume and plugging index with tree dryness as the dependent factor. Estimates of direct and indirect effects of each of the latex parameters on tree dryness were calculated through linear correlation and path analysis. The correlation coefficient between initial volume and initial flow rate was 1.00 and both characters had the same correlation coefficients with other latex parameters and tree dryness. This implies that initial volume and initial flow rate are alternatives for evaluation of correlation between latex parameters and tree dryness. There was significant correlation between initial volume, initial flow rate and tree dryness at V = -0.52 and high indirect effect of initial volume and initial flow rate through final volume. In addition, despite the low correlation coefficient of V = -0.20 between final volume and tree dryness, the direct effect of final volume on tree dryness was high at 0.812. Final volume is therefore an important factor in the incidence of tree dryness.
Quintana, Gabriel; Gerbino, Esteban; Gómez-Zavaglia, Andrea
2017-01-01
Okara is a nutritionally valuable by-product produced in large quantities as result of soymilk elaboration. This work proposes its use as both culture and dehydration medium during freeze-drying, spray-drying, and storage of Lactobacillus plantarum CIDCA 83114. Whole and defatted okara were employed as culture media for L. plantarum CIDCA 83114. The growth kinetics were followed by plate counting and compared with those of bacteria grown in MRS broth (control). No significant differences in plate counting were observed in the three media. The fatty acid composition of bacteria grown in whole and defatted okara showed a noticeable increase in the unsaturated/saturated (U/S) fatty acid ratio, with regard to bacteria grown in MRS. This change was mainly due to the increase in polyunsaturated fatty acids, namely C18:2. For dehydration assays, cultures in the stationary phase were neutralized and freeze-dried (with or without the addition of 250 mM sucrose) or spray-dried. Bacteria were plate counted immediately after freeze-drying or spray-drying and during storage at 4°C for 90 days. Freeze-drying in whole okara conducted to the highest bacterial recovery. Regarding storage, spray-dried bacteria previously grown in whole and defatted okara showed higher plate counts than those grown in MRS. On the contrary, freeze-dried bacteria previously grown in all the three culture media were those with the lowest plate counts. The addition of sucrose to the dehydration media improved their recovery. The higher recovery of microorganisms grown in okara after freeze-drying and spray-drying processes and during storage was ascribed to both the presence of fiber and proteins in the dehydration media, and the increase in U/S fatty acids ratio in bacterial membranes. The obtained results support for the first time the use of okara as an innovative matrix to deliver L. plantarum. Considering that okara is an agro-waste obtained in large quantities, these results represent an
Mixed field radiation effects on dry and acidic solution saturated polyamide 6,6
Energy Technology Data Exchange (ETDEWEB)
Brown, L. [Department of Chemistry and Chemical Engineering, Royal Military College of Canada, Kingston, Ont., K7K 7B4 (Canada); Bonin, H.W. [Department of Chemistry and Chemical Engineering, Royal Military College of Canada, Kingston, Ont., K7K 7B4 (Canada)]. E-mail: bonin-h@rmc.ca; Bui, V.T. [Department of Chemistry and Chemical Engineering, Royal Military College of Canada, Kingston, Ont., K7K 7B4 (Canada)
2005-05-15
The disposal of Canada's radioactive waste materials has been the focus of ongoing research at the Royal Military College of Canada, in the use of polymer-based composite materials for the fabrication of disposal containers. An evaluation of the performance of polyamide 6,6 after exposure to radiation and acidic aqueous solutions provides the basis for the assessment of the lifetime performance of a polymeric-based storage container. This work demonstrates the importance of the combined effects of aqueous solution diffusion and radiation exposure on the mechanical performance and molecular structure of polyamide 6,6. Irradiation of dry samples initially results in a marked reduction of mechanical performance, however, post-irradiation aging allows for the return to pre-irradiation mechanical strength. Samples irradiated after exposure to either distilled water or 0.1 M sulfuric acid solutions exhibited increases in mechanical performance upon exposure to a mixed field radioactive environment.
Mixed field radiation effects on dry and acidic solution saturated polyamide 6,6
International Nuclear Information System (INIS)
Brown, L.; Bonin, H.W.; Bui, V.T.
2005-01-01
The disposal of Canada's radioactive waste materials has been the focus of ongoing research at the Royal Military College of Canada, in the use of polymer-based composite materials for the fabrication of disposal containers. An evaluation of the performance of polyamide 6,6 after exposure to radiation and acidic aqueous solutions provides the basis for the assessment of the lifetime performance of a polymeric-based storage container. This work demonstrates the importance of the combined effects of aqueous solution diffusion and radiation exposure on the mechanical performance and molecular structure of polyamide 6,6. Irradiation of dry samples initially results in a marked reduction of mechanical performance, however, post-irradiation aging allows for the return to pre-irradiation mechanical strength. Samples irradiated after exposure to either distilled water or 0.1 M sulfuric acid solutions exhibited increases in mechanical performance upon exposure to a mixed field radioactive environment
International Nuclear Information System (INIS)
Coppa, N.V.; Stewart, P.; Renzi, E.
1999-01-01
The present invention provides methods and apparatus for freeze drying in which a solution, which can be a radioactive salt dissolved within an acid, is frozen into a solid on vertical plates provided within a freeze drying chamber. The solid is sublimated into vapor and condensed in a cold condenser positioned above the freeze drying chamber and connected thereto by a conduit. The vertical positioning of the cold condenser relative to the freeze dryer helps to help prevent substances such as radioactive materials separated from the solution from contaminating the cold condenser. Additionally, the system can be charged with an inert gas to produce a down rush of gas into the freeze drying chamber to also help prevent such substances from contaminating the cold condenser
CSIR Research Space (South Africa)
Yanga, F
2017-12-01
Full Text Available International, vol. 43(18): 16652-16658 Formic acid as additive for the preparation of high-performance FePO4 materials by spray drying method Yanga F Zhang H Shao Y Song H Liao S Ren J ABSTRACT: High-performance ferric phosphate (FePO4...
Teka, Tekleab; Bisrat, Daniel; Yeshak, Mariamawit Yonathan; Asres, Kaleab
2016-10-28
Malaria is one of the three major global public health threats due to a wide spread resistance of the parasites to the standard antimalarial drugs. Considering this growing problem, the ethnomedicinal approach in the search for new antimalarial drugs from plant sources has proven to be more effective and inexpensive. The leaves of Aloe pulcherrima Gilbert and Sebsebe, an endemic Ethiopian plant, are locally used for the treatment of malaria and other infectious diseases. Application of the leaf latex of A. pulcherrima on preparative silica gel TLC led to the isolation of two C -glycosylated anthrones, identified as nataloin ( 1 ) and 7-hydroxyaloin ( 2 ) by spectroscopic techniques (UV, IR, ¹H- and 13 C-NMR, HR-ESIMS). Both the latex and isolated compounds displayed antimalarial activity in a dose-independent manner using a four-day suppressive test, with the highest percent suppression of 56.2% achieved at 200 mg/kg/day for 2 . The results indicate that both the leaf latex of A. pulcherrima and its two major constituents are endowed with antiplasmodial activities, which support the traditional use of the leaves of the plant for the treatment of malaria.
A latex metabolite benefits plant fitness under root herbivore attack
Huber, M.; Epping, J.; Gronover, C.S.; Fricke, J.; Aziz, Z.; Brillatz, T.; Swyers, M.; Köllner, T.G.; Vogel, H.; Hammerbacher, A.; Triebwasser-Freese, D.; Robert, C.A.M.; Verhoeven, K.; Preite, V.; Gershenzon, J.
2016-01-01
Plants produce large amounts of secondary metabolites in their shoots and roots and store them in specialized secretory structures. Although secondary metabolites and their secretory structures are commonly assumed to have a defensive function, evidence that they benefit plant fitness under herbivore attack is scarce, especially below ground. Here, we tested whether latex secondary metabolites produced by the common dandelion (Taraxacum officinale agg.) decrease the performance of its major n...
Omega-3 fatty acid supplementation can improve both symptoms and signs of dry eye disease
Kwon,Jae-Woo; Han,Sang Beom
2017-01-01
Jae-Woo Kwon,1 Sang Beom Han2 1Department of Internal Medicine, 2Department of Ophthalmology, Kangwon National University Hospital, Kangwon National University Graduate School of Medicine, Chuncheon, South Korea We read with great interest the article by Gatell-Tortajada1 entitled “Oral supplementation with a nutraceutical formulation containing omega-3 fatty acids, vitamins, minerals, and antioxidants in a large series of patients with dry eye symptoms: results of a prosp...
Krzemińska, Sylwia; Rzymski, Władysław M.; Malesa, Monika; Borkowska, Urszula; Oleksy, Mariusz
2016-01-01
Resistance to permeation of noxious chemical substances should be accompanied by resistance to mechanical factors because the glove material may be torn, cut or punctured in the workplace. This study reports on glove materials, protecting against mineral oils and mechanical hazards, made of carboxylated acrylonitrile–butadiene rubber (XNBR) latex. The obtained materials were characterized by a very high resistance of the produced materials to oil permeation (breakthrough time > 480 min). The mechanical properties, and especially tear resistance, of the studied materials were improved after the addition of modified bentonite (nanofiller) to the XNBR latex mixture. The nanocomposite meets the requirements in terms of parameters characterizing tear, abrasion, cut and puncture resistance. Therefore, the developed material may be used for the production of multifunctional protective gloves. PMID:26757889
Directory of Open Access Journals (Sweden)
Andre L. A. Domingos
2009-04-01
Full Text Available PURPOSE: To investigate histological features and biocompatibility of a latex biomembrane for bladder augmentation using a rabbit model. MATERIAL AND METHODS: After a partial cystectomy, a patch of a non-vulcanized latex biomembrane (2x4 cm was sewn to the bladder with 5/0 monofilament polydioxanone sulfate in a watertight manner. Groups of 5 animals were sacrificed at 15, 45 and 90 days after surgery and the bladder was removed. The 5-µm preparations obtained from grafted area and normal bladder were stained with hematoxylin-eosin. Immunohistochemical staining was performed with a primary antibody against alpha-actin to assess muscle regeneration. RESULTS: No death, urinary leakage or graft extrusion occurred in any group. All bladders showed a spherical shape. Macroscopically, after 90 days, the latex biomembrane was not identifiable and the patch was indistinguishable from normal bladder. A bladder stone was found in one animal (6.6%. On the 90th day, histology revealed continuity of transitional epithelium of host bladder tissue on the patch area. At this time, the muscle layers were well organized in a similar fashion to native bladder muscle layers. The inflammatory process was higher on grafted areas when compared to controls: 15 days - p < 0.0001, 45 days - p < 0.001, and 90 days - p < 0.01. The anti alpha-actin immunoexpression peaked at 45 days, when the graft was observed covered by muscle cells. CONCLUSION: The latex biomembrane is biocompatible and can be used in models for bladder augmentation in rabbits. It promotes epithelium and muscle regeneration without urinary leakage.
Characterization of short chain fatty acid microcapsules produced by spray drying
International Nuclear Information System (INIS)
Teixeira, Maria Ines; Andrade, Leonardo R.; Farina, Marcos; Rocha-Leao, Maria Helena M.
2004-01-01
Microcapsules containing short chain fatty acids (SCFA) were produced by spray drying technique using different proportions of gum arabic and maltodextrin as wall materials. Proportions of 5% and 10% of gum arabic and maltodextrin isolated, and a mixture of 5% of maltodextrin and 5% of gum arabic were added to samples of fermented permeate containing SCFA, and spray dried. The microstructure of microcapsules was studied by scanning electron microscopy (SEM) and the size distribution was obtained by laser diffraction. SEM observations showed that the microcapsules structures were affected by type and proportion of wall material tested. Most of the microcapsules containing gum arabic as wall material had surface dents or invaginations. Microcapsules containing maltodextrin were spherical with few surface dents and some of them had pores. The larger microcapsule sizes were observed in those containing maltodextrin. Our results show that microstructure and size of microcapsules are affected by type and proportion of biomaterial used. The samples containing 5% of maltodextrin and the mixture of 5% of gum arabic with 5% of maltodextrin presented smooth surfaces and homogenous size distributions. The corresponding microcapsules are considered optimal to food industrial uses due to the flowability property. Besides, these capsules were found to present a homogenous distribution of diameters, which may give a homogenous flavor distribution to the food products
Energy Technology Data Exchange (ETDEWEB)
Fogler, H.S.
1986-01-01
Our earlier study has shown that hydrocolloids such as gum tragacanth (GT) are effective in stabilizing coal-water slurries by the steric stabilization mechanism and also possibly by electrostatic stabilization mechanism. In this study, polystyrene latex has been chosen as the model system for coal-water slurries because of its monodispersity and its well established surface properties. The studies of the effects of ionic strength and pH on adsorption isotherms indicate that the adsorption of GT is probably hydrophobic rather than electrostatic or hydrogen-bonding. The value of pK was measured to be 2.95, from which the relation between the stability factor and the degree of dissociation of GT in the solution was obtained. Combining the results from the adsorption study and the measurement of stability factor at various pH, it was found that the stability factor significantly changes with pH even with the same amount of GT adsorbed. This indicates that the steric layer thickness or the conformation of GT on the surface of latex varies with pH. Binding studies on coal-water slurries were also carried out before and after acid leach, and the results indicate that the metal oxides on the coal surface, such as Al/sub 2/O/sub 3/ and SiO/sub 2/, may be responsible for the adsorption with GT. 7 refs., 9 figs.
Thermoresponsive latexes for fragrance encapsulation and release.
Popadyuk, N; Popadyuk, A; Kohut, A; Voronov, A
2016-04-01
To synthesize cross-linked latex particles protecting the encapsulated fragrance at ambient temperatures and facilitating the release of cargo at the temperature of the surface of the skin that varies in different regions of the body between 33.5 and 36.9°C. Poly(stearyl acrylate) (PSA), a polymer with long crystallizable alkyl side chains (undergoes order-disorder transitions at 45°C), was chosen as the main component of the polymer particles. As a result, new thermoresponsive polymer particles for fragrance encapsulation were synthesized and characterized, including assessing the performance of particles in triggered release by elevated temperature. To obtain network domains of various crystallinity, stearyl acrylate was copolymerized with dipropylene glycol acrylate caprylate (DGAC) (comonomer) in the presence of a dipropylene glycol diacrylate sebacate (cross-linker) using the miniemulsion process. Comonomers and a cross-linker were mixed directly in a fragrance during polymerization. Fragrance release was evaluated at 25, 31, 35 and 39°C to demonstrate a new material potential in personal/health care skin-related applications. Particles protect the fragrance from evaporation at 25°C. The fragrance release rate gradually increases at 31, 35 and 39°C. Two slopes were found on release plots. The first slope corresponds to a rapid fragrance release. The second slope indicates a subsequent reduction in the release rate. Crystalline-to-amorphous transition of PSA triggers the release of fragrances from cross-linked latex particles at elevated temperatures. The presence of the encapsulated fragrance, as well as the inclusion of amorphous fragments in the polymer network, reduces the particle crystallinity and enhances the release. Release profiles can be tuned by temperature and controlled by the amount of loaded fragrance and the ratio of comonomers in the feed mixture. © 2015 Society of Cosmetic Scientists and the Société Française de Cosmétologie.
D'Addio, Suzanne M; Kafka, Concepcion; Akbulut, Mustafa; Beattie, Patrick; Saad, Walid; Herrera, Margarita; Kennedy, Michael T; Prud'homme, Robert K
2010-04-05
Nanoparticles have significant potential in therapeutic applications to improve the bioavailability and efficacy of active drug compounds. However, the retention of nanometer sizes during concentrating or drying steps presents a significant problem. We report on a new concentrating and drying process for poly(ethylene glycol) (PEG) stabilized nanoparticles, which relies upon the unique pH sensitive hydrogen bonding interaction between PEG and polyacid species. In the hydrogen bonding coacervate precipitation (HBCP) process, PEG protected nanoparticles rapidly aggregate into an easily filterable precipitate upon the addition various polyacids. When the resulting solid is neutralized, the ionization of the acid groups eliminates the hydrogen bonded structure and the approximately 100 nm particles redisperse back to within 10% of their original size when poly(acrylic acid) and citric acid are used and 45% when poly(aspartic acid) is used. While polyacid concentrations of 1-5 wt % were used to form the precipitates, the incorporation of the acid into the PEG layer is approximately 1:1 (acid residue):(ethylene oxide unit) in the final dried precipitate. The redispersion of dried beta-carotene nanoparticles protected with PEG-b-poly(lactide-co-glycolide) polymers dried by HBCP was compared with the redispersion of particles dried by freeze-drying with sucrose as a cryprotectant, spray freeze-drying, and normal drying. Freeze-drying with 0, 2, and 12 wt % sucrose solutions resulted in size increases of 350%, 50%, and 6%, respectively. Spray freeze-drying resulted in particles with increased sizes of 50%, but no cryoprotectant and only moderate redispersion energy was required. Conventional drying resulted in solids that could not be redispersed back to nanometer size. The new HBCP process offers a promising and efficient way to concentrate or convert nanoparticle dispersions into a stable dry powder form.
n-BA/KOH/t-BHP behaviour in the natural rubber latex vulcanization by gamma rays
International Nuclear Information System (INIS)
Souza, A. de.
1994-01-01
Natural rubber latex was vulcanized in the absence and in the presence of sensitizer (S), with gamma ray from 60 Co source, panoramic type, at the dose rate range of 1,20-1,33 kGy/h. The components of used S were n-butyl acrylate (n-BA), the KOH as stabilizer and t-butyl hydroperoxide (t-BHP) as co-S. The purpose of this work was to study the efficiency and the behaviour of each component of S in the irradiated latex crosslinking by tensile strength (T b ), volume fraction and permanent set. In the absence of S occur straight crosslinking between macromolecular adjacent radicals. IN the presence of S, the n-BA participates in the crosslinking through acrylic bridges between macromolecules. (author)
Latex paint as a delivery vehicle for diethylphthalate and di-n-butylphthalate
DEFF Research Database (Denmark)
Schripp, Tobias; Salthammer, Tunga; Fauck, Christian
2014-01-01
gas-phase concentration at steady state(y). For both, DEP and DnBP, the y0 obtained was lower than the respective saturation vapor pressure (Ps). Furthermore, for both phthalates in latex paint, the material/air partition coefficient (C0/y0) was close in value to the octanol/air partition coefficient...
Energy Technology Data Exchange (ETDEWEB)
Nosrati, Rahimeh, E-mail: ra.nosrati@gmail.com [Polymer Composite Research Laboratory, Department of Applied Chemistry, Faculty of Chemistry, University of Tabriz, Tabriz (Iran, Islamic Republic of); Olad, Ali, E-mail: a.olad@yahoo.com [Polymer Composite Research Laboratory, Department of Applied Chemistry, Faculty of Chemistry, University of Tabriz, Tabriz (Iran, Islamic Republic of); Nofouzi, Katayoon, E-mail: nofouzi@tabrizu.ac.ir [Faculty of Veterinary Medicine, University of Tabriz, Tabriz (Iran, Islamic Republic of)
2015-08-15
Graphical abstract: - Highlights: • A novel nanocomposite coating based on polyacrylic was prepared. • Nanostructured TiO{sub 2}/Ag-exchanged-zeolite-A composite material was prepared. • Prepared nanocomposite used as additive for modification of polyacrylic latex. • Modified coatings show self-cleaning and antibacterial properties. • Modified coatings show better stability in water in versus of unmodified polymer. - Abstract: The commercial grade polyacrylic latex was modified in order to prepare a self-cleaning coating. TiO{sub 2}/Ag-exchanged-zeolite-A nanocomposite was prepared and used as additive in the matrix of polyacrylic latex to achieve a hydrophilic and photocatalytic coating. FTIR and UV–visible spectroscopy, X-ray diffraction patterns and FESEM were used to characterize the composition and structure of the nanocomposites and coatings. The acrylic coatings, were prepared by using of TiO{sub 2}/Ag-exchanged-zeolite-A additive, had better UV and visible light absorption, hydrophilic, degradation of organic pollutants, stability in water and antimicrobial properties than pristine commercial grade polyacrylic latex coating. According to the results, the modified polyacrylic based coating containing 0.5 wt% of TiO{sub 2}/Ag-exchanged-zeolite-A nanocomposite additive with TiO{sub 2} to Ag-exchanged-zeolite-A ratio of 1:2 was the best coating considering most of useful properties such as small band gap and low water contact angle. The water contact angle for unmodified polyacrylic latex coating was 68° which was decreased to less than 10° in modified coating after 24 h LED lamp illumination.
International Nuclear Information System (INIS)
Watson, J.G.; Chow, J.C.; Egami, R.T.; Bowen, J.L.; Frazier, C.A.
1991-06-01
The State of California monitors the concentrations of acidic gases and particles at 10 sites throughout the state. Seven sites represent urban areas (South Coast Air Basin - three sites, San Francisco Bay Area, Bakersfield, Santa Barbara, and Sacramento) and three represent forested areas (Sequoia National Park, Yosemite National Park, and Gasquet). Several sites are collocated with monitoring instruments for other air quality and forest response networks. Continuous monitors for the dry deposition network collect hourly average values for ozone, wind speed, wind direction, atmospheric stability, temperature, dew point, time of wetness, and solar radiation. A newly-designed gas/particle sampler collects daytime (6 a.m. to 6 p.m.) and nighttime (6 p.m. to 6 a.m.) samples every sixth day for sulfur dioxide, ammonia, nitrogen dioxide, and nitric acid. Particles are collected on the same day/night schedule in PM(10) and PM(2.5) size ranges, and are analyzed for mass, sulfate, nitrate, chloride, ammonium, sodium, magnesium, potassium, and calcium ions. The sampling schedule follows the regulatory schedule adopted by the EPA and ARB for suspended particulate matter. Wet deposition data are collected at or nearby the dry deposition stations. The first year of the monitoring program included installation of the network, training of technicians, acquisition and validation of data, and transfer of the sampling and analysis technology to Air Resources Board operating divisions. Data have been validated and stored for the period May, 1988 through September, 1989
Directory of Open Access Journals (Sweden)
Cristiane K. Santin
2012-01-01
Full Text Available O comportamento da borracha natural na forma látex frente à reação de epoxidação foi avaliado visando estabelecer as melhores condições reacionais sem a ocorrência de reações laterais, que promovem a coagulação do látex e o desenvolvimento de um aglomerado de borracha. Grupos epóxidos foram gerados através da reação de epoxidação a partir da formação in situ do ácido perfórmico. As amostras foram caracterizadas qualitativamente por espectroscopia de infravermelho (FTIR e o grau de modificação determinado por ressonância magnética nuclear de hidrogênio (1H-RMN. Análises de calorimetria exploratória diferencial (DSC demonstraram que a mobilidade da cadeia polimérica foi influenciada pela presença de grupos epóxidos, com aumento linear na temperatura de transição vítrea (Tg. Os resultados indicaram que a epoxidação do látex de borracha natural, sem a ocorrência de reações laterais, é possível e dependente das condições reacionais.Natural rubber latex was submitted to epoxidation reaction to establish the best reaction conditions without the occurrence of side reactions, which promote coagulation of the latex and development of an agglomerate of rubber. Epoxy groups were produced by in situ epoxidation with formic acid and hydrogen peroxide. The samples were characterized qualitatively by Fourier Transform Infrared (FTIR analysis and the degree of modification determined by Hydrogen Nuclear Magnetic Resonance Spectroscopy (1H-NMR analysis. A linear increase in the glass transition temperature (Tg was observed. The results show that the epoxidation of natural rubber latex is possible and depends on the reaction conditions.
ROZEBOOM, HJ; BUDIANI, A; BEINTEMA, JJ
1990-01-01
Hevamine, an enzyme with both lysozyme and chitinase activity, was isolated and purified from Hevea brasiliensis (rubber tree) latex. The enzyme (molecular weight 29,000) is homologous to certain “pathogenesis-related” proteins from plants, but not to hen egg-white or phage T4 lysozyme. To
Enhancing Student Writing and Computer Programming with LATEX and MATLAB in Multivariable Calculus
Sullivan, Eric; Melvin, Timothy
2016-01-01
Written communication and computer programming are foundational components of an undergraduate degree in the mathematical sciences. All lower-division mathematics courses at our institution are paired with computer-based writing, coding, and problem-solving activities. In multivariable calculus we utilize MATLAB and LATEX to have students explore…
Influence of wearing latex gloves on electric pulp tester readings in children.
Holan, G
1993-12-01
Electric pulp testers operated by completing an electric circuit. Latex examination gloves have been claimed to interrupt this circuit and lead to false-negative results. This study was conducted to evaluate the influence of wearing latex gloves on electric pulp tester (EPT) readings. The pulps of 80 maxillary permanent incisors of 22 children 10-13 1/2 years old were tested using the Pelton & Crane 'Vitapulp' instrument. Each tooth was tested twice: with gloves and with bare hands. Teeth failing to respond to the EPT without gloves were excluded from the study. All EPT readings ranged between 1 and 9.5. Five teeth gave the same responses with gloved and ungloved hands. Only five teeth did not respond when gloves were worn, and all of these gave readings near the top of the EPT scale when tested without gloves. The other 70 teeth presented significantly higher readings with gloves than without gloves. It is concluded that removal of examination gloves during the operation of the EPT is necessary only if no response is obtained.
McAdam, Scott A. M.
2017-01-01
Angiosperms are able to respond rapidly to the first sign of dry conditions, a decrease in air humidity, more accurately described as an increase in the vapor pressure deficit between the leaf and the atmosphere (VPD), by abscisic acid (ABA)-mediated stomatal closure. The genes underlying this response offer valuable candidates for targeted selection of crop varieties with improved drought tolerance, a critical goal for current plant breeding programs, to maximize crop production in drier and increasingly marginalized environments, and meet the demands of a growing population in the face of a changing climate. Here, we review current understanding of the genetic mechanisms underpinning ABA-mediated stomatal closure, a key means for conserving water under dry conditions, examine how these mechanisms evolved, and discuss what remains to be investigated. PMID:29113039
New nanocomposites of polystyrene with polyaniline doped with lauryl sulfuric acid
Pud, A. A.; Nikolayeva, O. A.; Vretik, L. O.; Noskov, Yu. V.; Ogurtsov, N. A.; Kruglyak, O. S.; Fedorenko, E. A.
2017-08-01
This work is concentrated on synthesis and investigation of new core-shell nanocomposites of polystyrene (PS) with doped polyaniline (PANI). The latex containing PS nanoparticles with sizes of 15-30 nm was prepared by microemulsion polymerization of styrene in water media. The PS/PANI nanocomposites were synthesized by chemical oxidative polymerization of aniline in the PS latex media in a presence of lauryl sulfuric acid (LSA), which served as both dopant and plasticizer. The real content of PANI in the synthesized nanocomposites was determined by UV-Vis spectroscopy method. The composition of the nanocomposites and oxidation state of the doped polyaniline were characterized by FTIR spectroscopy. The core-shell morphology of the nanocomposite nanoparticles was proved by transmission and scanning electron microscopy. It was found that conductivity and thermal behavior in air of these nanocomposites not only nonlinearly depended on the doped polyaniline content but also were strongly effected both by plasticizing properties of the acid-dopant and presence of the polyaniline shell. A possibility of application of these nanocomposites as sensor materials has been demonstrated.
Directory of Open Access Journals (Sweden)
Piyanuch Piyatrakul
Full Text Available The AP2/ERF superfamily encodes transcription factors that play a key role in plant development and responses to abiotic and biotic stress. In Hevea brasiliensis, ERF genes have been identified by RNA sequencing. This study set out to validate the number of HbERF genes, and identify ERF genes involved in the regulation of latex cell metabolism. A comprehensive Hevea transcriptome was improved using additional RNA reads from reproductive tissues. Newly assembled contigs were annotated in the Gene Ontology database and were assigned to 3 main categories. The AP2/ERF superfamily is the third most represented compared with other transcription factor families. A comparison with genomic scaffolds led to an estimation of 114 AP2/ERF genes and 1 soloist in Hevea brasiliensis. Based on a phylogenetic analysis, functions were predicted for 26 HbERF genes. A relative transcript abundance analysis was performed by real-time RT-PCR in various tissues. Transcripts of ERFs from group I and VIII were very abundant in all tissues while those of group VII were highly accumulated in latex cells. Seven of the thirty-five ERF expression marker genes were highly expressed in latex. Subcellular localization and transactivation analyses suggested that HbERF-VII candidate genes encoded functional transcription factors.
Directory of Open Access Journals (Sweden)
Jung-Hwan Lee
2014-01-01
Full Text Available Understanding the biocompatibility of nanoparticles in dental materials is essential for their safe usage in the oral cavity. In this study, we investigated whether nanoparticles deposited on orthodontic latex rubber bands are involved in the induction of cytotoxicity. A method of stretching to three times (“3L” the length of the latex rubber bands was employed to detach the particles using the original length (“L” for comparison. The cytotoxicity tests were performed on extracts with mouse fibroblasts (L929 and human gingival fibroblasts (HGFs. Fourier transform infrared spectroscopy, ion chromatography, elemental analysis, and inductively coupled plasma mass spectrometry (ICP-MS were performed to detect the harmful components in the extracts from rubber bands. There was a significant decrease in the cell viability in the “L” samples compared with the “3L” samples (P<0.05 in the L929 and HGF cells. This was due to the Ni single crystal nanoparticles (~50nm from the inner surface of “L” samples that were detached in the “3L” samples as well as the Zn ion (~9 ppm detected in the extract. This study revealed that the Ni nanoparticles, as well as Zn ions, were involved in the induction of cytotoxicity from the latex rubber bands.
International Nuclear Information System (INIS)
Utama, Marga; Yoshii, F.; Kume, T.
2006-01-01
Three importance factors for producing low protein by low energy electron beam (250 keV/10 mA) irradiation in pilot scale (20 liters per bath) with 1,9-nonediol diacrylate (NDA) namely: maturation time of natural rubber latex before irradiation, treatment of irradiated natural rubber latex (INRL) before and after centrifugation, and standard irradiation method has been carried out. The results showed that the optimum irradiation time for producing INRL with 5 phr (part hundred ratio of rubber) of NDA as sensitize agent, and with the rotation speed of agitation 210 rpm (rotation per minutes) was between 20-30 minutes. By using this condition tensile strength of the INRL film was 26 MPa. The maturation of natural rubber latex before irradiation is the key for driving the quality of INRL. Water extractable protein content of INRL after leaching in 1% ammonia solution for 30 minutes at room temperature was around 47 μ/g, and after adding with 1 phr of PVA (poly vinyl alcohol) or 0.1 phr CMC (carboxy methyl cellulose) the water extractable protein content decrease less than 6 μ/g. (author)
Manoorkar V B; Mandge S V; B D Gachande
2015-01-01
In present study, aqueous and ethanol extracts of leaf & latex of Calotropis procera (Ait.) was tested for their antifungal activity against dominant storage seed-borne fungi of some oil seeds such as groundnut, soybean, sunflower and mustard. The antifungal effect of ethanol and aqueous extracts of leaf & latex of Calotropis procera (Ait.) against ten seed-borne dominant fungi viz., Cuvularia lunata, Alternaria alternata, Rhizoctonia solani, Fusarium solani, Penicillium chrysogenum, Asperg...
Cytotoxicity of latex and pharmacobotanical study of leaves and stem of Euphorbia umbellata (Janaúba
Directory of Open Access Journals (Sweden)
Lívia E.C. Luz
Full Text Available AbstractIn southern Brazil, the bottled latex of Synadenium grantii Hook f., Euphorbiaceae, is popularly used as a treatment of all types of cancer. Similarly, Synadenium umbellatum Pax. is used in the central western region of Brazil for the same purpose and in the same manner of use. Both plants are popularly known as janaúba or leitosinha. The objectives of this study were to use pharmacobotanical analysis to verify whether these two species, which are considered to be distinct, are actually the same to determine anatomical markers; to assist in the identification and differentiation of other Euphorbia; and to evaluate the cytotoxic activity of the latex in relation to HeLa and HRT-18 cells. Leaves and stems of the species were collected in Goiânia and Ponta Grossa and were investigated using scanning electron microscopy and optical microscopy techniques. The latex was also collected and analyzed in relation to its cytotoxic effect by employing MTT and NR techniques. The pharmacobotanical study of the specimens in both localities showed that they were the same species, namely Euphorbia umbellata (Pax Bruyns, which is the scientific nomenclature accepted and confirmed by an expert taxonomist who specializes in Euphorbia. The pharmacobotanical characteristics highlighted in this study can assist in the identification of the taxon and contribute to the control of the quality of this plant drug. The evaluation of the latex in relation to HRT-18 cells demonstrated action after 48 h of experiment. In contrast, in relation to HeLa cells its induced cytotoxicity in all times and a dose-dependent manner. The IC50 values (72 h observed were 252.58 ± 18.51 µg/ml and 263.42 ± 15.92 µg/ml to MTT experiment and 250.18 ± 19.48 µg/ml and 430.56 ± 19.71 µg/ml to NR experiment for the HeLa and HRT-18 cells, respectively.
Marketing techniques and cost calculations of radiation vulcanised natural rubber latex (RVNRL)
International Nuclear Information System (INIS)
Wan Manshol Wan Zin; Chai Chee Keong; Najib Mohammed Zakey; Hafizuddin Maseri
2005-01-01
This paper describes how RVNRL is promoted to the latex based industries locally and abroad. RVNRL promotion requires patience and very challenging. This is a fact since the product is new to the market. Cost is important in deciding its market and potential usage. The elements that contribute to the cost is described in this paper. (Author)
Directory of Open Access Journals (Sweden)
Brzhesky VV
2014-06-01
Full Text Available Vladimir Vsevolodovich Brjesky,1 Yury Fedorovich Maychuk,2 Alexey Vladimirovich Petrayevsky,3 Peter Gerrievich Nagorsky41Department of Ophthalmology, Pediatric State Medical Academy, Saint Petersburg, 2Moscow Research Institute of Eye Diseases, Moscow, 3Department of Ophthalmology, Volgograd State Medical University, Volgograd, 4Novosibirsk Branch of the Federal State Institute MNTK Eye Microsurgery, Novosibirsk, Russian Federation, RussiaAbstract: Artificial tear preparations are important in the management of dry eye syndrome. We present the findings from four recently published studies conducted in Russia assessing Hylabak® (marketed as Hyabak® in Europe, a preservative-free hyaluronic acid preparation, for the treatment of dry eye syndrome. All studies had an open, noncomparative design, but one compared the findings with those from 25 patients treated with Tear Naturale® in previous studies. A total of 134 children and adults were enrolled, and the etiologies of dry eye syndrome included contact lens use, intensive office work, adenovirus eye infection, postmenopausal status, persistent meibomian blepharitis, Sjögren's syndrome, phacoemulsification with intraocular lens implantation, and refractive surgery. The patients were treated with Hylabak for 2 weeks to 2 months. All studies showed that Hylabak resulted in marked improvement as assessed by subjective sensations/complaints, Schirmer's test, Norn’s test, impression cytology and biomicroscopy, staining, and tear osmolarity. Greater benefits were also reported compared with Tear Naturale, including a faster onset of action. Hylabak was well tolerated. In conclusion, Hylabak provided rapid and safe relief from the signs and symptoms of dry eye syndrome, as well as improvement in objective measures, in a wide range of patients.Keywords: dry eye, eye drops, artificial tears, hyaluronic acid, Hylabak®, preservative-free
International Nuclear Information System (INIS)
Devendra, R.; Kulatunge, S.; Chandralal, H.N.K.K.; Kalyani, N.M.V.; Seneviratne, J.; Wellage, S.
1996-01-01
Radiation Vulcanization of natural rubber latex has been developed extensively through various research and development programme. During these investigations many data was collected and from these data it was proved that radiation vulcanized natural rubber latex (RVNRL) can be used as a new material for industry (RVNRL symposium 1989; Makuuchi IAEA report). This material has been extensively tested in making of dipped goods and extruded products. However these investigations were confined only to laboratory experiments and these experiments mainly reflected material properties of RVNRL and only a little was observed about its behavior in actual production scale operation. The present exercise was carried out mainly to study the behavior of the material in production scale by irradiating latex on a large scale and producing gloves in a production scale plant. It was found that RVNRL can be used in conventional glove plants without making major alteration to the plant. Quality of the gloves that were produced using RVNRL is acceptable. It was also found that the small deviation of vulcanization dose will affect the crosslinking density of films. This will drastically reduce the tensile strength of the film. Crosslinking density or pre-vulcanized relax modulus (PRM) at 100% is a reliable property to control the pre vulcanization of latex by radiation
Solar drying of rose (Rosa sp.) petals
Energy Technology Data Exchange (ETDEWEB)
Balladin, D.A.; Headley, Oliver [University of the West Indies, Center for Resource Management and Environmental Studies, St. Michael (Barbados)
1999-10-01
The rose (Rosa sp.) petals can be dried after 2 days at about 30degC reaching an equilibrium moisture content after 16 h using the solar wire basket dryer. The initial moisture content (wet wt basis) and final moisture content (dry wt basis), determined by the Dean-Stark toluene were 65.7 and 25.2% respectively. The intensity of the rose red coloured pigment (pelargonidin) decreased by a factor of 2.5 after drying. The pelargonidin ethanoic extract as an acid-base indicator, has a K{sub 4} value of 1 x 10{sup -4} mol 1{sup -1} and pH of end point 4 and imbibed on filter paper and allowed to air dry for 5 min showed excellent properties as acid-based test tapes. (Author)
Air-drying paint compositions comprising carbohydrate-based polyesters and polyester preparation
Oostveen, E.A.; Weijnen, J.; Haveren, van J.; Gillard, M.
2003-01-01
The invention relates to a polyester obtainable by transesterification or interesterification of:(i) a carbohydrate or an acyl ester thereof, (ii) an alkyl ester of a drying fatty acid, semi-drying fatty acid or mixture thereof; and (iii) an alkyl ester of a non aromatic polycarboxylic acid. The
Oláh, A.; Hempenius, Mark A.; Vancso, Gyula J.
2004-01-01
In this research, novel 3-(2-pyridyl)propyl methacrylate and 3-(3-pyridyloxy)propyl methacrylate monomers were synthesized and emulsion polymerized on colloidal polystyrene seeds, resulting in core–shell latex systems. The cores and the core–shell particles were characterized by static light
DEFF Research Database (Denmark)
Pedersen, Mads Brøgger; Bunzel, Mirko; Schäfer, Judith
2015-01-01
Ferulic acid dehydrodimers- (DFA) and trimers (TriFA) ester-linked to plant cell wall polymers may not only cross-link cell wall polysaccharides, but also other cell wall components including proteins and lignin, thus, enhancing the rigidity and potentially affect the enzymatic degradation...... of the plant cell wall. Corn-, wheat-, and mixed cereal distillers dried grains with solubles (DDGS) were investigated for composition of DFAs and TriFAs by reversed phase high performance liquid chromatography with ultra violet detection. Corn DDGS contained 5.3 and 5.9 times higher contents of total DFAs...... acid cross-links in the corn cell wall are presumably not modified during fermentation and DDGS processing....
Emami, Fakhrossadat; Vatanara, Alireza; Najafabadi, Abdolhosein Rouholamini; Kim, Yejin; Park, Eun Ji; Sardari, Soroush; Na, Dong Hee
2018-07-01
The purpose of this study was to prepare spray freeze-dried particles of immunoglobulin G (IgG) using various combinations of trehalose and different amino acids (leucine, phenylalanine, arginine, cysteine, and glycine), and investigate the effect of the amino acids on the stability of IgG during the spray freeze-drying (SFD) process and storage. The morphology and structural integrity of the processed particles were evaluated by physical and spectroscopic techniques. SFD-processed IgG without any excipient resulted in the formation of aggregates corresponding to approximately 14% of IgG. In contrast, IgG formulations stabilized using an optimal level of leucine, phenylalanine, or glycine in the presence of trehalose displayed aggregates <2.2%. In particular, phenylalanine combined with trehalose was most effective in stabilizing IgG against shear, freezing, and dehydration stresses during SFD. Arginine and cysteine were destabilizers displaying aggregation and fragmentation of IgG, respectively. Aggregation and fragmentation were evaluated by dynamic light scattering, ultraviolet spectrophotometry, size-exclusion chromatography, and microchip capillary gel electrophoresis. The IgG formulations prepared with leucine, phenylalanine, or glycine in the presence of trehalose showed good stability after storage at 40 °C and 75% relative humidity for 2 months. Thus, a combination of the excipients trehalose and uncharged, nonpolar amino acids appears effective for production of stable SFD IgG formulations. Copyright © 2018 Elsevier B.V. All rights reserved.
Quality of pomegranate pomace as affected by drying method.
Cano-Lamadrid, Marina; Lech, Krzysztof; Calín-Sánchez, Ángel; Rosas-Burgos, Ema Carina; Figiel, Adam; Wojdyło, Aneta; Wasilewska, Malwina; Carbonell-Barrachina, Ángel A
2018-03-01
During the industrial manufacturing of pomegranate juice, large amounts of pomace are produced. The aim of this work was to find the effective method to dry pomegranate pomace to open new commercial applications for this co-product. The effects of three drying methods: (i) convective drying (CD) at 50, 60, and 70 °C; (ii) vacuum microwave drying (VMD) at 240, 360, and 480 W, and (iii) a combined method (CPD-VMFD); convective pre-drying (60 °C) followed by vacuum microwave finish drying (360 W), on drying kinetics and quality of PomP (pomegranate pomace obtained after preparing pomegranate juice by squeezing only arils) were evaluated. The shortest treatments were VMD at 240 and 360 W (52 and 33 min, respectively); besides, these treatments led to interesting values of the green-red coordinate, a *, (12.2 and 4.1, respectively), total phenolic content (4.0 and 4.1 mg eq gallic acid g -1 dry weight, respectively), and antioxidant activity (30.8 and 29.0 µmol g -1 dry weight, respectively). On the other hand, this study demonstrated that this co-product is a rich source of punicic acid (average value = 66.4%), being a good opportunity for the pharmaceutical and nutraceutical industries. Moreover, no significant changes in the fatty acid profile was observed as affected by the drying treatments, and no off-flavors were generated by any of the drying methods.
The effect of residual water on antacid properties of sucralfate gel dried by microwaves.
Gainotti, Alessandro; Losi, Elena; Colombo, Paolo; Santi, Patrizia; Sonvico, Fabio; Baroni, Daniela; Massimo, Gina; Colombo, Gaia; Del Gaudio, Pasquale
2006-03-01
The aim of this work was to study the acid neutralization characteristics of microwave-dried sucralfate gel in relation to the water content and physical structure of the substance. Several dried sucralfate gels were compared with humid sucralfate gel and sucralfate nongel powder in terms of neutralization rate and buffering capacity. Humid sucralfate gel and microwave-dried gel exhibited antacid effectiveness. In particular, the neutralization rate of dried gel powders was inversely related to the water content: as the water content of dried powders decreased, the acid reaction rate linearly increased. The relationship was due to the different morphology of dried sucralfate gels. In fact, the porosity of the dried samples increased with the water reduction. However, the acid neutralization equivalent revealed that the dried sucralfate gel became more resistant to acid attack in the case of water content below 42%. Then, the microwave drying procedure had the opposite effect on the reactivity of the aluminum hydroxide component of dried sucralfate gel powders, since the rate of the reaction increased whereas the buffering capacity decreased as the amount of water was reduced.
Energy Technology Data Exchange (ETDEWEB)
Nomura, Toshiyuki, E-mail: nomura@chemeng.osakafu-u.ac.jp; Kuriyama, Yuta; Tokumoto, Hayato; Konishi, Yasuhiro [Osaka Prefecture University, Department of Chemical Engineering (Japan)
2015-02-15
The cytotoxicity and colloidal behavior of surface-functionalized polystyrene latex (PSL) nanoparticles (NPs) (nominal diameter: 100 nm) toward a model gram positive bacterium Lactococcus lactis JCM 5805 were examined. Nearly all the L. lactis cells exposed to the negatively charged PSL NPs survived because the surface of the bacterial cell was charged negatively, and the NPs therefore hardly adhere to the cell surface. In contrast, the positively charged PSL NPs adhered to the L. lactis cell surface but were not entrapped within the cell, and cell death subsequently occurred. The bacterial growth curves after the toxic NP exposure suggested that NP toxicity did not affect the specific growth phase, but did affect lag time. These results indicated that the cells were damaged by the cell disruption that resulted from the adhesion of the NPs to the cell surface. Finally, the cytotoxicity of the toxic, positively charged PSL NPs toward L. lactis was compared with that displayed toward a model gram negative bacterium Escherichia coli and a model eukaryote Saccharomyces cerevisiae. The cytotoxic behaviors of NPs on L. lactis and E. coli were similar, and depended not on the bacterial surface structure, but rather the environmental ionic strength. In contrast, the cytotoxicity of the prokaryote bacteria was higher than that toward the model eukaryote S. cerevisiae. The difference between the NP sensitivities of the prokaryote and eukaryote resulted from the prokaryote’s lack of an endocytotic pathway.
Nomura, Toshiyuki; Kuriyama, Yuta; Tokumoto, Hayato; Konishi, Yasuhiro
2015-02-01
The cytotoxicity and colloidal behavior of surface-functionalized polystyrene latex (PSL) nanoparticles (NPs) (nominal diameter: 100 nm) toward a model gram positive bacterium Lactococcus lactis JCM 5805 were examined. Nearly all the L. lactis cells exposed to the negatively charged PSL NPs survived because the surface of the bacterial cell was charged negatively, and the NPs therefore hardly adhere to the cell surface. In contrast, the positively charged PSL NPs adhered to the L. lactis cell surface but were not entrapped within the cell, and cell death subsequently occurred. The bacterial growth curves after the toxic NP exposure suggested that NP toxicity did not affect the specific growth phase, but did affect lag time. These results indicated that the cells were damaged by the cell disruption that resulted from the adhesion of the NPs to the cell surface. Finally, the cytotoxicity of the toxic, positively charged PSL NPs toward L. lactis was compared with that displayed toward a model gram negative bacterium Escherichia coli and a model eukaryote Saccharomyces cerevisiae. The cytotoxic behaviors of NPs on L. lactis and E. coli were similar, and depended not on the bacterial surface structure, but rather the environmental ionic strength. In contrast, the cytotoxicity of the prokaryote bacteria was higher than that toward the model eukaryote S. cerevisiae. The difference between the NP sensitivities of the prokaryote and eukaryote resulted from the prokaryote's lack of an endocytotic pathway.
International Nuclear Information System (INIS)
Nomura, Toshiyuki; Kuriyama, Yuta; Tokumoto, Hayato; Konishi, Yasuhiro
2015-01-01
The cytotoxicity and colloidal behavior of surface-functionalized polystyrene latex (PSL) nanoparticles (NPs) (nominal diameter: 100 nm) toward a model gram positive bacterium Lactococcus lactis JCM 5805 were examined. Nearly all the L. lactis cells exposed to the negatively charged PSL NPs survived because the surface of the bacterial cell was charged negatively, and the NPs therefore hardly adhere to the cell surface. In contrast, the positively charged PSL NPs adhered to the L. lactis cell surface but were not entrapped within the cell, and cell death subsequently occurred. The bacterial growth curves after the toxic NP exposure suggested that NP toxicity did not affect the specific growth phase, but did affect lag time. These results indicated that the cells were damaged by the cell disruption that resulted from the adhesion of the NPs to the cell surface. Finally, the cytotoxicity of the toxic, positively charged PSL NPs toward L. lactis was compared with that displayed toward a model gram negative bacterium Escherichia coli and a model eukaryote Saccharomyces cerevisiae. The cytotoxic behaviors of NPs on L. lactis and E. coli were similar, and depended not on the bacterial surface structure, but rather the environmental ionic strength. In contrast, the cytotoxicity of the prokaryote bacteria was higher than that toward the model eukaryote S. cerevisiae. The difference between the NP sensitivities of the prokaryote and eukaryote resulted from the prokaryote’s lack of an endocytotic pathway
Guo, Sheng; Duan, Jin-Ao; Zhang, Ying; Qian, Dawei; Tang, Yuping; Zhu, Zhenhua; Wang, Hanqing
2015-12-12
Chinese jujube (Ziziphus jujuba), a medicinal and edible plant, is widely consumed in Asian countries owing to the remarkable health activities of its fruits. To facilitate selection of the suitable processing method for jujube fruits, in this study their contents of triterpenic acids, nucleosides, nucleobases and saccharides after drying and steaming treatment were determined using ultra-high performance liquid chromatography and high performance liquid chromatography coupled with evaporative light scattering detector methods. The results showed that except for sucrose, the content levels of most analytes were increasing in the jujube fruits during drying treatment at 45 °C. The levels of cyclic nucleotides such as adenosine 3',5'-cyclic monophosphate and guanosine 3',5'-cyclic monophosphate, were significantly decreased after the fruits were steamed. Therefore, owing to the bioactivities of these components for human health, the dried fruits would be the better choice as medicinal material or functional food, and dried jujube fruit should not be further steamed.
Nucleic acid detection with surface plasmon resonance using cationic latex
de Vries, E.F.A.; Schasfoort, Richardus B.M.; van der Plas, J.; Greve, Jan
1994-01-01
An affinity sensor based on Surface Plasmon Resonance (SPR) was used to detect nucleic acids. SPR is an optical technique that is able to detect small changes in the refractive index of the immediate vicinity of a metal surface. After a specific amplification of DNA, achieved using the polymerase
Yan, Ning; Wan, Xiao-Fang; Chai, Xin-Sheng; Chen, Run-Quan; Chen, Chun-Xia
2017-12-29
This paper reports on an ionic-liquid assisted headspace gas chromatographic (HS-GC) for the determination of the content of alkyl ketene dimer (AKD) in its latex samples, in which the GC system was equipped with a thermal conductivity detector (TCD). The method was based on the AKD hydrolysis conducted in 1-butyl-3-methylimidazolium chloride (ionic-liquid) added medium at 100°C for 10min in a closed headspace sample vial, and the measured CO 2 (the resulting product of the hydrolysis) by HS-GC. The results showed that the present method has a good measurement precision (RSD <2.3%) and accuracy (recoveries from 96 - 105%), and the limit of quantitation (LOQ) is 0.9%. The present method is very suitable to be used for the routine check of AKD content in its latex sample in mill applications. The study also showed that the content of AKD in the tested commercial latex samples were in the range of 3.5-12%. Copyright © 2017 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Siri-Upathum, Chyagrit; Boonyawat, Jariya
2007-08-01
Full text: Low molecular weight carboxy methyl cellulose (CMC), hydroxyl ethyl cellulose (HEC), hydroxyl propyl cellulose (HPC) and methyl cellulose (MC) prepared by radiation-induced degradation were added into diluted natural concentrated latex prior to centrifuge for a purpose of reducing allergenic rubber protein in the latex. Optimum molecular weight (Mv) of CMC and HEC for such a purpose was found to be 17-18 kDa which decreased allergenic rubber protein (14-94 kDa) to an undetectable amount as determined by SDS PAGE method
Antifungal activity evaluation of Aloe arborescens dry extract against trichosporon genus yeasts
Directory of Open Access Journals (Sweden)
João Ricardo Bueno de Morais Borba
2014-10-01
Full Text Available The objective of this study was to investigate the antifungal activity of Aloe arborescens dry extract against Trichosporon genus yeast species. Extraction was carried out by means of a longitudinal incision in fresh leaves, which were collected on a vat, and the total volume was frozen and subsequently lyophilized. Then, 40 mg of the dry extract was dissolved in DMSO by gentle inversion in order to obtain a solution whose concentration was 4000 µg mL-1. This solution became limpid and slightly yellowish because the pigment of the latex was attenuated. It was performed serial dilutions from 2,000 to 15.625 µg mL-1 with RPMI-1640 broth. There was already no pigment in the first dilution of 2000 μg mL-1. It was analyzed fifteen strains of Trichosporon spp., and Candida albicans ATCC 10231 was used as control strain. We carried out the reading of microplates in the ELISA reader device at a wavelength of 530 nm, after incubation for 24 and 48 hours, and it was determinated the Minimum Inhibitory Concentration (MIC. The MIC50 value obtained for all Trichosporon species and for C. albicans was 500 µg mL-1. As a result, we concluded that Aloe arborescens dry extract has antifungal activity against Trichosporon yeasts.
Brandão, Marcelo Luiz; Reis, Paulo Roberto Melo; Araújo, Lilhian Alves de; Araújo, Ana Carolina Vicente; Santos, Maisa Helena de Abreu Silva; Miguel, Marina Pacheco
2016-09-01
To compare the use of latex derivative and Aloe vera extract to wound healing. Twenty one rats were randomly divided into three groups and each one had a wound made by incision. The treatment consisted in: derivative of latex (GL), Aloe vera extract (GA) and saline solution (GC). The wound area was measured on the 7th, 14th and 21st days and macroscopic and microscopic evaluation were done. The comparison between the measurements of the wounds presented statistical difference in GC and GA from the 7th day of evaluation and GL from the 14th day. The extent of the wound was significantly smaller by the 7th day in GL. Histologically, in GL, the neovascularization was significant on the 7th, 14th and 21st days. On the 21st day the scar was large and little mature. In GA and GC, the findings were similar on the 7th, 14th and 21st days with a slight better organization of skin and collagen on the 21st in GA. Statistical analysis did not allow for the definition of the best topical agent. The latex had the highest angiogenesis, but a possible foreign body granuloma. Aloe vera has revealed a healing process adequated temporally in histology.
Lipid transfer protein from Hevea brasiliensis (Hev b 12), a cross-reactive latex protein
Beezhold, Donald H.; Hickey, Vicky L.; Kostyal, David A.; Puhl, Henry; Zuidmeer, Laurian; van Ree, Ronald; Sussman, Gordon L.
2003-01-01
BACKGROUND: Latex-allergic individuals experience clinical cross-reactivity to a large number of fruits and vegetables. Much of the cross-reactivity can be attributed to Hev b 6, but evidence indicates that additional cross-reactive allergens may be present. A common pan-allergen, which has not
Energy Technology Data Exchange (ETDEWEB)
Kuntanoo, K., E-mail: thip-kk@hotmail.com [Graduate School of Khon Kaen University, Khon Kaen, 40002 Thailand (Thailand); Promkotra, S., E-mail: sarunya@kku.ac.th [Department of Geotechnology, Faculty of Technology, Khon Kaen University, Khon Kaen 40002 Thailand (Thailand); Kaewkannetra, P., E-mail: paknar@kku.ac.th [Department of Biotechnology, Faculty of Technology, Khon Kaen University, Khon Kaen 40002 Thailand (Thailand)
2015-03-30
A biopolymer of polyhydroxybutyrate-co-hydroxyvalerate (PHBV) is blended with bio-based materials, natural rubber latex, to improve their microstructures. The various ratios between PHBV and natural rubber latex are examined to develop their mechanical properties. In general, physical properties of PHBV are hard, brittle and low flexible while natural rubber (NR) is presented itself as high elastic materials. Concentrations of the PHBV solution are constituted at 1%, 2% and 3% (w/v). The mixtures of their PHBV solutions to natural rubber latex are produced the blended films in three different ratios of 4:6, 5:5 and 6:4, respectively. They are characterized by appearance analyses which are the scanning electron microscope (SEM), universal testing machine (UTM) and differential scanning calorimetry (DSC). The SEM photomicrographs of the blended films and the controlled PHBV can provide the void distribution in the range of 12-14% and 19-21%, respectively. For mechanical properties of the blended films, the various elastic moduli of 1%, 2% and 3% (w/v) PHBV are the average of 773, 956 and 1,007 kPa, respectively. The tensile strengths of the blends increase with the increased concentrations of PHBV, similarly trend to the elastic modulus. The crystallization and melting behavior of unmixed PHBV and the blends are determined by DSC. Melting transition temperatures (T{sub m}) of the unmixed PHBV are stated two melting peak at 154°C and 173°C. Besides, the melting peaks of the blends alter in the range of 152-156°C and 168-171°C, respectively. According to morphology of the blends, the void distribution decreases twice compared to the unmixed PHBV. The results of mechanical properties and thermal analysis indicate that the blended PHBV can be developed their properties by more resilient and wide range of temperature than usual.
Directory of Open Access Journals (Sweden)
Fátima Reyes-López
2015-08-01
Full Text Available Cholera is an acute contagious intestinal disease caused by ingestion of food or water contaminated with O1 and O139 serotypes of the bacterium Vibrio cholerae. Cholera is characterized by abundant secretory diarrhea leading to dehydration. Death occurs within hours without treatment, so early diagnosis is very important, especially at the beginning of the disease, because it is difficult to differentiate from other acute diarrheal diseases. The diagnostic golden test is the stool culture; however, it does not guarantee a rapid detection of the disease. Rapid tests have been recently developed; they are based on test strips and agglutination with latex particles, which are very effective, but difficult to acquire for their high prices. The objective of this research was to obtain a quick assay based on latex particles coupled with a monoclonal antibody (mAb against V. cholerae O1 lipopolysaccharide obtained in Finlay Institute. Latex particles of 0.8 µm were used in a 10% suspension, and they were coupled to the mAb (0.25 mg/ml for 2 hours at 37°C. The sensitivity, specificity and performance were evaluated in 84 stool samples from patients with presumptive diagnosis of cholera. The diagnostic test obtained showed no cross-reactivity against no-O1 strains and other enteropathogens. Latex diagnostic test showed values of sensitivity, specificity and efficacy of 97.87; 97.29 and 97.6% respectively, very similar to the commercial diagnostic test CTK- Biotech. The latex reagent obtained can be used in the rapid diagnosis of the disease.
The effect of proteins on the aging properties of radiation vulcanized natural rubber latex
International Nuclear Information System (INIS)
Abad, L.V.
1993-01-01
The effect of natural rubber latex (NRL) proteins on the aging properties of NRL films was investigated. SDS-PAGE electrophoresis of the rubber proteins in NRL (Sri-Lanka) indicated a total of 18 proteins. A sharp decrease in tensile strength was observed after aging when NRL films were leached in 1% NH 4 OH. However, when these films were soaked in ethanol prior to leaching, the aging properties approximated those of the unleashed samples. Electrophoretic analysis of the proteins present in the NH 3 extracts of leached RVNRL films showed a high concentration of the protein herein. This protein was not found in the NH 3 extracts of ethanol soaked films. NRL proteins were shown to decelerate the aging process of Radiation Vulcanized Natural Rubber Latex (RVNRL) films. Among the proteins, herein exhibited good anti-aging properties. The hydrolyzates from NR proteins also enhanced considerably the aging properties of RVNRL. (auth.). 8 refs.; 40 figs.; 30 tabs
Ajami, Shabnam; Farjood, Amin; Zare, Mahbubeh
2017-01-01
Latex elastics are still in common use due to their low cost and high flexibility to improve sagittal discrepancies or interdigitation of teeth. Mechanical properties of elastics are influenced by several environmental factors such as pH changes. This study evaluated similar latex elastics to define the influence of synergic effect of intermittent low pH and various baselines pH of saliva. Four groups of latex elastics (3-M Unitek, 3/16 inch) were tested ( n = 15 in each group). Two groups of elastics were immersed in two tanks of artificial saliva with different pH levels of 7 and 5, and two groups were immersed in two tanks of artificial saliva with intermittent drop of pH to 4. The force was measured when the elastics were stretched to 25 mm. These measurements were taken in 0, 4, 8, 12, 24, 36, and 48 h for each group. Repeated measures analysis of variance (RMANOVA) and post-hoc Tukey's test were used to assess the findings. The level of significance was 0.05%. The interaction between pH and time analyzed with RMANOVA showed no significant differences ( P > 0.05) except in 36 h ( P = 0.014). The Tukey's analysis showed that each comparison between any two groups did not indicate significant differences ( P > 0.05) except between Groups 1 and 3 and between Groups 2 and 3 ( P pH and force degradation in latex elastic band except in 36 h.
Natural rubber latex used as drug delivery system in guided bone regeneration (GBR
Directory of Open Access Journals (Sweden)
Rondinelli Donizetti Herculano
2009-06-01
Full Text Available In this work, we propose natural rubber latex (NRL membranes as a protein delivery system. For this purpose Bovine Serum Albumin (BSA was incorporated into the latex solution for in vitro protein delivery experiments. Different polymerization temperatures were used, from -10 to 27 °C, in order to control the membrane morphology. These membranes were characterized by Scanning Electron Microscopy (SEM, Atomic Force Microscopy (AFM, as well as the Lowry Method to measure the BSA release. SEM and AFM microscopy analysis showed that the number, size and distribution of pores in NRL membranes can be varied, as well as its overall morphology. We have found that the morphology of the membrane is the predominant factor for higher protein release, compared with pore size and number of pores. Results demonstrated that the best drug-delivery system was the membrane polymerized at RT (27 °C, which does release 66% of its BSA content for up to 18 days. Our results indicate that NRLb could be used in the future as an active membrane that could accelerate bone healing in GBR.
Composition, physical properties and drying characteristics of seed oil of Citrullus lanatus
Idris, S. A.; Rashidi, A. R.; Muhammad, A.; Abdullah, M.; Elham, O. S. J.; Mamat, M. S.
2017-09-01
A study to investigate the effect of different drying methods for the pre-treatment process on the quality and quantity of oil extracted from Citrulllus lanatus seeds was conducted. The red type Citrulllus lanatus seeds from local supermarket in Shah Alam is used in this experiment. The amount of seed was divided into two portions; one portion was subjected to sun drying while the other portion was subjected to oven drying (at a temperature of 70°C). After the drying process, the seeds were ground in a laboratory grinder to turn them into powder. The ground seeds then will be fed to Supercritical Carbon Dioxide unit (SC-CO2) for extraction. Once the extracted oil is obtained, it will be analysed by using Gas Chromatography and Mass Spectrometer (GC-MS). Results indicated that the amount of the moisture content from the sun-dried was lower compared to oven-dried. The results also indicated that, there were no significant difference in the quantity of oil obtained from both samples of oven-dried and sun-dried. However, the acid value and other component content in the sample were higher in the sun-dried sample relative to the oven-dried sample. Linoleic acid is the only compound that was found in the oven-dried sample, whereas linoleic acid and oleic acid were found in the sun-dried sample. Based on the results, it shows that the drying effect were important when the quality of oil was to be considered. The other compounds like Naphtalenol, 9-17-Octadecadeinal, 2-Chloroethyl linoleate, and Carboxin also are found in the sun-dried sample. Other that that, drying method does not give any effect to the physical appearance of the extracted oil, as similar color and other physical appearance was produced by the both sample.
Validation for radiation sterilization of surgical latex glove
International Nuclear Information System (INIS)
Liu Degui
2002-01-01
Objective: To determine the optimal radiation mode for sterilization of surgical latex gloves. Methods: The dose distribution in the product loads inside radiation container was measured in different radiation mode. Results: Data of dose distribution in the product load in different radiation mode were obtained. Conclusion: At pre-set height of source working position and within pre-determined dwelling time of each irradiation container staying at the irradiation position, the delivered dose can meet the customers requirement by the radiation mode that, in the half cycle of radiation process, turns the horizontal middle layers of the product to the upper or lower layers, and the upper and lower layers to the middle layers
DEFF Research Database (Denmark)
Johansen, Marianne; Lund, Peter; Weisbjerg, Martin Riis
2018-01-01
Our previous study showed that supply of metabolisable protein (MP) to lactating dairy cows increased with increasing dry matter (DM) concentration in grass-clover silage. The aim of this study was to examine how amino acid (AA) profile of MP was affected by silage DM concentration. Eight grass-c...
JEKEL, PA; HARTMANN, JBH; BEINTEMA, JJ
1991-01-01
The primary structure of hevamine, an enzyme with lysozyme/chitinase activity from Hevea brasiliensis latex, has been determined predominantly with conventional non-automatic methods. The positions of three disulfide bridges have been determined. The sequence has about 60% identity with that of a
Nghiem, Nhuan P; Montanti, Justin; Kim, Tae Hyun
2016-05-01
Dried distillers grains with solubles (DDGS), a co-product of corn ethanol production in the dry-grind process, was pretreated by soaking in aqueous ammonia (SAA) using a 15 % w/w NH4OH solution at a solid/liquid ratio of 1:10. The effect of pretreatment on subsequent enzymatic hydrolysis was studied at two temperatures (40 and 60 °C) and four reaction times (6, 12, 24, and 48 h). Highest glucose yield of 91 % theoretical was obtained for the DDGS pretreated at 60 °C and 24 h. The solubilized hemicellulose in the liquid fraction was further hydrolyzed with dilute H2SO4 to generate fermentable monomeric sugars. The conditions of acid hydrolysis included 1 and 4 wt% acid, 60 and 120 °C, and 0.5 and 1 h. Highest yields of xylose and arabinose were obtained at 4 wt% acid, 120 °C, and 1 h. The fermentability of the hydrolysate obtained by enzymatic hydrolysis of the SAA-pretreated DDGS was demonstrated in ethanol fermentation by Saccharomyces cerevisiae. The fermentability of the hydrolysate obtained by consecutive enzymatic and dilute acid hydrolysis was demonstrated using a succinic acid-producing microorganism, strain Escherichia coli AFP184. Under the fermentation conditions, complete utilization of glucose and arabinose was observed, whereas only 47 % of xylose was used. The succinic acid yield was 0.60 g/g total sugar consumed.
Effect of wine inhibitors on the proteolytic activity of papain from Carica papaya L. latex.
Benucci, Ilaria; Esti, Marco; Liburdi, Katia
2015-01-01
The influence of potential inhibitors naturally present in wine on the proteolytic activity of papain from Carica papaya latex was investigated to evaluate its applicability in white wine protein haze stabilization. Enzymatic activity was tested against a synthetic tripeptide chromogenic substrate in wine-like acidic medium that consisted of tartaric buffer (pH 3.2) supplemented with ethanol, free sulfur dioxide (SO2 ), grape skin and seed tannins within the average ranges of concentrations that are typical in wine. The diagnosis of inhibition type, performed with the graphical method, demonstrated that all of tested wine constituents were reversible inhibitors of papain. The strongest inhibition was exerted by free SO2 , which acted as a mixed-type inhibitor, similar to grape skin and seed tannins. Finally, when tested in table white wines, the catalytic activity of papain, even when if it was ascribable to the hyperbolic behavior of Michaelis-Menten equation, was determined to be strongly affected by free SO2 and total phenol level. © 2014 American Institute of Chemical Engineers.
The role of proteins on the thermal oxidative aging of radiation vulcanized natural rubber latex
International Nuclear Information System (INIS)
Abad, L.V.; Rosa, A. de la; Keizo Makuuchi; Fumio Yoshii
1996-01-01
The effect of Hevea latex proteins on the aging properties of radiation vulcanized natural rubber latex (RVNRL) was investigated. Unpurified RVNRL films exhibited better aging properties than the purified RVNRL films. A sharp decrease in tensile strength was observed after aging when RVNRL films were leached in 1% NH sub 4 OH. However, when these films were soaked in ethanol prior to leaching, the aging properties approximated those of the unleached samples. Kjeldahl and FT-IR analyses of the leached and unleached RVNRL films indicated a higher protein content for both the unleached and ethanol-soaked films than for leached films. Electrophoretic analysis of the proteins present in the NH, extracts of leached RVNRL films showed a high concentration of hevein. This protein was not found in the ATH, extracts of ethanol soaked films. Hevein was shown to improve the aging properties of RVNRL
Pei, Fei; Shi, Ying; Gao, Xingyang; Wu, Fangning; Mariga, Alfred Mugambi; Yang, Wenjian; Zhao, Liyan; An, Xinxin; Xin, Zhihong; Yang, Fangmei; Hu, Qiuhui
2014-12-15
Button mushroom slices were dehydrated using freeze drying (FD) or FD combined with microwave vacuum drying (FMVD), and the non-volatile component profiles were studied. The results showed that the level of non-volatile components in button mushroom firstly increased during sublimation of FD/FMVD process and then fell during desorption in FD process and MVD in FMVD process. Compared to FD products, the contents of soluble sugars and polyols in FMVD products were relatively low, whereas the contents of total free amino acids were significantly higher, close to the level of fresh mushroom. However, there was no significant difference in the contents of 5'-nucleotides and organic acids between FD and FMVD products. The equivalent umami concentration (EUC) values for FD and FMVD products did not differ from fresh, indicating that both drying methods could effectively preserve MSG (monosodium glutamate)-like components in button mushroom. Copyright © 2014 Elsevier Ltd. All rights reserved.
Gatell-Tortajada, Jordi
2016-01-01
To assess the benefits and tolerability of a dietary supplement based on omega-3 fatty acids to relieve dry eye symptoms. A total of 1,419 patients (74.3% women, mean age 58.9 years) with dry eye syndrome using artificial tears participated in a 12-week prospective study. Patients were instructed to take 3 capsules/day of the nutraceutical formulation (Brudysec(®) 1.5 g). Study variables were dry eye symptoms (scratchy and stinging sensation, eye redness, grittiness, painful and tired eyes, grating sensation, and blurry vision), conjunctival hyperemia, tear breakup time (TBUT), Schrimer I test, and Oxford grading scheme. At 12 weeks, each dry eye symptom improved significantly (Pdry eye symptoms were also found in compliant versus noncompliant patients as well as in those with moderate/severe versus none/mild conjunctival hyperemia. Oral ω-3 fatty acids supplementation was an effective treatment for dry eye symptoms.
Jarkasi, Siti Aisyah; Samsuri, Azemi; Hashim, M. Y. Amir; Kamarun, Dzaraini
2017-09-01
A study was structured to investigate the effects of two different approaches of black-filled NRL films preparation on tensile strengths and tensile stress at 100% strain (M100). In the "First Approach", carbon black dispersion was added into the NRL and mixed using mechanical stirrer. Then the black-filled NRL was coagulated with acetic acid and dried to form NR black-filled masterbatch. This black-filled NR masterbatch was then masticated and mixed with other compounding ingredients on the 2-roll mill. In the "Second Approach", carbon black dispersion was mixed with NRL plus all other compounding ingredients using a mechanical stirrer at high mechanical stirring speed (200 rpm) for 3 hrs. Tensile test-pieces from these two rubber specimens were tested according to ISO37. It was observed that the tensile strengths are affected by both methods. In the case of masticated latex masterbatch, the black-filled NRL films gave higher tensile strength (25-27 MPa) as compared to un-masticated black-filled NRL films (11-17 MPa). The optimum amount of filler loading for highest tensile strength in both approaches was 20 phr of carbon black. However these different approaches did not give significant effect to the elongation at break, EB and M100. SEM images of samples prepared from both approaches suggested that the dispersion of filler in the rubber matrix was better in the masticated samples compared to the un-masticated samples. The reason for the difference in the tensile strength between the two black-filled rubbers might be associated with the degree of dispersions and the uniformity of the dispersions within the rubber matrix. The first mixing approach involved high mechanical shearing action during mastication and mixing process on the 2-roll mill. The high shearing actions were able to breakdown filler aggregates efficiently and distributed the dispersed filler uniformly within the rubber matrix. In the second approach, the breakdown of filler aggregates relied on
Directory of Open Access Journals (Sweden)
Cong Wang
2018-01-01
Full Text Available A mixture of air-dried corn stover and cabbage waste was ensiled to preserve lignocellulosic biomass for use as biofuel. Furthermore, the effects of different fresh mass fractions (0.3 and 0.6 % of formic or acetic acid on the mixed silage quality were evaluated to guarantee its quality. The application of formic or acetic acid prior to mixing the silage led to higher water-soluble carbohydrate fractions than the negative control, indicating that both acids contributed to preservation of water-soluble carbohydrates during storage for 170 days. The dry matter content was also increased after storage from 90 to 170 days. It was found that the content of neutral and acid detergent fibre, cellulose and holocellulose (the sum of cellulose and hemicellulose in mixed silage treated with formic or acetic acid was significantly lower than that obtained in the negative control. The pH and the ratio of ammoniacal nitrogen to total nitrogen in mixed silage treated with acetic acid also significantly decreased. Furthermore, the addition of formic or acetic acid significantly weakened the fermentation intensity of lactic acid, depending on the ratio of lactic to acetic acid, as well as the ratio of lactic acid to total organic acids. The number of bacterial species and their relative abundance shifted during silage mixing, wherein microbial communities at phylum level mainly consisted of Proteobacteria and Firmicutes. The dominant bacteria were also observed to shift from Lactobacillus and Enterobacter in presilage biomass to Lactobacillus and Paralactobacillus. Specifically, Enterobacter disappeared after 130 days of storage. In conclusion, the addition of a low dose of acetic acid to fresh mass (0.3 % could effectively improve the fermentation quality and is conducive to the preservation of the organic components.
Directory of Open Access Journals (Sweden)
Sarimeseli Ayse
2015-12-01
Full Text Available Effects of infrared power output and sample mass on drying behaviour, colour parameters, ascorbic acid degradation, rehydration characteristics and some sensory scores of spinach leaves were investigated. Within both of the range of the infrared power outputs, 300–500 W, and sample amounts, 15–60 g, moisture content of the leaves was reduced from 6.0 to 0.1±(0.01 kg water/kg dry base value. It was recorded that drying times of the spinach leaves varied between 3.5–10 min for constant sample amount, and 4–16.5 min for constant power output. Experimental drying data obtained were successfully investigated by using artificial neural network methodology. Some changes were recorded in the quality parameters of the dried leaves, and acceptable sensory scores for the dried leaves were observed in all of the experimental conditions.
Mihailetchi, Valentin D.; Xie, Hangxing; Boer, Bert de; Popescu, Lacramioara M.; Hummelen, Jan C.; Blom, Paul W.M.; Koster, L. Jan Anton
2006-01-01
The origin of the enhanced performance of bulk heterojunction solar cells based on slowly dried films of poly(3-hexylthiophene) (P3HT) and [6,6]-phenyl C-61-butyric acid methyl ester is investigated, combining charge transport measurements with numerical device simulations. Slow drying leads to a
Polpuech, C; Chavasit, V; Srichakwal, P; Paniangvait, P
2011-08-01
Lysine fortification of wheat flour has been used toward reducing protein energy malnutrition in developing countries. The feasibility of fortifying instant noodles with lysine was evaluated based on sensory qualities and the residual lysine content. Fifty grams of deep-fried and dried instant noodles were fortified with 0.23 and 0.21 g lysine, respectively. The production temperatures used for deep-frying were 165-175 degrees C and for drying, 80-105 degrees C; these are the temperatures used in the industrial production of both kinds of noodles. Lysine fortification was then performed at the local factories using the commercial production lines and packaging for both types of instant noodles. Both fortified and unfortified deep-fried and dried instant noodles were stored at 50 degrees C under fluorescent light for 2 and 4 months, respectively. The fortified products were tested for residual lysine content and sensory qualities as compared with unfortified noodles. The results show fortified products from the tested processing temperatures were all accepted. After storage, significant losses of lysine were not found in both types of noodles analysed. The lysine-fortified noodles had amino acid scores of 102% and 122%, respectively. After 2 months, the sensory quality of fortified deep-fried noodles was still acceptable; however, the dried noodles turned to an unacceptable dark colour. This study shows that it is feasible to fortify deep-fried instant noodles with lysine, though lysine fortification exhibited an undesirable colour in the dried instant noodles after storage.
Directory of Open Access Journals (Sweden)
Pek Li Gan
2014-10-01
Full Text Available Jackfruits are seasonal and highly nutritional fruits indigenous to the Southwestern rainforests of India. However much of the produce are spoilt annually due to poor preservation techniques. Minimal studies have been conducted on the drying kinetics of jackfruit and the effect of shapes on the drying kinetics. In this research, drying curves of three different shaped jackfruit slices were obtained using a convective oven at 40oC, 50oC, 60oC and 70oC. Modified Midilli-Kucuk Model was found to be the best kinetic model for drying of jackfruits. At all temperatures, effective moisture diffusivity values and activation energy varied from 2.66 x 10-10 - 4.85 x 10-10 m2/s and 16.08 - 20.07 kJ/mol respectively. Drying was found to be most efficient at 50oC using the square shaped slices with a R2, RMSE and SSE value of 0.9984, 0.01127 and 0.002668 respectively. Sensory evaluation of untreated and additive-added dried jackfruit slices was conducted by 40 untrained sensory panelists. Jackfruit with ascorbic acid and sugar coating had highest aesthetics value due to better retention of colour by ascorbic acid. However sugar coated jackfruit had the most favorable taste and smell. Further optimization must be done to satisfy consumers collectively to enable a highly marketable product.
Sulfonated macro-RAFT agents for the surfactant-free synthesis of cerium oxide-based hybrid latexes
Garnier, J.; Warnant, J.; Lacroix-Desmazes, P.; Dufils, P.E.; Vinas, J.; Herk, van A.M.
2013-01-01
Three types of amphiphatic macro-RAFT agents were employed as compatibilizers to promote the polymerization reaction at the surface of nanoceria for the synthesis of CeO2-based hybrid latexes. Macro-RAFT copolymers and terpolymers were first synthesized employing various combinations of butyl
Purification of papain from fresh latex of Carica papaya
Directory of Open Access Journals (Sweden)
Rubens Monti
2000-01-01
Full Text Available In the present study we wish to report a method of crystallizing papain from fresh papaya latex which gave higher yields than previously reported. This method does not involve the use of sulphydryl reagents. The papain thus obtained is practically pure and shows a single band when submitted to electrophoresis on polyacrylamide gel, and is identical to the papain obtained by other methods. In routine enzymatic assays, specific activity was measured using Z-gly-pNP and BAEE as substrates. Papain crystallized by this method, without the use of high concentrations of salts or thiol-containing substances such as cysteine and dithiothreitol, is obtained in the form of a complex with natural inhibitors existent in latex which can be removed by dialysis.No presente trabalho apresenta-se um método de cristalização da papaína oriunda do látex fresco de mamão, o qual apresenta uma alta produtividade em relação aos métodos previamente descritos. A metodologia aqui descrita não envolve o uso de reagentes sulfidrílicos, a papaína foi obtida de forma praticamente pura, apresentando uma simples banda quando submetida a eletroforese, e com propriedades idênticas àquelas obtidas por outros métodos. A atividade específica foi determinada utilizando Z-gly-pNP e BAEE como substrato. A papaína obtida por essa metodologia, sem uso de substâncias tais como cisteína e ditiotreitol, apresenta-se na forma de um complexo com inibidores naturais, os quais podem ser removidos por diálise.
Directory of Open Access Journals (Sweden)
Oh Seok Kim
2017-05-01
Full Text Available This paper introduces a mixed method approach for analyzing the determinants of natural latex yields and the associated spatial variations and identifying the most suitable regions for producing latex. Geographically Weighted Regressions (GWR and Iterative Self-Organizing Data Analysis Technique (ISODATA are jointly applied to the georeferenced data points collected from the rubber plantations in Xishuangbanna (in Yunnan province, south China and other remotely-sensed spatial data. According to the GWR models, Age of rubber tree, Percent of clay in soil, Elevation, Solar radiation, Population, Distance from road, Distance from stream, Precipitation, and Mean temperature turn out statistically significant, indicating that these are the major determinants shaping latex yields at the prefecture level. However, the signs and magnitudes of the parameter estimates at the aggregate level are different from those at the lower spatial level, and the differences are due to diverse reasons. The ISODATA classifies the landscape into three categories: high, medium, and low potential yields. The map reveals that Mengla County has the majority of land with high potential yield, while Jinghong City and Menghai County show lower potential yield. In short, the mixed method can offer a means of providing greater insights in the prediction of agricultural production.
Directory of Open Access Journals (Sweden)
Gatell-Tortajada J
2016-05-01
Full Text Available Jordi Gatell-TortajadaOn behalf of the Large Dry Eye Clinical Study Group (LDECSGCornea and Ocular Surface Department, Institut Català de Retina, Barcelona, SpainPurpose: To assess the benefits and tolerability of a dietary supplement based on omega-3 fatty acids to relieve dry eye symptoms.Methods: A total of 1,419 patients (74.3% women, mean age 58.9 years with dry eye syndrome using artificial tears participated in a 12-week prospective study. Patients were instructed to take 3 capsules/day of the nutraceutical formulation (Brudysec® 1.5 g. Study variables were dry eye symptoms (scratchy and stinging sensation, eye redness, grittiness, painful and tired eyes, grating sensation, and blurry vision, conjunctival hyperemia, tear breakup time (TBUT, Schrimer I test, and Oxford grading scheme.Results: At 12 weeks, each dry eye symptom improved significantly (P<0.001, and the use of artificial tears decreased significantly from 3.77 (standard deviation [SD] =2.08 at baseline to 3.45 (SD =1.72 (P<0.01. In addition, the Schirmer test scores and the TBUT increased significantly, and there was an increase in patients grading 0–I in the Oxford scale and a decrease of those grading IV–V. Significant differences in improvements of dry eye symptoms were also found in compliant versus noncompliant patients as well as in those with moderate/severe versus none/mild conjunctival hyperemia.Conclusion: Oral ω-3 fatty acids supplementation was an effective treatment for dry eye symptoms.Keywords: dry eye symptoms, artificial tears, omega-3 polyunsaturated fatty acids, nutraceutical supplement, ocular inflammation, eye discomfort
Pengaruh Latek pada Kepekaan Terhadap Temperatur Bahan Pengikat Aspal
Directory of Open Access Journals (Sweden)
Henri Siswanto
2009-02-01
Full Text Available Natural rubber (latex is an additive that could be expected to enhance the physical properties of an asphalt mixtrure, particular its temperature susceptibility bitumen in the form of latex-bitumen in road construction merits consideration. The objectives of the research were to in investigate the effect of latex on the temperature susceptibility. Bitumen used was 60/70-penetration grade and the latex was Dry Rubber Content 60. The results of tests in binders containing 0%, 2%, 4%, and 6% by weight of bitumen indicated that penetration index increases with increase in latex content, indicating a reduction in temperature susceptibility.
International Nuclear Information System (INIS)
Ong, Hun Tiar; Julkapli, Nurhidayatullaili Muhd; Hamid, Sharifah Bee Abd; Boondamnoen, O.; Tai, Mun Foong
2015-01-01
Nitrile butadiene rubber (NBR) gloves are one of the most important personal protective equipments but they are possible to tear off and contaminate food or pharmaceutical and healthcare products during manufacturing and packaging process. High tendency of torn glove remaining in food or products due to white or light flesh-coloured glove is not easy to be detected by naked eyes. In this paper, iron oxide nanoparticles (IONs) selected as additive for NBR to improve its detectability by mean of magnetic properties. IONs synthesized via precipitation method and compounded with NBR latex before casting on petri dish. The properties of IONs were investigated by X-ray Diffractometry (XRD), Transmission Electron Microscope (TEM), Raman Spectroscopy and Vibrating Sample Magnetometer (VSM). Meanwhile NBR/IONs composites were studied by Thermogravimetry Analysis (TGA), Differential Scanning Calorimetry (DSC) and Vibrating Sample Magnetometer (VSM). It observed that, synthesized IONs shows of 25.28 nm crystallite with 25.86 nm semipherical (changed as) shape. Meanwhile, Magnetite and maghemite phase are found in range of 670 cm −1 and 700 cm −1 respectively, which it contributes magnetization saturation of 73.96 emu/g at 10,000 G by VSM. Thermal stability and magnetic properties were increased with incorporating IONs into NBR latex up to 20 phr. NBR/IONs 5 phr has the optimum thermal stability, lowest glass transition temperature (−14.83 °C) and acceptable range of magnetization saturation (3.83 emu/g at 10,000 G) to form NBR gloves with magnetic detectability. - Highlights: • We synthesized IONs with high magnetization saturation (M s ). • High M s of IONs were incorporated into NBR latex in order to induce magnetic properties in the NBR composite. • Introduction of IONs into NBR latex would improve thermal properties. • The produced NBR/IONs 5 phr composite exceeded the minimum magnetic moment sensor of the detector. • They have high potential for the
Energy Technology Data Exchange (ETDEWEB)
Ong, Hun Tiar; Julkapli, Nurhidayatullaili Muhd; Hamid, Sharifah Bee Abd, E-mail: sharifahbee@um.edu.my; Boondamnoen, O.; Tai, Mun Foong
2015-12-01
Nitrile butadiene rubber (NBR) gloves are one of the most important personal protective equipments but they are possible to tear off and contaminate food or pharmaceutical and healthcare products during manufacturing and packaging process. High tendency of torn glove remaining in food or products due to white or light flesh-coloured glove is not easy to be detected by naked eyes. In this paper, iron oxide nanoparticles (IONs) selected as additive for NBR to improve its detectability by mean of magnetic properties. IONs synthesized via precipitation method and compounded with NBR latex before casting on petri dish. The properties of IONs were investigated by X-ray Diffractometry (XRD), Transmission Electron Microscope (TEM), Raman Spectroscopy and Vibrating Sample Magnetometer (VSM). Meanwhile NBR/IONs composites were studied by Thermogravimetry Analysis (TGA), Differential Scanning Calorimetry (DSC) and Vibrating Sample Magnetometer (VSM). It observed that, synthesized IONs shows of 25.28 nm crystallite with 25.86 nm semipherical (changed as) shape. Meanwhile, Magnetite and maghemite phase are found in range of 670 cm{sup −1} and 700 cm{sup −1} respectively, which it contributes magnetization saturation of 73.96 emu/g at 10,000 G by VSM. Thermal stability and magnetic properties were increased with incorporating IONs into NBR latex up to 20 phr. NBR/IONs 5 phr has the optimum thermal stability, lowest glass transition temperature (−14.83 °C) and acceptable range of magnetization saturation (3.83 emu/g at 10,000 G) to form NBR gloves with magnetic detectability. - Highlights: • We synthesized IONs with high magnetization saturation (M{sub s}). • High M{sub s} of IONs were incorporated into NBR latex in order to induce magnetic properties in the NBR composite. • Introduction of IONs into NBR latex would improve thermal properties. • The produced NBR/IONs 5 phr composite exceeded the minimum magnetic moment sensor of the detector. • They have high
Benhabib, K.; Town, R.M.; Leeuwen, van H.P.
2009-01-01
Solid phase microextraction (SPME) is applied in the dynamic speciation analysis of the pesticide atrazine in an aqueous medium containing sorbing latex nanoparticles. It is found that the overall rate of extraction of the analyte is faster than in the absence of nanoparticles and governed by the
Understanding particulate coating microstructure development
Roberts, Christine Cardinal
How a dispersion of particulates suspended in a solvent dries into a solid coating often is more important to the final coating quality than even its composition. Essential properties like porosity, strength, gloss, particulate order, and concentration gradients are all determined by the way the particles come together as the coating dries. Cryogenic scanning electron microscopy (cryoSEM) is one of the most effective methods to directly visualize a drying coating during film formation. Using this method, the coating is frozen, arresting particulate motion and solidifying the sample so that it be imaged in an SEM. In this thesis, the microstructure development of particulate coatings was explored with several case studies. First, the effect of drying conditions was determined on the collapse of hollow latex particles, which are inexpensive whiteners for paint. Using cryoSEM, it was found that collapse occurs during the last stages of drying and is most likely to occur at high drying temperatures, humidity, and with low binder concentration. From these results, a theoretical model was proposed for the collapse of a hollow latex particle. CryoSEM was also used to verify a theoretical model for the particulate concentration gradients that may develop in a coating during drying for various evaporation, sedimentation and particulate diffusion rates. This work created a simple drying map that will allow others to predict the character of a drying coating based on easily calculable parameters. Finally, the effect of temperature on the coalescence and cracking of latex coatings was explored. A new drying regime for latex coatings was identified, where partial coalescence of particles does not prevent cracking. Silica was shown to be an environmentally friendly additive for preventing crack formation in this regime.
International Nuclear Information System (INIS)
Shin, Hyunho; Jung, Hyun Suk; Hong, Kug Sun; Lee, Jung-Kun
2005-01-01
The crystal phase evolution of TiO 2 nanoparticles, during hydrolysis and condensation of titanium tetraisopropoxide, was quenched at various reaction times by a freeze-drying method, followed by various characterizations. Three types of solutions with different acid input times were studied: (1) addition in infinite time (no addition) (2) addition at 24h after the hydrolysis/condensation reaction started, and (3) addition from the beginning of the reaction. The acid-free solution yielded amorphous TiO 2 , which transformed to anatase very slowly. The acid input in 24h resulted in a fast transformation of amorphous to a metastable anatase having a highly distorted atomic arrangement: thereby its transformation to a more stable phase, rutile, was suitable. The acid addition from the beginning of the reaction yielded the formation of a relatively stable anatase from the hydrolysis seed, thereby the subsequent transformation to rutile was sluggish
Folic acid content in thermostabilized and freeze-dried space shuttle foods
Lane, H. W.; Nillen, J. L.; Kloeris, V. L.
1995-01-01
This study was designed to determine whether freeze-dried and thermostabilized foods on a space shuttle contain adequate folate and to investigate any effects of freeze-drying on folacin. Frozen vegetables were analyzed after three states of processing: thawed; cooked; and rehydrated. Thermostabilized items were analyzed as supplied with no further processing. Measurable folate decreased in some freeze-dried vegetables and increased in others. Folacin content of thermostabilized food items was comparable with published values. We concluded that although the folacin content of some freeze-dried foods was low, adequate folate is available from the shuttle menu to meet RDA guidelines.
Directory of Open Access Journals (Sweden)
Tiffany L. B. Yelverton
2016-01-01
Full Text Available Gaseous and particulate emissions from the combustion of coal have been associated with adverse effects on human and environmental health, and have for that reason been subject to regulation by federal and state governments. Recent regulations by the United States Environmental Protection Agency have further restricted the emissions of acid gases from electricity generating facilities and other industrial facilities, and upcoming deadlines are forcing industry to consider both pre- and post-combustion controls to maintain compliance. As a result of these recent regulations, dry sorbent injection of trona to remove acid gas emissions (e.g. HCl, SO2, and NOx from coal combustion, specifically 90% removal of HCl, was the focus of the current investigation. Along with the measurement of HCl, SO2, and NOx, measurements of particulate matter (PM, elemental (EC, and organic carbon (OC were also accomplished on a pilot-scale coal-fired combustion facility. Gaseous and particulate emissions from a coal-fired combustor burning bituminous coal and using dry sorbent injection were the focus of the current study. From this investigation it was shown that high levels of trona were needed to achieve the goal of 90% HCl removal, but with this increased level of trona injection the ESP and BH were still able to achieve greater than 95% fine PM control. In addition to emissions reported, measurement of acid gases by standard EPA methods were compared to those of an infrared multi-component gas analyzer. This comparison revealed good correlation for emissions of HCl and SO2, but poor correlation in the measurement of NOx emissions.
Andayani, Sih Wuri; Suratman, Rochim; Imran, Iswandi; Mardiyati
2018-05-01
Portland cement concrete have been used in construction due to its strength and ecomical value. But it has some limitations, such low flexural strength, low tensile strength, low chemical resistant and etc. Due to its limitations in flexural and tensile strength, Portland cement concrete more susceptible by seismic force. There are some methods for improving its limitations. Polymer addition into concrete mixture could be one of solution for improving the flexural and tensile strength, in aiming to get erthquake resistant properties. Also, the eartquake resistant could be achieved by improving energy dissipation capacity. In this research, the earthquake resistant evalution was approached from dynamic evaluation through energy dissipation capacity, after polymer addition as concrete additives. The polymers were natural latex (Indonesian naural resource) grafted with styrene and methacrylate, forming copolymer - natural latex methacrylate (KOLAM) and copolymer - natural latex styrene (KOLAS). They were added into concrete mixture resulting polymer modified concrete. The composition of polymer are 1%, 5% and 10% weight/weight of cement. The higher capacity of energy dissipation will give more capability in either absorbing or dissipating energy, and it was predicted would give better earthquake resistant.. The use of KOLAM gave better performance than KOLAS in energy dissipation capacity. It gave about 46% for addition of 1% w/w compared to Portland cement concrete. But for addition 5% w/w and 10% w/w, they gave about 7% and 5% higher energy dissipation capacity. The KOLAM addition into concrete mixture would reduce the maximum impact load with maximumabout 35% impact load reducing after 1% w/w addition. The higher concentration of KOLAM in concrete mixture, lower reducing of impact load, they were about 4% and 3% for KOLAM 5% and 10%. For KOLAS addition in any compositions, there were no positive trend either in energy dissipation capacity or impact load properties
Lenaerts, S; Van Der Borght, M; Callens, A; Van Campenhout, L
2018-07-15
Freeze drying represents the current practice to stabilize mealworms, even though it is an energy demanding technique. Therefore, it was examined in the present study whether microwave drying could be a proper alternative. To this end, the impact of both drying techniques on the proximate composition, vitamin B 12 content, fatty acid profile, oxidation status and colour parameters of mealworms was investigated. Furthermore, the influence of the application of vacuum during microwave drying was studied. The different drying technologies resulted in small differences in the proximate composition, while the vitamin B 12 content was only reduced by microwave drying. The fat fraction of freeze dried mealworms showed a higher oxidation status than the fat of microwave dried mealworms. Application of a vacuum during the microwave drying process did not appear to offer advantages. This research shows that for mealworms microwave drying can be a proper alternative to freeze drying. Copyright © 2018 Elsevier Ltd. All rights reserved.
Sudesh Kumar; Suraj Prakash Mathur
2013-01-01
The corrosion inhibition of aluminium in sulfuric acid solution in the presence of different plant parts, namely, leaves, latex, and fruit was studied using weight loss method and thermometric method. The ethanolic extracts of Calotropis procera and Calotropis gigantea act as an inhibitor in the acid environment. The inhibition efficiency increases with increase in inhibitor concentration. The plant parts inhibit aluminium, and inhibition is attributed, due to the adsorption of the plant part...
Numerical Simulation and Experimental Validation of the Inflation Test of Latex Balloons
Bustos, Claudio; Herrera, Claudio García; Celentano, Diego; Chen, Daming; Cruchaga, Marcela
2016-01-01
Abstract Experiments and modeling aimed at assessing the mechanical response of latex balloons in the inflation test are presented. To this end, the hyperelastic Yeoh material model is firstly characterized via tensile test and, then, used to numerically simulate via finite elements the stress-strain evolution during the inflation test. The numerical pressure-displacement curves are validated with those obtained experimentally. Moreover, this analysis is extended to a biomedical problem of an...
Macaulay, Babajide Milton; Enahoro, Gloria Ebarunosen
2015-10-01
Effects of acid rain on the morphology, phenology and dry biomass of maize (Suwan-1 variety) were investigated. The maize seedlings were subjected to different pH treatments (1.0, 2.0, 3.0, 4.0, 5.0 and 6.0) of simulated acid rain (SAR) with pH 7.0 as the control for a period of 90 days. The common morphological defects due to SAR application were necrosis and chlorosis. It was observed that necrosis increased in severity as the acidity increased whilst chlorosis was dominant as the acidity decreased. SAR encouraged rapid floral and cob growth but with the consequence of poor floral and cob development in pH 1.0 to 3.0 treatments. The result for the dry biomass indicates that pH treatments 2.0 to 7.0 for total plant biomass were not significantly different (P > 0.05) from one another, but were all significantly higher (P pH 1.0. Therefore, it may be deduced that Suwan-1 has the potential to withstand acid rain but with pronounced morphological and phenological defects which, however, have the capacity to reduce drastically the market value of the crop. Therefore, it may be concluded that Suwan-1 tolerated acid rain in terms of the parameters studied at pH 4.0 to 7.0 which makes it a suitable crop in acid rain-stricken climes. This research could also serve as a good reference for further SAR studies on maize or other important cereals.
Feng, Lili; Cohen Stuart, Martien; Adachi, Yasuhisa
2015-01-01
The dynamic behavior of polyelectrolytes just after their encounter with the surface of bare colloidal particles is analyzed, using the flocculation properties of mono-dispersed polystyrene latex (PSL) particles. Applying a Standardized Colloid Mixing (SCM) approach, effects of ionic strength and
Ravik, Monika; Havnes, Anton; Bjørk, Ida Torunn
2017-12-01
To explore, describe and compare learning actions that nursing students used during peripheral vein cannulation training on a latex arm or each other's arms in a clinical skills centre. Simulation-based training is thought to enhance learning and transfer of learning from simulation to the clinical setting and is commonly recommended in nursing education. What students actually are doing during simulation-based training is, however, less explored. The analysis of learning actions used during simulation-based training could contribute to development and improvement of simulation as a learning strategy in nursing education. A qualitative explorative and descriptive research design, involving content analysis of video recordings, was used. Video-supported observation of nine nursing students practicing vein cannulation was conducted in a clinical skills centre in late 2012. The students engaged in various learning actions. Students training on a latex arm used a considerably higher number of learning actions relative to those training on each other's arms. In both groups, students' learning actions consisted mainly of seeking and giving support. The teacher provided students training on each other's arms with detailed feedback regarding insertion of the cannula into the vein, while those training on a latex arm received sparse feedback from the teacher and fellow students. The teacher played an important role in facilitating nursing students' practical skill learning during simulation. The provision of support from both teachers and students should be emphasised to ensure that nursing students' learning needs are met. This study suggest that student nurses may be differently and inadequately prepared in peripheral vein cannulation in two simulation modalities used in the academic setting; training on a latex arm and on each other's arms. © 2017 John Wiley & Sons Ltd.