WorldWideScience

Sample records for accueille sa nouvelle

  1. Bonne nouvelle

    Directory of Open Access Journals (Sweden)

    Esther Cloutier

    2007-10-01

    Full Text Available Bonjour, Nous sommes heureux de vous présenter ce nouveau numéro de la revue PISTES. Nous avons en tout premier une nouvelle très stimulante à vous annoncer : la revue PISTES a reçu une subvention du CRSH (Conseil de recherche en sciences humaines du Canada. Ceci constitue une nouvelle reconnaissance scientifique. Avec cette subvention nous voulons traduire nos prochains numéros qui seront ainsi publiés en français et en anglais, ce qui permettra de faire connaître nos travaux dans le monde ...

  2. A Nouvelle Vague

    OpenAIRE

    Michel Marie

    2003-01-01

    In this discussion about Nouvelle Vague, the author demonstrates that the cinematographic phenomena appeared by chance, between 1959/1960, from a wide reaction against the French cinema. Particularly linked to the criticai Cahiers du Cinéma, the movement was consolidated after having excited a complex and paradoxical cinematographic practice involving happenings, ideas, authors, conceptions of direction and low budgets. It also allowed the appearance of a remarkable generation of cinematograp...

  3. Renouveler les villes nouvelles ?

    OpenAIRE

    Guy BAUDELLE; Ducom, Estelle

    2008-01-01

    National audience; Guy Baudelle (Université Européenne de Bretagne, UMR CNRS 6590) et Estelle Ducom (Université Paris IV-Sorbonne, UMR CNRS 8504) s'étonnent qu'on souhaite renouveler l'expérience des villes nouvelles alors que celles-ci sont confrontées à leur propre renouvellement. Un tel retour est cependant possible, sous conditions.

  4. A Nouvelle Vague

    Directory of Open Access Journals (Sweden)

    Michel Marie

    2003-06-01

    Full Text Available In this discussion about Nouvelle Vague, the author demonstrates that the cinematographic phenomena appeared by chance, between 1959/1960, from a wide reaction against the French cinema. Particularly linked to the criticai Cahiers du Cinéma, the movement was consolidated after having excited a complex and paradoxical cinematographic practice involving happenings, ideas, authors, conceptions of direction and low budgets. It also allowed the appearance of a remarkable generation of cinematographers, which is still a reference to the

  5. Les Coopératives : Nouvelles pratiques, nouvelles analyses - Introduction

    OpenAIRE

    Ansart, Sandrine; Artis, Amélie; Monvoisin, Virginie

    2016-01-01

    International audience; L’origine de cet ouvrage est une rencontre entre des universitaires et des représentants des coopératives qui a eu lieu à Grenoble en avril 2016 et dont l’objet était de confronter les points de vue des professionnels et des universitaires à la fois sur les nouvelles pratiques des coopératives, et les nouvelles analyses en cours.Le contexte dans lequel s’inscrit la vie des coopératives est en effet modifié par de nombreux éléments : la loi de juillet 2014 sur l’Économi...

  6. Assimilation ou fidélité aux valeurs du Vieux Monde ? La nouvelle et sa représentation de l’immigration juive aux Etats-Unis

    Directory of Open Access Journals (Sweden)

    Crystel Pinçonnat

    2001-06-01

    Full Text Available Quel modèle adopter : le respect de la tradition ou la voie de l’américanisation ? A partir de quelques nouvelles traduites du yiddish (New-Yorkaises de Lamed Shapiro, Le Fils qui venait d’Amérique d’Isaac Bashevis Singer et de l’américain (L’Oiseau-juif de Bernard Malamud, Eli le fanatique de Philip Roth et La Voix la plus forte de Grace Paley, cet article se propose d’étudier la représentation de la déchirure qui hante la communauté juive ashkénaze émigrée aux Etats-Unis : son tiraillement entre fidélité au passé et adhésion au présent.What model should be adopted: being respectful of tradition or becoming Americanized? A lot of Yiddish or American short stories raise the issue: New-York’s Women by Lamed Shapiro, The Son Who Came from America by Isaac Bashevis Singer,The Jewbird by Bernard Malamud Eli, The Fanatic by Philip Roth, and The Loudest Voice by Grace Paley. This article examines the representation these texts offer of the ongoing conflict within the Ashkenaze Jewish community, who came to the United States, torn between its past and its present, resistance and assimilation.¿Qué modelo adoptar : el respeto de la tradición o la vía de la americanización ? A partir de algunas novelas cortas traducidas del yiddish (New York’s Women de Lamed Shapiro, The Son Who Came from America de Isaac Bashevis Singer y del americano (The Jewbird de Bernard Malamud, Eli, The Fanatic de Philp Roth, y The Loudest Voice de Grace Paley, este artículo analiza la representación del dilema que desgarra a la comunidad judía asquenazie inmigrada a los Estados Unidos : la elección entre la fidelidad al pasado y la adhesión al presente.

  7. La nouvelle-tableau (2

    Directory of Open Access Journals (Sweden)

    Géraldine Jenvrin

    2012-06-01

    Full Text Available La nouvelle « Frémissante, la feuille se flétrit » met en scène le trouble d'un détenu qui par les seuls objets dont il dispose, lutte pour s'échapper intérieurement. L'usage du regard cinématographique porté sur les détails infimes de la matérialité carcérale, leur exposition sous forme de tableaux se faisant échos, les techniques de l’anonymat et du brouillage des repères objectifs, portent à son comble les dimensions énigmatiques et l'esthétique de la  brièveté propre à la nouvelle tout en permettant de  représenter la résistance de l'homme à l'enfermement et à la persécution.

  8. Nouvelles conversations avec Jacques Fontanille

    Directory of Open Access Journals (Sweden)

    Jean Cristtus PORTELA

    2015-12-01

    Full Text Available Cette interview réalisée de février à mai 2014 aborde les développements les plus récents de l’œuvre de Jacques Fontanille, sémioticien français qui est une des figures phares de la sémiotique européenne. Ici le sémioticien fait le point sur la sémiotique des pratiques et sur le concept de formes de vie, sujet de son dernier ouvrage encore inédit. Au cours de ces conversations, qui prolongent celles réalisées en 2006 (PORTELA, 2006, Fontanille parle de la situation actuelle de la sémiotique en France, du rapport entre sémiotique et sciences humaines et du rôle de l’intellectuel dans la société. Selon J. Fontanille, la sémiotique doit faire face aux problématiques théoriques transversales et répondre aux questions sociétales, sans se focaliser seulement sur les apories et les questions internes aux courants sémiotiques en tant que regroupements institutionnels. Ainsi, le plus grand défi de la sémiotique à l’heure actuelle serait de chercher de nouvelles voies pour se réinventer en tant que discipline à vocation prédictive et stratégique.

  9. Nouvelle économie et gouvernance

    OpenAIRE

    Gérard Charreaux

    2000-01-01

    L'objectif de cet article exploratoire est d'éclairer les relations entre nouvelle économie et gouvernance. D'une part, il s'interroge sur la façon de modéliser les liens entre nouvelle économie, création de valeur et système de gouvernance de façon à appréhender, selon un double sens de causalité, la contrainte exercée par les systèmes de gouvernance sur les trajectoires de développement et, inversement, les évolutions des configurations des systèmes de gouvernance. D'autre part, l'article p...

  10. L’affirmation d’une nouvelle dynastie

    Directory of Open Access Journals (Sweden)

    Emmanuelle Klinka

    2007-05-01

    Full Text Available Dès sa création par Ferdinand Ier de Castille et de León et son épouse Sancie, infante léonaise, la nouvelle dynastie a favorisé les expressions artistiques de grande envergure, dont le panthéon royal de Saint-Isidore de León et les fresques qui l’ornent. Ceci impliquant de façon pérenne les monarques et leurs successeurs, je me suis intéressée aux choix institutionnels, artistiques et idéologiques qui ont déterminé son édification.Desde el momento de su creación por Fernando I de Castilla y León y su esposa Sancha, infanta leonesa, la nueva dinastía favoreció las expresiones artísticas de máximo alcance, entre las cuales el panteón real de San Isidoro de León y los frescos que lo adornan. Puesto que implica de modo perenne a los monarcas y a sus sucesores, me interesé por las opciones tanto institucionales como artísticas e ideológicas que determinaron su edificación.

  11. Nella filigrana di “Nouvelle Vague”

    Directory of Open Access Journals (Sweden)

    Roberto Chiesi

    2012-06-01

    Full Text Available Jean-Luc Godard’s Nouvelle Vague (1990 presents an emblematic title that celebrates the 30th anniversary of A bout de souffle. Godard’s film is dominated by doubles – two times, two identities, two stories, two loves, two drownings – and by a range of echoes and literary quotations (Chandler, Homer, Leopardi, Dante, Rimbaud, Spengler, or cinematographic allusions (Hitchcock, Mankiewicz, Lewin, Antonioni, Huston which form the fabric of a story told as the reflection or the superimposition of another one.

  12. La zone nouvelle de Pudong (Shangai

    Directory of Open Access Journals (Sweden)

    Gabriel Weissberg

    2000-09-01

    Full Text Available Depuis 1990 et au prix de lourds investissements en infrastructures, le gouvernement et les autorités locales espèrent faire de la Zone Nouvelle de Pudong un élément clé de l’expansion de Shanghai. Neuf zones d’activités accueillent habitat, services et industries. Le développement de la ZNP reste cependant marqué par certaines faiblesses qui posent la question de son rôle dans le renouveau attendu de Shanghai.

  13. Villes et nouvelle économie

    Directory of Open Access Journals (Sweden)

    Emmanuel Éveno

    2003-06-01

    Full Text Available Cet article analyse les modes d’insertionspatiale des technologies de l’information et de la communication (TIC dans les métropoles puis aborde la question des mythes d’une «antigéographie» soulevés par cette nouvelle vague d’innovations dont les postulats sont basés sur les effets de réseaux et les technologies de lutte contre la distance. Trois approches (hiérarchie urbaine, réorganisation de l’espace métropolitain, nouveaux objets urbains essaient de montrer toute la place de la géographie et des problématiques territoriales autour des TIC.

  14. L’inventio de la Nouvelle Espagne. Rhétorique et domination territoriale du Nouveau Monde

    OpenAIRE

    Ceceña Alvarez, René

    2012-01-01

    Ce texte propose une analyse des mécanismes argumentatifs mis en œuvre dans les lettres que Hernán Cortés, conquistador du Mexique, a adressées à Charles V (Cartas de Relación) pour légitimer sa conquête du territoire qui deviendra la Nouvelle Espagne et, par ce biais, le Nouveau Monde. Il s’agit en particulier de montrer l’emploi du concept rhétorique d’inventio dans le passage d’une appropriation conceptuelle du « Nouveau Monde » (par l’élabor...

  15. Nouvelle formulation du modèle de Kubelka et Munk avec application aux encres fluorescentes

    OpenAIRE

    Emmel, P.

    2000-01-01

    Parmi les modèles de prédiction couleur courants, celui de Kubelka et Munk occupe une position centrale. En dépit de son caractère phénoménologique et de sa simplicité, il conduit à des résultats intéressants, et est toujours employé dans les systèmes d'aide à la formulation d'encres, de peintures et de teintures. Après un bref rappel du modèle, une nouvelle formulation mathématique basée sur une écriture matricielle sera présentée. On montrera qu'elle permet une manipulation plus aisée des é...

  16. Voyages et utopie scientifique dans La Nouvelle Atlantide de Bacon

    OpenAIRE

    2016-01-01

    Parce qu’il s’agit d’une fiction issue du genre utopique, la Nouvelle Atlantide est sans doute l’une des œuvres les plus originales du corpus baconien. Cet article s’efforce de montrer que ce récit de voyage et la philosophie du chancelier forment pourtant un tout cohérent, et que la Nouvelle Atlantide peut se lire comme une illustration fictionnelle de l’épistémologie baconienne. Pour Bacon, le voyage est à la fois la métaphore et l’instrument de la découverte scientifique. En effet la conna...

  17. Villes nouvelles et desserrement des services aux entreprises

    OpenAIRE

    Halbert, Ludovic

    2004-01-01

    Rapport 2004 dans le cadre du Programme d'Histoire et d'Evaluation des Villes Nouvelles du Ministère de l'Equipement; Ce rapport a été rédigé en 2004 dans le cadre du Programme d'Histoire et d'Evaluation des Villes Nouvelles du Ministère de l'Equipement, alors que j'étais rattaché au Ladyss. A partir d'un outil de lecture développé par le laboratoire Strates (Univ. Paris-1), et réactualisé lors de mon travail de thèse, les données du recensement de 1982 et 1999 sont analysées pour souligner l...

  18. Nouvelle espèce des Syntomides (Lepidoptera Heterocera)

    NARCIS (Netherlands)

    Snellen, P.C.T.

    1886-01-01

    Quatre mâles frais et bien conservés de 58—64 millim. d’envergure. Cette nouvelle espèce, gigantesque pour une Syntomide, appartient au genre Automolis, tel qu’il a été défini par Herrich-Schäffer, dans son ouvrage »Sammlung aussereuropäischer Schmetterlinge” (p. 21); le nom est emprunté au bien con

  19. Nouvelles recherches a la Grotte Cosquer (Marseille

    Directory of Open Access Journals (Sweden)

    Luc Vanrell

    2005-01-01

    Full Text Available En juillet 1991, un plongeur sous-marin, HENRI COSQUER, découvrit des peintures et des gravures dans une grotte sous la mer près deMarseille, au Cap Morgiou. En 1991, 1992 et 1994, des séries de plongées furent organisées par le Ministère de la Culture, avec la participation de JEAN COURTIN, préhistorien et plongeur. D’autres recherches furent reprises dernièrement, en 2002 et 2003, par les cosignataires de l’article.La localisation extraordinaire de l’entrée de cette caverne est due à la montée du niveau de la mer après la fin de la dernière glaciation. Au maximum glaciaire, il y a 20.000 ans, la mer se trouvait 130 mètres plus bas qu’actuellement et la ligne de rivage était à 5 kilomètres de là.Les parois de toutes les galeries et salles submergées ont été corrodées et aucune peinture ni gravure n’y subsistent. L’art découvert se trouve dans des salles supérieures restées hors d’eau. Environ 177 figures d’animaux ont été répertoriées, ainsi que 216 signes géométriques de formes diverses, 65 mains négatives, et l’image d’un homme tué. Les sols sont jonchés de charbons, restes de torches ou de feux allumés pour obtenir le charbon nécessaire aux dessins. Les gens n’habitaient pas dans ces lieux retirés. Ils les utilisèrent pour leurs cérémonies mais également pour obtenir le mondmilch raclé sur les parois et des fragments de concrétions, qui servirent probablement comme « médecines ».Les 27 dates obtenues par la méthode du radiocarbone ont montré que la caverne avait été fréquentée pendant deux périodes principales, d’abord aux alentours de 26 à 27.000 ans avant le présent, puis il y a 19.000 ans environ.La grotte Cosquer, dont plus des trois-quarts de l’art furent sans doute détruits par son ennoiement, est une découverte majeure, par sa localisation en Provence, par les activités dont elle fut le théâtre, et par l’abondance du bestiaire, des mains et des

  20. Le mélange du roman et de la nouvelle dans Hécate et ses chiens

    Directory of Open Access Journals (Sweden)

    Catherine Douzou

    1999-09-01

    Full Text Available Une des caractéristiques de l'art de la nouvelle tel que le pratique Paul Morand est sa tendance à mélanger les genres, en particulier celui du roman et de la nouvelle. Cette proximité de la narration brève avec l'écriture proprement romanesque se manifeste surtout dans la longue nouvelle, forme que notre auteur affectionne à partir des années trente. L'étude de l'une des ses longues nouvelles, Hécate et ses chiens, qui de plus, se trouve être un de ses textes les plus ambigus sur le plan générique, permet de réfléchir sur la distinction qui existe dans l'esprit de Morand entre ces deux genres. De même elle autorise à comprendre le sens de cette fascination de la nouvelle pour le roman : pour Morand la nouvelle est un art de la surface alors que l'écriture romanesque plonge aux profondeurs de l'être.One of the characteristics of Paul Morand's art of the short story is his tendency to mix genres together, in particular those of the novels and the short story. This proximity between the short narrative and the novel is to be observed mainly in the long short story, a form which Morand seems to have favoured from the nineteen thirties onward. The study of one of his long short stories, Hécate et ses chiens, which is moreover one of his most ambiguous texts as far as genre is concerned, leads to a reflection on the distinction which Morand made between those two genres. It also helps to understand the meaning of this fascination of the short story for the novel: for Morand, the short story is an art that deals with the surface, whereas the novel explores the depths of beings.Una de las características deI arte de la novela corta tal y como lo practica Paul Morand es su tendencia a mezclar los géneros, en particular los de la novela y de la novela corta. Dicha cercana presencia de la narración breve junto con la escritura novelesca propiamente dicho aparece sobre todo en la larga « novela corta », forma que nuestro autor

  1. SEMINAIRE DE L'ENSEIGNEMENT TECHNIQUE Nouvelles Technologies en Tuyauteries Multicouches - French version only

    CERN Multimedia

    Davide Vitè

    2002-01-01

    Mardi 28 mai, mercredi 29 mai 28 mai, 9:30 - 12:00 - Training Centre Auditorium, Room 11, bldg. 593 28 mai, 14:00 - 17:00; 29 mai, 9:00 - 12:00 - Training Centre Rooms 13 and 15, bldg. 593 Nouvelles Technologies en Tuyauteries Multicouches Jacques Dougoud / GEBERIT SA, Lausanne, Suisse Mario Bettini / GEORG FISCHER PFCI S.r.l., Peschiera del Garda, Brescia, Italie Christian Tacco / VALSIR S.P.A., Vestone, Brescia, Italie Depuis quelques années l'apparition de tubes multicouches a changé radicalement la conception des tuyauteries, tant pour les applications industrielles que domestiques. Les utilisations au CERN concernent pratiquement tous les fluides, c'est-à-dire eau sanitaire, eau déminéralisée, air comprimé, fluorocarbones liquides ou gazeux, et tous les gaz, depuis l'hélium jusqu'au xénon. Ce séminaire de l'Enseignement Technique est adressé à toute personne concern&eac...

  2. Political participation of immigrants through new urban policies in Brussels : constraints and small opportunities Participation politique des immigrés à travers les nouvelles politiques urbaines à Bruxelles : contraintes et manque d’opportunités

    Directory of Open Access Journals (Sweden)

    Muriel Sacco

    2012-12-01

    Full Text Available The political participation of immigrants is an important gauge of their integration into the receiving society more generally, as well as an indicator of the degree of openness of political elites towards ethnic minorities. With the restructuring of State intervention and the diffusion of civic culture, the role that immigrant associations play in shaping urban social policies has become another important form of political participation. As the Belgian city with the highest percentage of migrants and naturalized foreigners and benchmarked as multicultural by the regional government, Brussels presents a test case. Since the beginning of the nineties, new public policies including participative tools have been introduced in Brussels. However, immigrant associations are not adequately involved in these processes. Why is such little space given to migrant associations in the participative procedures of these new urban policies? The neo-institutionalist perspective will be helpful in identifying the major factors that explain the relatively low participation of immigrant associations.La participation politique des immigrés est un indicateur important à la fois de leur intégration dans la société d’accueil et du degré d’ouverture des élites politiques à l’égard des minorités ethniques. Avec les mutations de l’intervention de l’Etat et la diffusion d’une culture civique, les espaces participatifs des politiques socio-urbaines offrent une forme de participation politique nouvelle pour les associations d’immigrés. Bruxelles est un cas intéressant. D’une part, la capitale est la ville belge qui accueille le plus haut pourcentage de personnes étrangères et d’origine étrangère et est présentée comme ville multiculturelle par le gouvernement régional. D’autre part, depuis les années 1990, des nouvelles politiques publiques incluant des outils participatifs ont été implémentées à Bruxelles. Cependant, les

  3. LHC 2008 lectures "Une nouvelle vision du monde"

    CERN Multimedia

    2008-01-01

    The history of the science of the Universe and the science of matter have been marked by a small number of "revolutions" that have turned our understanding of the infinitesimally large and the infinitesimally small on its head. New ways of looking at the world have come about sometimes through conceptual advances and sometimes through innovations in scientific instrumentation. How do things stand at the beginning of the 21st century? Will today’s large-scale machine projects like the LHC and gravitational wave detectors pave the way for a new scientific revolution? Thursday, 15 May 2008 at 8.00 p.m. Une nouvelle vision du monde Jean-Pierre Luminet, Research Director at the CNRS The Globe, first floor No specialist knowledge required. Entrance free. To reserve call + 41 (0) 22 767 76 76 http://www.cern.ch/globe

  4. La « nouvelle orthographe », 21 ans plus tard

    Directory of Open Access Journals (Sweden)

    Farid Georges

    2012-07-01

    Full Text Available La « nouvelle orthographe » (appellation discutable découle du rapport du Conseil supérieur de la langue française de France "Les rectifications de l'orthographe", lequel a été approuvé par l’Académie française et publié dans le Journal officiel de la République française en 1990. Ces modifications orthographiques touchent au départ 2000 mots, et plus tard, 5000 mots avec l'intégration de termes techniques, et ce, en lien avec le trait d’union et la soudure, le singulier et le pluriel des noms composés et des mots étrangers, les accents et le tréma, les consonnes doubles, le participe passé de « laisser » suivi d’un infinitif, et certaines anomalies. Où en sommes-nous aujourd’hui : 21 ans plus tard? Qui les met en application : ministères, dictionnaires, grammaires, logiciels, correcteurs orthographiques? Qui s’y oppose et pourquoi? Quelles sont les forces et faiblesses des rectifications en question? Quels en sont les avantages ou les inconvénients pour les scripteurs? Autant de questions auxquelles cette communication répondra, avec de multiples références à l'appui. Après un bref historique de l’évolution de l’orthographe française de 1694 à 1975, et de 1975 jusqu’à 2011, nous rappellerons en quoi consistent les rectifications orthographiques de 1990. Nous analyserons les avantages et inconvénients (observations linguistiques de la « nouvelle orthographe » qui, pour ses détracteurs est une infamie, et pour ses partisans, une « réformette », mieux, une timide rectification. Seront discutées, entre autres, les points de vue de linguistes et de grammairiens : Catach, Goosse, Bentolila, Honveault, Duneton, Müller, Contant, et jusqu’à quel degré sept règles modernes contribuent réellement à la cohérence du système graphique et à la simplification de l'apprentissage. Enfin, nous soulèverons les questions qui préoccupent les scripteurs en termes de mise en application des

  5. Description d’une espèce nouvelle du genre Potamophora, Guen

    NARCIS (Netherlands)

    Snellen, P.C.T.

    1884-01-01

    Dans les „Suites à Buffon, Noctuélites III, p. 122”, le genre Potamophora de Mr. Guenée ne comprend qu’une seule espèce, la Pot. Manlia Cram. Depuis, trois nouvelles espèces ont été publiées dont deux, la Pot. Neocherina Butler, Ent. Monthly Mag. XIV (1877) p. 109 de Queensland (Nouvelle Hollande) e

  6. Elaboration de nouvelles configurations à partir de cas existants du patrimoine bâti. : Conception architecturale paramétrique

    OpenAIRE

    Chevrier, Christine; Charbonneau, Nathalie; Grussenmeyer, Pierre; Perrin, Jean-Pierre

    2009-01-01

    A l'origine conçu pour la modélisation 3D de monuments historiques, notre outil GOP permet la reconstruction 3D virtuelle à partir d'éléments architecturaux décrits par des paramètres. Dans le cadre de la conception paramétrique, un concepteur-architecte peut utiliser notre logiciel pour élaborer de nouvelles configurations à partir de cas existants en faisant varier les paramètres mis à sa disposition. Notre outil devient alors un support d'aide à la créativité et va permettre de générer des...

  7. Evolution de la stratégie multicanal chez Vedia S.A.

    OpenAIRE

    Hug, Nicole; Morand, Jean-Claude

    2009-01-01

    La société Vedia S.A. est active dans le domaine de la vente par correspondance sur le territoire Suisse. Elle vend des articles de tout genre pour une utilisation quotidienne sous deux noms de marque : Vedia et Kays. La nouvelle stratégie qu’aimerait poursuivre la société est de se lancer dans le multicanal de distribution en ouvrant un magasin qui lui permettera en partie de liquider de la marchandise à prix réduit. Lors d’une analyse de l’environnement démographique et économique il en est...

  8. Ahmad Yasavï héros des nouvelles républiques centrasiatiques

    Directory of Open Access Journals (Sweden)

    Thierry Zarcone

    2009-05-01

    Full Text Available Cette contribution concerne la relecture des écrits, pour la plupart poétiques, attribués au célèbre soufi du XIe siècle, Ahmad Yasavi, par les intellectuels, les hommes politiques et les journalistes des républiques actuelles d'Asie centrale ex-soviétique. Il s'agit d'abord de présenter les écrits d'Ahmad Yasavï et de préciser qu'ils ont laissé une marque notable dans les milieux lettrés et littéraires de l'ensemble de l'Asie centrale, y compris dans les régions de la Volga et du Turkestan oriental. Depuis le XIe siècle, en effet, Ahmad Yasavi fait figure de mythe en Asie centrale : aucun document ne permet de rendre compte de ses idées. Pour cette raison, l'interprétation de sa pensée par les musulmans, éclairés comme conservateurs, ainsi que par les marxistes et, aujourd'hui, par les intellectuels et les hommes politiques des nouvelles républiques, a conduit à des exposés variés et contradictoires. Cette étude se propose d'analyser les différentes interprétations du personnage en relation avec la culture et la société centrasiatique. On verra en particulier comment les écrits d'Ahmad Yasavi inspirèrent les modernistes musulmans (jadid des XIXe et XXe siècles qui l'ont décrit comme un poète nationaliste, prolétaire et socialiste et on verra pourquoi, du temps de l'URSS, après l'élimination par Staline des derniers jadid, il fut considéré comme un féodal, un bourgeois et un apôtre de la réaction, en sorte comme un « saint maudit ». La dernière partie de ce travail se concentre sur la période contemporaine et montre comment le mythe d'Ahmad Yasavï a été interprété depuis 1991, en relation avec le processus de reconstruction identitaire en Asie centrale et avec le renouveau de l'islam. Ahmad Yasavï est devenu le modèle du parfait citoyen d'Asie centrale. En bref, le mysticisme a été éliminé et seuls les aspects « nationalistes » et tolérants du soufi ont été retenus. L

  9. SalSA status

    Energy Technology Data Exchange (ETDEWEB)

    Connolly, Amy [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom)], E-mail: amyc@hep.ucl.ac.uk

    2009-06-01

    I review the status of SalSA, a proposed antenna array in a large volume salt formation for detecting ultra-high energy neutrinos. We report on measurements taken in 2007 of attenuation lengths in the 125-900 MHz frequency range at the Cote Blanche salt mine near New Iberia, Louisiana, which is the most precise in situ measurement of attenuation lengths in salt to date. We comment on the impact of these measurements on the feasibility of SalSA.

  10. Tradition et innovations esthétiques dans la nouvelle yéménite contemporaine Tradition and aesthetic innovations in contemporary Yemeni short stories

    Directory of Open Access Journals (Sweden)

    Géraldine Jenvrin

    2008-04-01

    Full Text Available Le nouveau recueil de Mu/hammad ‘Abd al-Wakîl Jâzim témoigne d’une transformation capitale dans la littérature yéménite contemporaine :  le passage d’une forme expérimentale en rupture avec les règles de la nouvelle traditionnelle et avec la réalité yéménite, à une autre forme plus accomplie dans laquelle les principes traditionnels de la nouvelle sont ici associés sans complexe aux formes renouvelées du genre.  La nouvelle intitulée Le maître des vautours, présente, dans une structure narrative traditionnelle, un conte fantastique moderne qui mêle réalisme, symbolisme et poésie, et dans lequel l’auteur traite à sa manière les thèmes littéraires contemporains de la dualité du rêve et de la réalité, du désenchantement et de l’enfermement perpétuel.  C’est notamment en s’inspirant de la langue, des pratiques orales, des croyances et de l’imaginaire populaire, que l’auteur, soucieux de donner un ancrage au texte dans la réalité yéménite, transfigure cette expérience existentielle moderne.The latest collection of short stories by Mu/hammad 'Abd al-Wakîl signals a major shift in contemporary Yemeni literature: from an experimental form, breaking away from both traditional short story conventions and Yemeni reality, to another, more accomplished form, unabashedly mixing traditional short story principles with renewed genre forms. The short story entitled The Vulture Master presents us, from within a traditional narrative structure, with a modern fantasy tale blending in realism, symbolism and poetry, and where the writer deals in his own way with such contemporary literary themes as disenchantment, perpetual captivity, and the duality of dream and reality. Drawing his inspiration from language itself, oral practices, beliefs and popular imagery, the writer, seeking to set his tale firmly in Yemeni reality, manages to transfigure this modern existential experiment.

  11. La conscience de la Mestiza. Vers une nouvelle conscience

    OpenAIRE

    Anzaldúa, Gloria

    2013-01-01

    Por la mujer de mi raza hablará el espíritu. José Vasconcelos, philosophe mexicain, a envisagé una raza mestiza, una mezcla de razas afines, una raza de color —la primera raza síntesis del globo.Il l’a appelée race cosmique, la raza cósmica, une cinquième race englobant les quatre principales races du monde. Contrairement à la théorie de l’Aryen pur, comme à la politique de pureté raciale que pratique l’Amérique blanche, sa théorie est inclusive. À la confluence d’au moins deux courants génét...

  12. Un nouveau genre, une nouvelle espèce de Torneutini : Gnathopraxithea sarryi nov. sp. (Coleoptera, Cerambycidae)

    OpenAIRE

    C. A. C. Seabra; Tavakilian, Gérard

    1986-01-01

    Description de #Gnathopraxithea sarryi$, nouveau genre, nouvelle espèce, illustrée par deux photographies, avec son insertion dans la clef des genres de #Torneutini$ (#Coleoptera$, #Cerambycidae$). (Résumé d'auteur)

  13. Deux nouvelles lèvres de Cassidae au PPNB

    Directory of Open Access Journals (Sweden)

    Gaëlle Le Dosseur

    2008-03-01

    Full Text Available En 2008, deux nouvelles lèvres de Cassidae ont été mises au jour sur deux sites néolithiques (Néolithique Précéramique B : PPNB du Levant Sud : Beisamoun et Yiftahel. Il s’agit d’objets façonnés sur la lèvre externe de coquillages méditerranéens appelés Phalium granulatum. Des aménagements pour la suspension (perforations aux extrémités laissent penser que ces objets ont été utilisés comme pendentifs ou qu’ils ont été cousus sur des vêtements ou des accessoires. Ces découvertes alimentent la discussion sur l’approvisionnement en matières premières mais aussi sur les parentés culturelles et les singularités de chaque site à cette époque. Si l’usage de lèvres de Cassidae est partagé par de nombreux sites PPNB, les modes de fabrication et de suspension ne sont pas strictement les mêmes sur tous. Ces variations reflètent-elles une évolution des modes de suspension dans le temps (au cours du PPNB moyen/récent ? Ou révèlent-elles des choix « contemporains » distincts, qui contribueraient à définir l’identité propre de chaque site ?   Après le Néolithique, l’usage des lèvres de Cassidae se poursuit aux Âges des métaux. À cette époque plus qu’au Néolithique, ces objets sont retrouvés dans des contextes funéraires. Il est difficile de savoir si cette situation résulte des méthodes de fouilles distinctes adoptées sur les sites néolithiques et sur ceux des Âges des métaux ou si elle est une réalité archéologique. Dans le second cas, on pourrait proposer que le sens donné aux lèvres de Cassidae, en partie reflété par le lieu de dépôt, a pu évoluer avec le temps.Two more cassid lips for the PPNBBeisamoun and Yiftahel In 2008, two new cassid lips have been found on two Neolithic sites (Pre Pottery Neolithic B, in the Southern Levant: Beisamoun and Yiftahel. These objects are shaped on the external lip of shells coming from the Mediterranean Sea and called Phalium

  14. Nouvelle structure de capteur à courants de Foucault et algorithme associé pour la mesure des propriétés électrique et magnétique d'un métal

    OpenAIRE

    Lê, Minh-Quang; Placko, Dominique

    1995-01-01

    Cet article décrit une nouvelle structure de capteur à courants de Foucault qui permet d'améliorer la sensibilité du capteur tout en conservant sa résolution latérale. Nous avons développé un modèle analytique de ce capteur qui peut être inversé pour estimer la conductivité électrique, la perméabilité magnétique d'une cible homogène et/ou la distance capteur-cible. La procédure d'inversion a été décrite et montre une possibilité d'estimer ces trois paramètres avec précision. L'expérience a ét...

  15. Michel Tozzi (2012). Nouvelles pratiques philosophiques.Lyon : Chroniques sociales, 343 p.

    OpenAIRE

    Roger, Monjo

    2013-01-01

    Avec cette nouvelle publication, Michel Tozzi nous offre un véritable synthèse, un panorama aussi exhaustif que possible, détaillé et précis, des « nouvelles pratiques philosophiques », ces pratiques de la philosophie qui n’ont cessé de se développer, en France et ailleurs, depuis le début des années 90, dans le cadre scolaire (de la maternelle au lycée) mais aussi hors de l’école (maison de retraite, hôpital, prison, médiathèques, etc.) et sous des formes non scolaires (comme le « café philo...

  16. Mobilisations politiques dans le monde arabe et nouvelle affirmation de la citoyenneté

    OpenAIRE

    Challand, Benoît

    2016-01-01

    Ce travail s’intéresse principalement aux liens entre la société et l’État dans le monde arabe avant et après les révolutions, et aborde l’impact que ces dernières ont eu à la fois sur les acteurs individuels et sur les nouvelles pratiques de la citoyenneté. Deux notions, celles de présentisme et d’intersectionnalité, sont mobilisées pour comprendre les nouvelles configurations qui déterminent les rapports horizontaux entre les citoyens et, verticaux, des citoyens avec la sphère du pouvoir. C...

  17. L’Observatoire numérique Nouvelle-Calédonie

    Directory of Open Access Journals (Sweden)

    Charlotte Ullmann

    2013-06-01

    Full Text Available Ses missions consistent à observer le développement numérique et favoriser l’animation territoriale des acteurs en Nouvelle-Calédonie. Parrainée par l’association calédonienne pour les technologies de l’information et de la communication (ACTIC et le ministère en charge de l’économie numérique du Gouvernement de Nouvelle-Calédonie nommé depuis mai 2009, une mission d’étude a été menée depuis juin 2010 pour définir les contours d’un Observatoire numérique. A travers cette étude, il s’agissai...

  18. Description d’une nouvelle espèce du genre Platypria

    NARCIS (Netherlands)

    Gestro, R.

    1898-01-01

    Je suis redevable à l’amabilité de M. Ritsema de l’occasion de décrire une nouvelle espèce de Platypria, genre qui a été jadis l’objet de quelques uns de mes travaux et je remercie le savant Conservateur au Musée de Leyde d’avoir été et d’être toujours si obligeant et si large dans ses communication

  19. Description d’une espèce nouvelle du genre Ectatorhinus (Coleoptera: fam. Curculionidae)

    NARCIS (Netherlands)

    Roelofs, W.

    1890-01-01

    Monsieur Neervoort van de Poll ayant reçu récemment avec d’autres insectes une nouvelle espèce d’ Ectatorhinus, capturée dans l’intérieur de Bedagei (Deli, Sumatra orient.) par M. J. Z. Kannegieter, m’a invité de la décrire, ce que je fais avec d’autant plus de plaisir que j’avais décrit dans le tem

  20. Description de deux nouvelles espèces du genre Onychogymnus, Quedenfeldt

    NARCIS (Netherlands)

    Roelofs, W.

    1892-01-01

    Mr. Neervoort van de Poll possède deux nouvelles espèces de Curculionides voisins du genre Diabathrarius Schh. qui me paraissent, malgré quelques différences, peut-être génériques, pouvoir entrer dans le genre Onychogymnus Quedenf. ¹). La première de ces espèces, originaire de Madagascar, possède un

  1. Ut rosa spineti compensans flore rigorem. La Vierge Immaculée comme Nouvelle Ève dans la peinture italienne du xvie siècle

    Directory of Open Access Journals (Sweden)

    Marianna Lora

    2012-04-01

    Full Text Available Parmi les différents types iconographiques de l’Immaculée Conception qui se diffusent dans la peinture italienne du xvie siècle, la Vierge Immaculée Nouvelle ève revêt une importance toute particulière. Dans ce genre d’images, l’accent est porté sur le fait que Marie Immaculée doit être considérée comme la Nouvelle Ève, celle qui s’oppose à la première femme ; elle est sans péché dès l’origine car elle va opérer contre le péché même. C’est seulement en 1518 que l’opposition Marie–ève est adoptée pour la première fois en Italie pour mettre en image le privilège immaculiste de la Vierge : Guillaume de Marcillat peint cette année-là sa Dispute sur l’Immaculée Conception en présence d’ève pour l’église de San Francesco à Arezzo. Toujours à Arezzo ou dans ses environs, Luca Signorelli et Rosso Fiorentino réalisent ensuite également plusieurs représentations de la Vierge Immaculée comme Nouvelle ève. à partir de 1541, l’arétin Giorgio Vasari reprend ce sujet et l’introduit à Florence grâce à son Allégorie de l’Immaculée Conception de l’église de Santi Apostoli. S’il apparaît évident que ce type iconographique si particulier prend naissance à Arezzo, il est difficile d’expliquer pourquoi cette petite ville « de périphérie » en constitue le berceau. La présence en ville du chanoine Giovanni Pollastra en est certainement l’une de raisons : très érudit, Pollastra se prête volontiers à endosser le rôle de conseiller iconographique pour les artistes de son temps qui travaillent à Arezzo. C’est certainement lui qui aide Guillaume de Marcillat, Rosso Fiorentino et Giorgio Vasari à concevoir leurs Vierges Immaculées Nouvelles èves. Le retable de Vasari peint en 1541 a un succès extraordinaire et devient un modèle incontournable pour toute Immaculée Conception dans la peinture toscane du xvie siècle. Son originalité réside en particulier dans l

  2. David, Charles-Philippe et la Chaire Raoul-Dandurand (éds : Repenser la sécurité, nouvelles menaces, nouvelles politiques, Quebec : Fides la Presse, 315 p, annexes.

    Directory of Open Access Journals (Sweden)

    Gérard Groc

    2004-12-01

    Full Text Available La Remmm couvrant essentiellement le monde arabe et musulman, le livre Repenser la sécurité, nouvelles menaces et nouvelles politiques dont nous faisons ici le compte-rendu, nous interpelle moins dans le fourmillement de considérations militaires, stratégiques, balistiques extrêmement techniques qu'en fonction de la prémisse à partir de laquelle est faite cette réévaluation de la sécurité, à savoir l'aire musulmane mais aussi l'islam. L'objet global de ce livre, réalisé par toute une équipe ...

  3. ALLER + INFINITIF ET SES TRADUISANTS EN ITALIEN : REMARQUES POUR UNE NOUVELLE CATEGORISATION DE LA PERIPHRASE

    Directory of Open Access Journals (Sweden)

    Alida SILLETTI

    2013-05-01

    Full Text Available Cette recherche porte sur la périphrase aller + infinitif en français contemporain et ses traduisants en italien. Les études les plus récentes (dont Vet, 2007 en la matière mettent en évidence une nouvelle catégorisation de la périphrase, notamment comme temps verbal à part entière (Vetters, Lière, 2009. Il est donc possible de situer aller au milieu d’un continuum temporel, entre le présent pro futuro et le futur simple flexionnel, pour signifier le futur temporel verbal en français (Silletti, sous presse. Ces études insistent également sur le fait que, au niveau sémantique, aller exprimerait un futur proche du moment de l’énonciation en termes de certitude de la part du locuteur (Provôt, Desclés, Vinzerich, 2010 plutôt qu’en termes d’immédiateté temporelle. Grâce à notre expérience d’enseignement de la traduction français - italien pour italophones nous avons remarqué que la traduction d’aller posait quelques problèmes. Selon nous, deux facteurs expliquent cette difficulté : d’une part, le manque d’une périphrase fonctionnellement proche d’aller en italien ; d’autre part, un traitement non homogène d’aller. C’est pourquoi nous analyserons d’abord la nouvelle catégorisation d’aller en français ; puis nous proposerons les exemples d’aller tirés de notre corpus. Celui-ci est constitué de quatre textes français contemporains et de leurs traduisants italiens proposés par 250 étudiants. Ensuite, nous ferons état du traitement d’aller au sein de cinq grammaires d’apprentissage du français pour italophones. Notre but consistera à évaluer les choix des étudiants en les rapportant aux co(ntextes d’occurrences d’aller. Suite à ce travail d’évaluation, nous tenterons d’exposer une nouvelle catégorisation d’aller pour les grammaires d’apprentissage du français pour italophones. Celle-ci devrait tenir compte de plusieurs paramètres et y intégrer les nouvelles

  4. Une nouvelle approche de la relation vision-commande en robotique

    OpenAIRE

    Espiau, Bernard; Chaumette, François; Rives, Patrick

    1990-01-01

    Ce rapport presente les concepts et les resultats relatifs a une nouvelle approche de la commande referencee vision en robotique. L'idee de base consiste a considerer un systeme de vision comme un capteur particulier associe a une tache, et insere dans une boucle de commande. Une fois effectuee l'etape necessaire de modelisation, la problematique ainsi posee ressort alors de l'automatique, et met en avant des questions naturelles de stabilite et de robustesse. Ce rapport est structure comme s...

  5. Marginalité, adaptation et agriculture dans les hautes terres de Nouvelle-Zélande

    OpenAIRE

    Steven Kelly; Willie Smith

    2012-01-01

    La population des espaces montagnards néo-zélandais est dispersée, et les impacts directs des catastrophes, dans ces régions, touchent principalement les communautés agricoles et les réseaux de communication. Soumis aux séismes (principalement dans les Alpes du Sud) et aux éruptions volcaniques (sur le plateau central de l’Île du Nord), les espaces montagnards de Nouvelle-Zélande sont plus généralement enclins à des problèmes d’érosion et de glissements de terrain, et à des chutes de neiges a...

  6. Meta Analisis sa Pagsusuri ng Maiikling Kwento sa mga Tesis at Disertasyon

    Directory of Open Access Journals (Sweden)

    Regina I. Cuizon

    2014-10-01

    Full Text Available Anumang mga pagbabago na makikita sa mundo ay bunga ng pananaliksik. Ang meta-analisis ay isa sa mga bunga ng pananaliksik na ginagamit sa kasalukuyan bilang teknik upang malaman iba pang mga nagsulputang informasyon. Ito’y pag-aaral sa mga pag-aaral. Isang kritikal at sistematikong pagsusuri sa istruktura ng mga pag-aaral. Maging gabay sa mga gradwadong paaralan sa pagpili ng paksang pagaaralan. Pangunahing layunin na matiyak ang mga pamamaraan sa pagsusuri ng maiikling kwento ng mga tesis at disertasyong nagawa mula sa mga piling SUCs. Desinyong kwalitatibo - kontent analisis sa pagsusuri ng: kaanyuan ayon sa suliranin, metodolohiya, paglalahad at interpretasyon ng mga datos, natuklasan, konklusyon, at rekomendasyon; kahinatnan ayon sa pagkatulad, pagkakaiba at kabuluhan; Emerging tema. Napag-alaman na ang karaniwang pinag-aralan ay 30% kahalagahang pangkatauhan, 20% larawangdiwa ng mga kababaihan at 10% gramatikang aspeto. Sa metodolohiyang ginamit, 80% desinyong kwalitatibo at 20% kwantitatibo-kwalitatibo. Sa paglikom ng datos 60% diretsahang pagsusuri, 30% talatanungan at 10% tseklis. Sa pag-analisa 90% kontent analisis at 10% gramatikal analisis. Batay sa natuklasan, ang pagsusuri ng maiikling kwento sa mga tesis at disertasyon mula sa iba’t ibang paaralan gamit ang meta analisis ay isang epektibo, mabisa, objektibong paraan at kagamitan na magagamit sa makatarungang paghatol; pamumuna sa kabuluhan at kagandahan; paghaham- bing sa mga kritikal na isyu; at pormulasyon ng panibagong pamantayan at batas.

  7. Description de trois nouvelles especes de Paractenopsyllus (Siphonaptera : Leptopsyllinae de Madagascar

    Directory of Open Access Journals (Sweden)

    Duchemin J.B.

    2004-09-01

    Full Text Available Les mâles de trois nouvelles espèces rares de Paractenopsyllus Wagner, 1938, genre endémique de Madagascar, sont décrits. Paractenopsyllus beaucournui, P. oconnori et P. raxworthyi ont été collectés à partir de micromammifères endémiques de Madagascar (excepté un rat noir et, comme les autres espèces du genre, les biotopes de récolte se situent au sein des forêts des hautes terres centrales ou des massifs du Nord de l'île. Deux des trois espèces décrites ont été récoltées à des altitudes relativement basses pour le genre, à la limite de la zone écoclimatique des hautes terres. Les affinités morphologiques entre ces nouvelles espèces et celles déjà décrites permettent des rapprochements taxonomiques. Une clef de détermination des 20 espèces de Leptopsyllinae malgaches est présentée.

  8. La christianisation de la Nouvelle-Espagne ou le rêve d’une église indienne : la praxis de l’évangélisation

    Directory of Open Access Journals (Sweden)

    Hervé Pujol

    2012-01-01

    Full Text Available En consacrant la partition du Nouveau monde entre l’Espagne et le Portugal et en fixant aux deux royaumes les limites de leur souveraineté, les bulles alexandrines de 1493 ont assigné aux Espagnols la mission d’évangéliser les Indiens. Ainsi, avant même le débarquement de Cortès au Mexique, cette interaction entre le temporel et le spirituel encourageait déjà la dynamique de conversion autant qu’elle scellait le sort des autochtones appelés à devenir et vassaux et chrétiens. Initié brutalement, le processus évangélisateur assura pourtant la renaissance de l’âme indigène tandis qu’il apparut, aux yeux des missionnaires en charge de sa réalisation, comme l’occasion de poser, en Nouvelle-Espagne, les fondements d’une nouvelle église, plus vertueuse.In partitioning the New World, Pope Alexander VI in the papal bulls of 1493 (Inter Caetera granted sovereignty of these lands to Spain and Portugal, ordering the religious conversion of the indigenous people by the Spaniards in exchange. Even before the arrival of Cortès in Mexico, the temporal and spiritual conditions of the sovereignty motivated the missionaries and started the conversion dynamic that would seal the fate of the natives to become vassals and Christians. Though brutal conversion tactics were utilized, the religious souls of the natives were re-ignited as Christians, and in the eyes of the missionaries responsible, provided the opportunity to establish a new and more virtuous church in the New World.

  9. La christianisation de la Nouvelle-Espagne ou le rêve d’une église indienne : les agents de l’évangélisation

    Directory of Open Access Journals (Sweden)

    Hervé Pujol

    2012-01-01

    Full Text Available En consacrant la partition du Nouveau monde entre l’Espagne et le Portugal et en fixant aux deux royaumes les limites de leur souveraineté, les bulles alexandrines de 1493 ont assigné aux Espagnols la mission d’évangéliser les Indiens. Ainsi, avant même le débarquement de Cortès au Mexique, cette interaction entre le temporel et le spirituel encourageait déjà la dynamique de conversion autant qu’elle scellait le sort des autochtones appelés à devenir et vassaux et chrétiens. Initié brutalement, le processus évangélisateur assura pourtant la renaissance de l’âme indigène tandis qu’il apparut, aux yeux des missionnaires en charge de sa réalisation, comme l’occasion de poser, en Nouvelle-Espagne, les fondements d’une nouvelle église, plus vertueuse.In partitioning the New World, Pope Alexander VI in the papal bulls of 1493 (Inter Caetera granted sovereignty of these lands to Spain and Portugal, ordering the religious conversion of the indigenous people by the Spaniards in exchange. Even before the arrival of Cortès in Mexico, the temporal and spiritual conditions of the sovereignty motivated the missionaries and started the conversion dynamic that would seal the fate of the natives to become vassals and Christians. Though brutal conversion tactics were utilized, the religious souls of the natives were re-ignited as Christians, and in the eyes of the missionaries responsible, provided the opportunity to establish a new and more virtuous church in the New World.

  10. Planejamento em Saúde

    Directory of Open Access Journals (Sweden)

    Antonio José Costa CARDOSO

    2014-03-01

    Full Text Available Esse texto pretendeu subsidiar aula sobre Planejamento e Avaliação em Saúde para os Analistas Técnicos de Políticas Sociais lotados no Ministério da Saúde (MS, na perspectiva de promover uma maior compreensão dos antecedentes históricos do planejamento em saúde no Brasil e na América Latina, do referencial teórico metodológico do planejamento estratégico e participativo, e refletir sobre os avanços e desafios que se apresentam no atual contexto de construção do Sistema Único de Saúde (SUS. Neste sentido, foi estruturado na perspectiva de responder a três questões orientadoras: 1 Como tem se dado esse processo de coordenação do Planejamento Estratégico Nacional no âmbito do SUS, em cooperação técnica com os Estados, Municípios e Distrito Federal? 2 Quais são as tecnologias de gestão e planejamento em saúde adotadas pelo MS para conduzir esses processos de forma integrada? 3 Como se dá o gerenciamento das ações no MS? Como os planos, projetos e programas são monitorados pelas equipes responsáveis?

  11. “Bachelard, science, poésie, une nouvelle éthique?” Convegno di Cerisy-la-Salle

    Directory of Open Access Journals (Sweden)

    Aurosa Alison

    2012-10-01

    Full Text Available “Bachelard, science, poésie, une nouvelle éthique?” Convegno di Cerisy-la-Salle (Direzione e coordinamento di Jean-Jacques Wunenburger ; Centre Culturel International de Cerisy-la-Salle 25 giugno-1 agosto 2012 di  Aurosa Alison

  12. L'acteur, l'employeur et l'imprésario. Trois nouvelles notions pour gérer les nouvelles relations entre l'acteur de sa vie professionnelle et l'entreprise

    OpenAIRE

    2011-01-01

    Cet ouvrage publié par le groupe Adecco (entreprise d'intérim) a été réalisé par son Observatoire des Hommes et des Organisations (Lab'Ho) auquel participent également deux cabinets de consultants : Alexandre Tic et Lee Hetch Harrison. L'analyse qui nous est proposée s'appuie sur une enquête qualitative (150 entretiens) et un questionnaire diffusé dans six pays auprès de jeunes de 25 à 35 ans : Allemagne, Belgique, Espagne, Italie, France, Grande-Bretagne (2050 questionnaires auto-administrés...

  13. A Robust Separation Assurance (SA) Architecture Using Integrated Airborne and Ground SA Concepts Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Intelligent Automation, Inc. proposes a robust SA architecture that uses integrated airborne and ground-based SA concepts such that SA functions are switched between...

  14. Cerditos Company S.A.

    OpenAIRE

    2010-01-01

    Esta idea de negocio consiste en la adecuación de una granja, en la cual se desarrollará el proceso de levante y comercialización de carne de cerdo en pie o en canal. Cerditos Company S.A. es una empresa que busca la calidad y el buen servicio, brindando al consumidor garantías de la carne que está consumiendo. En Colombia el mercado ha sido poco explotado comparado con otros países como Chile o Europa, donde el consumo es muy significativo, Cerditos Company S.A. busca aumentar el cons...

  15. Nouvelle cuisine

    CERN Multimedia

    2007-01-01

    Diners at CERN's Restaurant No. 1 have been adjusting to some temporary arrangements while building work takes place in the main service area. The essential renovation will bring many improvements in the near future. The restaurant before restoration. A huge white marquee erected on a green lawn greets the eye. The sight is familiar in the summer months, but the sharp chill in the air disrupts the scene. Instead of a mid-summer's day, it's actually the middle of January. This apparently strange reversal of seasons is a way of providing an additional dining and service area outside Restaurant No. 1. As renovations get underway inside, the mysterious hum of drills and the hollow echo of hammering behind scaffold boards raise our curiosity about what is in-store. 'Everything will be better,' says Mario Zanolini, head waiter of Restaurant No. 1. 'It will be more comfortable for the customers. The free-flow area will be bigger and there will be 7 tills instead of the previous 5.' These are just for starters. ...

  16. The Importance of the Idealist Discourse in Defence of American Foreign Policy Initiatives: beyond rhetoric towards a new form of imperialism L’importance du discours idéaliste pour défendre la politique étrangère américaine : vers une nouvelle forme d’impérialisme

    Directory of Open Access Journals (Sweden)

    Andrew Ives

    2009-10-01

    Full Text Available Les États-Unis font rarement appel à un discours basé sur la défense de leurs propres intérêts nationaux pour défendre sa politique étrangère. Dans leur discours officiel, ils tentent plutôt de subordonner l’intérêt national aux objectifs plus nobles de défendre les droits de l’homme ou la démocratie. Cet article commence par retracer les origines de ce discours idéaliste américain. Puis, il tente d’analyser le rôle important joué par ce discours, suggérant qu’il est révélateur d’une nouvelle forme d’impérialisme. Elle est nouvelle dans la mesure où l’État-nation dominant se présente comme l’incarnation de la démocratie libérale faisant en sorte que ses propres intérêts coïncident avec ceux de la démocratie libérale. Le discours idéaliste serait, selon l’auteur, non pas une façade, mais plutôt un élément essentiel d’une nouvelle forme d’impérialisme car la relation étroite qui s’établit entre démocratie libérale et interventionnisme américain renforcerait les intérêts du capitalisme moderne.  

  17. ANALISIS DAYA SAING KEDELAI INDONESIA

    Directory of Open Access Journals (Sweden)

    Sarwono Sarwono

    2014-09-01

    Full Text Available RCA (Revealed Comparative Advantage index of soybean in Indonesia from 1983 up to 2013 is less than one, mostly. It means that the competitiveness of soybean in Indonesia is low. The purpose of this study is to analyze the factors influence the soybean competitiveness. OLS (Ordinary Least Square was used as the analysis method. Hypotheses test based on that analysis model is not bias, so that, classic divergence test is needed. It is for getting the Best Linier Unbiased Estimator (BLUE appraisal. T statistic and F statistic were also applied. The result of this research shows that production and export have positive and significant influence. In addition, exchange rate and government policy do not influence the Indonesia soybean competitiveness.Indeks RCA (Revealed Comparative Advantage kedelai Indonesia dari tahun 1983-2013 kecenderungan bernilai kurang dari satu yang berarti daya saing kedelai Indonesia rendah.Penelitian ini bertujuan untuk menganalisis faktor-faktor yang mempengaruhi daya saing kedelai Indonesia.Metode analisis yang digunakan adalah Ordinary Least Square (OLS.Pengujian hipotesis berdasarkan model analisis tersebut tidak bias maka perlu dilakukan uji penyimpangan klasik yang tujuannya agar diperoleh penaksiran yang bersifat Best Linier Unbiased Estimator (BLUE.Pengujian statistik menggunakan uji t statistikdan uji f statistik.Hasil penelitian ini menunjukkan bahwa produksi dan ekspor berpengaruh secara positif dan signifikan terhadap daya saing kedelai Indonesia. Nilai tukar rupiah dan kebijakan pemerintah tidak berpengaruh terhadap daya saing kedelai Indonesia.

  18. Les nouvelles frontières de l’humanitaire : l’impasse syrienne

    OpenAIRE

    Abu-Sada, Caroline; Brigaud, Thierry; Lesens, Pascal Dessenne et Olivier; Martin, Boris; Michel, Boris; Oberreit, Stephan; Perrin, Jean-Pierre; Potier, Gilbert; Rubio, Francisco; Ryfman, Philippe; Salignon, Pierre; Salignon, Thierry Brigaud et Pierre; Tallès, Olivier; Troy, Jean-Yves

    2013-01-01

    Le mouvement humanitaire français puise à la source d’une utopie, celle de faire tomber les frontières. Pourtant de « nouvelles frontières » apparaissent, en même temps que les frontières traditionnelles resurgissent dans toute leur dureté. C’est le cas en Syrie où l’action humanitaire s’avère particulièrement complexe, coincée entre l’obstination d’un dictateur et la frilosité des États et des bailleurs. Les ONG étrangères ne sont pas absentes pour autant, s’adaptant à ce contexte dangereux,...

  19. Qui sera le nouvel Einstein ? Vers une nouvelle theorie de la gravitation

    Science.gov (United States)

    Bonnet-Bidaud, J. M.

    1999-10-01

    Un debat de plus d'un siecle a resurgi ces toutes dernieres annees avec une vigueur nouvelle. L'enjeu ? Mettre fin, ni plus ni moins, a l'une des contradictions les plus inouies de la physique fondamentale, en reconciliant mecanique quantique et relativite generale. En effet, a l'heure ou la gravitation semble enfin sur le point de fusionner avec les trois autres forces de la nature. il est certain que la relativite d'Einstein doit etre bientot remplacer par une autre theorie... Reste quye tous les physiciens sont loin de s'accorder sur la marche a suivree. Gravitation quantique, relativite d'echelle, supersymetrie, les candidates ne manquent pas.

  20. Une Nouvelle Orientation Psychophysique dans la Pédagogie Théâtrale Contemporaine

    Directory of Open Access Journals (Sweden)

    Vezio Ruggieri

    2015-09-01

    Full Text Available Cet article a pour but de présenter comment les apports du modèle psychophysiologique bio-existentialiste élaboré par Vezio Ruggieri et ses collaborateurs peuvent jeter une lumière nouvelle sur les processus sous-jacents le jeu de l’acteur tels que la présence scénique, le processus d’identification avec un personnage et le complexe mécanisme de la prosodie. Cet encadrement théorique, qui voit le rapport corps-esprit dans une relation circulaire, éclairera le lecteur sur les bases physiologiques de la perception et de l’imagination ainsi que sur le rôle fondamental que la structure musculaire joue dans la construction de ces phénomènes.

  1. Développement d’une nouvelle architecture logicielle pour un enregistreur embarqué

    OpenAIRE

    VERDONI, Quentin

    2012-01-01

    Participation à l’élaboration d’un enregistreur embarqué de type boite noire appliqué à l’automobile. Cet enregistreur répondant au nom de « EMMA3 », Enregistreur eMbarqué de Mécanismes d’Accidents, est une nouvelle version d’un produit déjà développé par l’IFSTTAR. La version 3 sera plus petite, moins couteuse, et plus performante que la précédente. Le but de ce stage était de développer un programme en C pour le microcontrôleur STM32F103 qui lui permette ...

  2. Images de femmes dans le cinéma de la Nouvelle Vague

    OpenAIRE

    Sellier, Geneviève

    2006-01-01

    L’émergence de la Nouvelle Vague au tournant des années 1960 peut se lire comme la revendication d’une posture créatrice relevant de la culture d’élite, dans un medium jusque là éminemment populaire, le cinéma. S’inscrivant dans une tradition culturelle particulièrement forte en France, ce nouveau cinéma va se conjuguer quasi-exclusivement au masculin singulier, et les figures féminines qu’il crée oscillent entre la prise en compte de l’émancipation des femmes réelles et des fantasmes romanti...

  3. Turquie, Grèce : un passé commun, des nouvelles perspectives

    OpenAIRE

    Akgönül, Samim; Bertrand, Gilles; Bilici, Faruk; Dalègre, Joëlle; Drettas, Georges; Sawas, Stéphane; Tonnet, Henri; YÉRASIMOS, Stéphane; Zerouali, Basma

    2013-01-01

    Sans être naïfs sur les questions aussi importantes que le contentieux en mer Égée, le problème chypriote, la question des minorités, la confrontation des nationalismes, l’instrumentalisation de l'histoire, l’utilisation des différends comme outil politique interne, avec ce numéro spécial « Turquie et Grèce : un passé commun, des nouvelles perspectives », nous avons voulu délibérément mettre l’accent sur la complémentarité et la communauté culturelle entre Grecs et Turcs, bien plus encore que...

  4. Securite, dangerosite, biopolitique: trois versants d'une nouvelle pratique de pouvoir sur les individus

    Directory of Open Access Journals (Sweden)

    Jean-François Bert

    2012-01-01

    Full Text Available Le questionnement de Foucault sur la judiciarisation des sociétés contemporaines renvoie à plusieurs controverses qui, entre 1974 et 1976, ont spécifiquement concerné la question du vivant comme de son rapport au champ du droit et des institutions politiques. Ces polémiques se sont cristallisées autour d'affaires judiciaires retentissantes mais également autour d'un discours technique et politique qui donne une place nouvelle aux notions de dangerosité, de sécurité et à la question plus générale de la gestion du vivant. Trois discours qui, pour Foucault, sont révélateur d'un profond changement de société et de mode de gouvernement des individus.

  5. Ville nouvelle, quarante ans après : les pionniers vieillissants de Maurepas

    Directory of Open Access Journals (Sweden)

    Marie Peretti-Ndiaye

    2009-01-01

    Full Text Available Construites à partir des années 1960 sous l’impulsion du Schéma directeur d’Aménagement et d’Urbanisme de 1965, cinq villes nouvelles ont vu le jour en région parisienne. Leur aménagement laisse entrevoir une volonté de répondre à des besoins urbains identifiés, se conjuguant parfois avec l’offre d’espaces, de services ou d’équipements envisagés alors comme novateurs. Maurepas, rattachée jusqu’en 1984 à l’agglomération nouvelle de Saint-Quentin-en-Yvelines, a été façonnée en partie par ces aspirations. Elle constitue aujourd’hui une commune à la population vieillissante et à l’urbanisme marqué par des jeux d’échelle, des cloisonnements et par une relative uniformité. La configuration de la ville laisse entrevoir la volonté d’ébaucher « un nouveau genre de vie urbaine »(Pachaud, 2006 manifeste durant les années soixante et soixante-dix tandis que l’histoire de la commune permet d’envisager les difficultés inhérentes à l’intercommunalité. Au cœur de cette histoire se retrouvent des ménages de la classe moyenne, entrés dans le périurbain comme des pionniers. Portés par l’idéologie d’une ville-nouvelle où « tout est à construire » et qui leur ouvrait, parallèlement, des perspectives nouvelles en termes « d’espaces à soi », ces derniers sont aujourd’hui âgés de plus de soixante ans. Quarante ans après leur installation, leurs discours sur la ville révèlent l’existence de plusieurs ordres de tension : tension entre ruralité et urbanité, d’une part, tension entre adhésion, différenciation et réflexivité, de l’autre. Ces tensions peuvent être mises en parallèle avec les évolutions de la ville et la façon dont les formes urbaines sont mises en question dans l’espace des débats publics. Ces différents éléments nous conduiront à envisager les résistances et les projections à l’œuvre ainsi que les processus de subjectivation qu’elles r

  6. Relativité et quanta une nouvelle révolution scientifique

    CERN Document Server

    Cohen-Tannoudji, Gilles

    2017-01-01

    Ces trois dernières années, les moissons scientifiques ont été exceptionnellement fructueuses, de la découverte du boson de Higgs à celles des ondes gravitationnelles émises lors de la coalescence de deux trous noirs massifs, et aux observations du fond cosmologique par le satellite Planck. L'humanité vient alors d'atteindre un nouveau palier dans la compréhension du monde quantique et du monde de la gravitation : nos bases théoriques, expérimentales et technologiques forment un socle scientifique solide pour aller plus loin et tenter de répondre aux nouvelles questions qui surgissent suite à ces découvertes... Enquête et mise au point sur une révolution en cours.

  7. Bertrand Badie, Dominique Vidal (dir.), Nouveaux acteurs, nouvelle donne. L'état du monde 2012

    OpenAIRE

    2014-01-01

    Cette édition 2012 de L’état du monde, dirigée par Bertrand Badie et Dominique Vidal ambitionne examiner les modalités d’action des « nouveaux acteurs » qui émergent dans un contexte de « nouvelle donne » où l’hyper puissance américaine se trouve en perte de vitesse alors que les printemps arabes induisent de profonds changements dans l’ordre social établi. Le projet des contributeurs de l’ouvrage est clair : prendre la mesure de la déstabilisation du monde et des rééquilibrages qu’elle impli...

  8. Karl Polanyi, la Nouvelle sociologie économique et les forces du marché

    Directory of Open Access Journals (Sweden)

    Ronan Le Velly

    2008-12-01

    Full Text Available Cet article montre en quoi plusieurs auteurs de la Nouvelle sociologie économique tendent à adopter un regard incomplet sur les forces du marché. Pour cela, l’auteur distingue deux notions d’encastrement renvoyant pour la première à un cadre méthodologique institutionnaliste et pour la seconde à l’observation du poids variable des forces du marché. Il établit qu’autant des sociologues classiques comme Weber ou Polanyi ont su coupler ces deux approches, autant plusieurs travaux majeurs de la Nouvelle sociologie économique, notamment ceux de Zelizer, de Fligstein et de Biggart, adoptent la première perspective mais ne traitent que de façon partielle de la seconde. L’auteur met particulièrement en cause les objets de recherche retenus par ces derniers auteurs, dès lors que sont systématiquement privilégiées des situations où les forces du marché sont tenues à l’écart.This article shows how many authors of the New Economic Sociology tend to adopt an incomplete view of market forces. The author distinguishes two notions of embeddedness, one related to the institutionalist theories and the second to the observation of the variable weight of market forces. It is established that classical sociologists such as Weber or Polanyi have joined these two approaches, while manyu works of the New sociological economy, for examle those of Zelizer, Fligstein or Biggart adopt the first perspective, but only treat the second partially. The author particularly questions the research objects chosen by these authors, since he considers that they generally refer to situations where market forces are held at bay.

  9. La nouvelle donne de la santé globale : dynamiques et écueils

    Directory of Open Access Journals (Sweden)

    Marine Buissonnière

    2012-04-01

    Full Text Available Les quinze dernières années ont été marquées par l’avènement de nouveaux acteurs dans le champ de la santé globale et l’augmentation de l’aide au développement en faveur de la santé. Ces acteurs ont capté une partie importante des ressources privées et publiques supplémentaires disponibles et se sont imposés comme les pièces maîtresses de ce nouvel échiquier, aux dépens des institutions traditionnelles qui ont graduellement perdu leur prépondérance et ont vu leur leadership s’affaiblir. Les choix et politiques de santé ont peu à peu échappé à la seule autorité des institutions qui en avaient jusqu’alors le mandat et en assumaient la charge. Certains pans entiers de la santé sont désormais dominés par des financeurs privés, devenus de facto prescripteurs d’orientations de santé publique. Cette nouvelle donne pose des questions essentielles de gouvernance et de responsabilité. Qui décide des orientations ? Comment les décisions sont-elles prises ? Les pays destinataires de l’aide doivent encore trop souvent subir le manque de coordination des donateurs et l’absence d’alignement des agendas. Dans ce contexte, et en prenant acte de cette nouvelle réalité, quelques pistes mériteraient d’être explorées afin de garantir que les orientations en matière de santé globale reflètent au mieux la réalité des besoins et les aspirations des pays.

  10. Varyasyong Leksikal sa mga Dayalektong Mandaya

    Directory of Open Access Journals (Sweden)

    Dr. Raymund M. Pasion

    2014-12-01

    Full Text Available Layuning panlahat sa pag-aaral na ito na tuklasin ang varyasyong leksikalsa Wikang Mandaya na matatagpuan sa Probinsyang Davao Oriental. Bilang lunsaran sa paglilikom ng mga datos, ginamit ang mga terminong kultural na pangkabuhayan tulad ng pagsasaka, pangangaso, pangingisda at paghahayupan nanababatay sa Indigenous Knowledge System and Practices (IKSP.Sinikap sagutin sa pagaaral ang suliraning ano-anong varyasyong liksikal ang makikita sa mga terminong kultural na pangkabuhayan ng Mandaya na makikita sa munisipalidad ng Caraga, Manay, Bagangaat Cateel? Disenyong kwalitatibo ginamit.Metodong indehinusat deskriptibo naman ang ginamit mula sa paglilikom hanggang sa pag-aanalisa ng mga datos. Samantalang, ang mga impormante ay pinilisa pamamagitan ng kombinasyong purposive at snow-ball sampling. Natuklasan, na ang wikang Mandaya ay nakitaan ng varyasyong lekisikal ayon sa magkakaiba ang anyo, may pagkakatulad ang anyo, at magkakatulad ang anyo subalit magkakaiba ang bigkas. Gayunpaman, pinaniniwalaang dahil sa paktor na heograpikal, sikolohikal at sosyolohikal na nagaganap sa kanilang kultura ay hindi rin maipagkailang nagyari ang varyasyong leksikal na aspekto nito.

  11. Le 18 Brumaire, une étape dans la constitution d’une armée nouvelle

    OpenAIRE

    Crépin, Annie

    2006-01-01

    Le 18 Brumaire, Bonaparte trouva un instrument de guerre entièrement forgé par la Révolution et le Directoire. Il devait de plus en plus s’éloigner des intentions initiales des créateurs d’une armée nouvelle. Celle-ci, pourtant, survécut au détournement de l’héritage que Bonaparte avait reçu en la matière tant elle était fondée sur des rapports nouveaux avec une nation et une société, elles aussi nouvelles, tant elle était en adéquation avec l’invention de la citoyenneté. 18 Brumaire, a Mi...

  12. Les villes nouvelles franciliennes et la polarisation du desserrement des activités d'intermédiation

    OpenAIRE

    Halbert, Ludovic

    2005-01-01

    International audience; This paper describes the role played by the Ile-de-France New Towns in the deconcentration of producer services in the Paris city-region.; Cet article analyse le rôle joué par les villes nouvelles franciliennes dans les processus de desserrement des emplois d'intermédiation dans la région métropolitaine parisienne.

  13. Deux nouvelles espèces de Dasypsyllus (Siphonaptera : Ceratophyllidae au Chili

    Directory of Open Access Journals (Sweden)

    Beaucournu J.-C.

    2009-06-01

    Full Text Available De nouveaux taxa de Puces, seulement connus par le mâle, sont ajoutés à la faune chilio-andine. Il s’agit de représentants du sousgenre Neornipsyllus, inféodé aux Oiseaux, essentiellement Passériformes. D. (N. huinayensis sp. n., est, inter alia, caractérisé par la disposition des fortes soies du télomère ; D. (N. tapaculensis sp. n. montre un tergite X (ou proctiger original pour l’Ordre entier par sa forme et sa chetotaxie en grande partie formée de soies bifides.

  14. Nouvelle structure de capteur à courants de Foucault et algorithme associé pour la mesure des propriétés électrique et magnétique d'un métal

    Science.gov (United States)

    Lê, Minh-Quang; Placko, Dominique

    1995-06-01

    This paper describes a new structure for eddy-current transducers which improves sensitivity while maintaining high lateral resolution. We have developed an analytical model to allow a model-based inversion from transducers signals to estimate thick and homogeneous plates electrical conductivity, magnetic permeability and/or lift-off. The inversion procedure is described and shows the possibility of a precise simultaneous estimation of the three parameters. Experiments were conducted with magnetic and non magnetic metals. Cet article décrit une nouvelle structure de capteur à courants de Foucault qui permet d'améliorer la sensibilité du capteur tout en conservant sa résolution latérale. Nous avons développé un modèle analytique de ce capteur qui peut être inversé pour estimer la conductivité électrique, la perméabilité magnétique d'une cible homogène et/ou la distance capteur-cible. La procédure d'inversion a été décrite et montre une possibilité d'estimer ces trois paramètres avec précision. L'expérience a été effectuée sur des métaux magnétiques et amagnétiques.

  15. Lingon sa Iskolarsyip sa Dulaan (1948-2007 Looking Back on Theater Scholarship (1948-2007

    Directory of Open Access Journals (Sweden)

    Apolonio B. Chua

    2012-12-01

    Full Text Available From 1948 to 2007, the academic community produced about a hundred titles of theses and dissertations on drama and theater, or made use of data from drama and theater for larger spheres of studies. The current article looked into identifying trends and points of emphasis, as the researches and studies progressed through roughly half a century of research production in the academic setting. Inductive in approach and tentative and exploratory in its analysis, the study identified four trends and points of emphasis in research production. In the fifties and sixties, the emphasis was more on studying the play text or drama; studies veered towards a literary reading and orientation. Eventually, this trend gave way to studying the larger phenomenon of mounting, and the mise en scéne and the spectator became additional units of concern for research. Studies began to have sections on props, costumes, and staging techniques. In the eighties, a larger concern for looking at theater as social production followed. Participant observation, field work and ethnography gave equal emphasis on the social context of theater. Marxism and other perspectives from the social sciences framed theater studies then; correlations between theater and society became useful. Towards the last decade of the century, theater studies aimed at a more conceptual approach, emphasizing core concepts like panata and other related or equivalent terms, elevating and defining the study of theater as a study of culture itself. Gamit ang mahigit sa sandaang tesis at disertasyon hinggil sa dula at dulaan o sinasangkot ang mga ito na lumabas sa akademya mula 1948 hanggang 2007, kapwa sa Unibersidad ng Pilipinas at sa iba pa, nilayon ng “Lingon sa Iskolarsyip sa Dulaan (1948-2007” na pulsuhan ang pangkalahatang daloy, tutok, tunguhin o kalakaran sa pagdadala ng mga pag-aaral. Panimula at exploratory sa inductive nitong lapat, nakatukoy ang pag-aaral ng apat na sapit o tutok sa daloy ng

  16. Les oiseaux de l’archipel de Nosy Hara, au nord nord - ouest de Madagascar et la nouvelle distribution connue du Gobe mouche de Ward (Pseudobias wardi

    Directory of Open Access Journals (Sweden)

    Marie Jeanne Raherilalao

    2010-06-01

    Full Text Available Peu d’informations ornithologiques étaient disponibles sur l’archipel de Nosy Hara, au nord nord - ouest de Madagascar. Afin de constituer une base de données scientifique, nous avons entrepris un inventaire du peuplement aviaire de cet archipel entre fin septembre et début octobre 2005. Pour la collecte des données, deux méthodes complémentaires ont été utilisées sur l’île de Nosy Hara, à savoir le taux de rencontre et les observations générales mais la présence des espèces dans certains îlots de l’archipel a été notée par la deuxième de ces techniques. Un total de 31 espèces d’oiseaux a été rencontré aucours de cet inventaire. Outre les espèces inféodées au milieu marin et celles des zones littorales, 18 espèces terrestres ont été trouvées sur l’île et une sur l’île d’Andalatsara. Bien que l’archipel présente un appauvrissement en espèces d’oiseaux par rapport aux autres écosystèmes forestiers de la grande terre, son importance ornithologique n’est pas à négliger. Le Gobe mouche de Ward Pseudobias wardi a été découvert au cours de cet inventaire dans un type d’habitat duquel il n’était pas encore connu et dans une nouvelle localité qui étend sensiblement sa distribution connue. La préservation de cet archipel est justifiée pour préserver ses richesses biologiques face aux diverses pressions anthropiques.

  17. Chacun sa carte? Le nouveau Google Maps

    Directory of Open Access Journals (Sweden)

    Thierry Joliveau

    2013-08-01

    Full Text Available Google prépare une nouvelle version de Google Maps qu’il est possible de tester en avant-première. L’interface utilisateur est réaménagée pour une plus grande fluidité et une meilleure interactivité entre la carte et les photographies, avec une intégration optimisée des recherches d’itinéraires à la consultation. Mais la principale innovation mise en avant par la firme est plus radicale. Dans cette nouvelle version, la carte va s’adapter à l’utilisateur: «plus vous utilisez la carte plus elle devient utile», annonce Google. Le principe est simple. En fonction de vos recherches, des endroits que vous visitez, des lieux conseillés par vos amis sur les réseaux et des remarques que vous ajoutez, Google Maps apprendra à mieux cerner vos intérêts et vous proposera un contenu plus adapté. La carte est personnalisée et intègre les habitudes et les besoins de l’utilisateur.

  18. La « Nouvelle Mosquée » d’Alger. Le déroulement d’une procédure constructive au xviie siècle

    Directory of Open Access Journals (Sweden)

    Samia Chergui

    2012-01-01

    Full Text Available « La Nouvelle Mosquée » est érigée, à la fin du xviie siècle, dans la seule perspective de doter le rite hanéfite de sa propre Grande Mosquée. Cette nouvelle édification relève, à l’évidence, d’une procédure collective exceptionnelle, celle qu’entreprend la milice d’Alger, en l’occurrence le corps des janissaires, en puisant dans les fonds des Subul al-Khayrât. L’examen du livre de comptes qu’avait tenu cette institution ḥabûs, responsable de la gestion de la plupart des mosquées hanéfites et de leurs awqâf, aussitôt après le lancement du chantier, a permis de suivre le déroulement des travaux sur une période de presque dix années, soit de 1067/1656-1657 à 1076/1665-1666. Ce rôle de chantier apporte des éclairages significatifs notamment sur la nature, la provenance, la quantité et le coût des matériaux employés à la construction. Ils ne manquent pas non plus de documenter les aspects concernant leur fabrication, voire leur préparation, et quelque rares fois leur mise en œuvre ; une mise en œuvre qui, ici, revient à la dextérité de nombreux hommes, mobilisés dans le cadre corporatif. La comptabilité salariale, tenue en cette occasion, compte d’ailleurs parmi les rares initiatives de gestion qui ont permis, durant au moins une décennie, de consigner les plus amples détails non seulement sur le profil distinctif de l’ensemble de ces intervenants, mais également sur leur origine géographique, voire confessionnelle.

  19. Nouvelles formes de gouvernance dans le domaine de l’eau. Apports et limites de la coopération décentralisée dans les pays en développement

    Directory of Open Access Journals (Sweden)

    Raoudha Makkaoui

    2010-09-01

    Full Text Available La problématique de cet article porte sur le rôle de la coopération décentralisée dans le domaine de l’eau, dans la mesure où celle-ci semble pouvoir apporter des réponses concrètes au problème de l’accès universel à l’eau et constituer une nouvelle option pour la communauté internationale. Dans une première partie, on présentera les problèmes rencontrés par les différents modes de gestion de l’eau dans les pays en développement et la façon dont ils ont successivement tenté de satisfaire à certains objectifs bien précis (accès universel à l’eau, réduction des coûts, prise en compte des besoins prioritaires. Dans une deuxième partie, sur la base d’une initiative de coopération décentralisée entre le Conseil régional de Seine-Saint-Denis et la ville marocaine de Figuig, on s’interrogera sur les apports et limites de cette nouvelle forme de partenariat participatif afin d’en évaluer la pérennité ainsi que la « soutenabilité sociale », montrant, de ce fait, sa proximité avec l’économie solidaire.Our paper builds on this issue of decentralized cooperation in the field of water management. Cooperation between decentralized entities in order to ensure the access to safe drinking water for all now constitutes in many places a preferred water governance option. Therefore, in the first part, we will provide an overview of the current difficulties encountered by the various forms of water management in developing countries, showing the solutions that they successively brought to specific issues (access for all, cost reduction, priority needs. In the second part, we will address the particular case of decentralized cooperation between the General Council of Seine-Saint-Denis in the suburbs of Paris, France, in partnership with the city of Figuig in Morocco. We review the insights and limits of such processes that refer to the people’s capabilities, at both individual and collective levels, in

  20. Contraintes et enjeux de développement de la Nouvelle-Calédonie

    Directory of Open Access Journals (Sweden)

    Christian Jost

    2010-02-01

    Full Text Available En 2008 a été lancée en Nouvelle-Calédonie une vaste consultation pour élaborer un Schéma d’Aménagement et de Développement du territoire à l’horizon 2025. Si l’économie calédonienne a connu une forte croissance pendant plus d’une décennie, pouvant soutenir les besoins de la population et les investissements, le grand défi d’aujourd’hui réside dans la capacité à construire une communauté de destin basée sur une reconnaissance d’aspirations multiculturelles et sur un projet commun. Lancé dix ans après l’Accord de Nouméa qui le prévoyait, le S.A.D. est cette chance qu’ont les Néo-Calédoniens d’écrire enfin leur avenir ensemble. La réflexion stratégique globale et la mise en place d’une politique générale restent toutefois encore à mettre en place.In 2008 a vast consultation was launched in New Caledonia aimed at establishing a development plan for the territory, directed at the year 2025. If the Caledonian economy has experienced high growth over the past decade, thereby satisfying population and investment needs, the current challenge resides in the capacity to build the society of the future based on the recognition of multi-cultural aspirations and a shared project. Envisaged by the Accord de Nouméa and launched ten years later, the SAD offers all New Caledonians the opportunity to plan the future together. The over-arching strategic reflection and the creation of the broad politic foundations for the project have yet, however, to be determined.

  1. Marginalité, adaptation et agriculture dans les hautes terres de Nouvelle-Zélande

    Directory of Open Access Journals (Sweden)

    Steven Kelly

    2012-03-01

    Full Text Available La population des espaces montagnards néo-zélandais est dispersée, et les impacts directs des catastrophes, dans ces régions, touchent principalement les communautés agricoles et les réseaux de communication. Soumis aux séismes (principalement dans les Alpes du Sud et aux éruptions volcaniques (sur le plateau central de l’Île du Nord, les espaces montagnards de Nouvelle-Zélande sont plus généralement enclins à des problèmes d’érosion et de glissements de terrain, et à des chutes de neiges aussi extrêmes qu’irrégulières, dans le Sud. L’impact de chutes de neige d’ampleur exceptionnelle au cours des 150 dernières années de d’occupation européenne est plutôt bien documentée. Tandis que la technologie moderne aurait pu diminuer de tels impacts, la tempête de neige récente de 2006, dans le sud du Canterbury, souligne la manière dont certains de ces événements dangereux continuent d’affecter les communautés des montagnes et des hautes terres. La dépendance accrue par rapport aux technologies modernes de communication et les changements liés aux opérations et à la gestion des systèmes agricoles modernes accroissent les impacts sociaux et économiques de tels événements. Ces impacts sont considérablement modifiés par la taille et la structure des exploitations agricoles concernées.

  2. How the Nouvelle Vague Invented the DVD: Cinephilia, new waves and film culture in the age of digital dissemination

    OpenAIRE

    Malte Hagener

    2014-01-01

    Whereas the currently emerging configurations of audiovisualcy in the age of digital networks are often addressed in terms of absolute novelty and innovation, this article wishes to shift the focus slightly, articulating instead the new in terms of the old. This essay proposes the argument that it was within the Nouvelle Vague and the French film culture of the 1960s that the DVD was “invented”. Obviously, this is a contrafactual argument, but if we understand the DVD as a discursive construc...

  3. La vitamine D : les nouvelles fonctions d’une ancienne vitamine

    Directory of Open Access Journals (Sweden)

    Garabedian Michèle

    2000-05-01

    Full Text Available Au début des années 80, on croyait tout connaître ou presque de la vitamine D [1, 2]. Sa fonction antirachitique et sa double origine, alimentaire et endogène, étaient des données classiques depuis le début des années 20. L’essentiel de son métabolisme et des facteurs contrôlant ce métabolisme était connu depuis 1970, de même qu’avaient été identifiées sa forme de réserve, la 25-hydroxyvitamine D, et sa forme active, la 1,25-dihydroxyvitamine D (1,25-(OH2D. De plus, le mode d’action de la 1,25-(OH2D sur la minéralisation du squelette et le métabolisme phosphocalcique était en grande partie élucidé. Enfin, dès le début des années 80, on savait que l’action de la 1,25-dihydroxyvitamine D sur ses cellules cibles, dans l’intestin, l’os, les reins, les parathyroïdes, nécessite la présence d’un récepteur spécifique intracellulaire, le VDR (Vitamin D Receptor et le transfert du couple 1,25-(OH2D-VDR vers le noyau cellulaire.

  4. Jelidi Charlotte, Fès, la fabrication d'une ville nouvelle (1912-1956, Lyon, ENS Editions, 2012, 266 p.

    Directory of Open Access Journals (Sweden)

    Manon Istasse

    2013-07-01

    Full Text Available Le segment d'histoire de l'architecture et de l'urbanisme abordé par Charlotte Jelidi, à savoir la période du Protectorat français (1912-1956 au Maroc, est une pierre à l’édifice des travaux réalisés sur les villes nouvelles marocaines, leur construction et leur évolution. Les villes nouvelles sont ces villes construites durant le Protectorat français, suivant la planification urbaine définie par Lyautey et son administration. Ces villes étaient majoritairement destinées aux Occidentaux, com...

  5. Une nouvelle génération de leaders en Afrique : quels enjeux ?

    Directory of Open Access Journals (Sweden)

    John O. Igué

    2010-03-01

    Full Text Available L’Afrique est à la croisée des chemins. Elle est désormais au cœur des préoccupations de développement dans lesquelles sont engagés ses dirigeants depuis une cinquantaine d’années. Ces derniers peinent à trouver une issue heureuse à partir de laquelle le continent noir pourrait jouer un rôle de premier plan sur la scène internationale. Il est nécessaire de réfléchir à une nouvelle génération de leaders, capables de relever plusieurs défis comme ceux de la fragmentation de l’espace, de l’histoire et du savoir, de la refondation de l’Etat postcolonial, de la promotion de la démocratie et des droits humains, et de la mise en place de nouvelles conditions de paix et de liberté, gage d’un développement durable. C’est sur la manière d’affronter ces différents défis que se penche cette contribution.

  6. How the Nouvelle Vague Invented the DVD: Cinephilia, new waves and film culture in the age of digital dissemination

    Directory of Open Access Journals (Sweden)

    Malte Hagener

    2014-01-01

    Full Text Available Whereas the currently emerging configurations of audiovisualcy in the age of digital networks are often addressed in terms of absolute novelty and innovation, this article wishes to shift the focus slightly, articulating instead the new in terms of the old. This essay proposes the argument that it was within the Nouvelle Vague and the French film culture of the 1960s that the DVD was “invented”. Obviously, this is a contrafactual argument, but if we understand the DVD as a discursive construction articulating a specific perspective on film, then the DVD simulates and emulates some key features of 1960s cinephilia that emerged within the context of the new waves. On the other hand, the Nouvelle Vague is understood as a broad discursive movement encompassing all segments of the institution cinema rather than five auteur-directors — Truffaut, Godard, Chabrol, Rohmer and Rivette — and their respective films. By arguing for the continuing importance of film history and culture, this article wishes to underline the fact that technological as well as aesthetic transformations are central to our understanding of media culture.

  7. Elaboration de nouvelles approches micromecaniques pour l'optimisation des performances mecaniques des materiaux heterogenes

    Science.gov (United States)

    Aboutajeddine, Ahmed

    Les modeles micromecaniques de transition d'echelles qui permettent de determiner les proprietes effectives des materiaux heterogenes a partir de la microstructure sont consideres dans ce travail. L'objectif est la prise en compte de la presence d'une interphase entre la matrice et le renforcement dans les modeles micromecaniques classiques, de meme que la reconsideration des approximations de base de ces modeles, afin de traiter les materiaux multiphasiques. Un nouveau modele micromecanique est alors propose pour tenir compte de la presence d'une interphase elastique mince lors de la determination des proprietes effectives. Ce modele a ete construit grace a l'apport de l'equation integrale, des operateurs interfaciaux de Hill et de la methode de Mori-Tanaka. Les expressions obtenues pour les modules globaux et les champs dans l'enrobage sont de nature analytique. L'approximation de base de ce modele est amelioree par la suite dans un nouveau modele qui s'interesse aux inclusions enrobees avec un enrobage mince ou epais. La resolution utilisee s'appuie sur une double homogeneisation realisee au niveau de l'inclusion enrobee et du materiau. Cette nouvelle demarche, permettra d'apprehender completement les implications des approximations de la modelisation. Les resultats obtenus sont exploites par la suite dans la solution de l'assemblage de Hashin. Ainsi, plusieurs modeles micromecaniques classiques d'origines differentes se voient unifier et rattacher, dans ce travail, a la representation geometrique de Hashin. En plus de pouvoir apprecier completement la pertinence de l'approximation de chaque modele dans cette vision unique, l'extension correcte de ces modeles aux materiaux multiphasiques est rendue possible. Plusieurs modeles analytiques et explicites sont alors proposee suivant des solutions de differents ordres de l'assemblage de Hashin. L'un des modeles explicite apparait comme une correction directe du modele de Mori-Tanaka, dans les cas ou celui ci echoue a

  8. Les Sapotaceae de Madagascar, deux nouvelles espèces du genre Mimusops L.

    Directory of Open Access Journals (Sweden)

    Richard Randrianaivo

    2013-11-01

    Full Text Available Members of the family Sapotaceae, occurring in Madagascar’s various forest types, are mostly known as nanto in local dialects; some of their cultural and social values are described here. While the circumscription of Mimusops is well-defined, the delimitation of species within the genus remains unclear and their identification is often difficult. A study of herbarium specimens assigned to this genus deposited in key herbaria, two in Madagascar (TAN and TEF and three outside the country (G, MO and P, revealed two new species: Mimusops boeniensis Randrianaivo sp. nov. and Mimusops masoalensis Randrianaivo sp. nov. This brings the number of Mimusops species recognized in Madagascar to 16. Both of these newly recognized species are illustrated, and detailed information is provided concerning their morphology and the differences between them and other members in the genus, as well as on their ecology and distribution. RÉSUMÉLes Sapotaceae de Madagascar sont rencontrés dans tous les types de forêt de l’île et sont connus sous un même nom vernaculaire sur l’ensemble du territoire, nanto. Les nanto sont importants dans la Société malgache et leur valeur culturelle est décrite ici. La circonscription taxinomique de Mimusops est bien définie. En revanche, la délimitation entre les différentes espèces au sein du genre reste confuse et l’identification des récoltes est souvent difficile. L’étude des spécimens d’herbier connus dans les herbiers nationaux (TAN et TEF et internationaux (G, MO et P nous a néanmoins permis de reconnaitre et de décrire deux nouvelles espèces : Mimusops boeniensis Randrianaivo sp. nov. et Mimusops masoalensis Randrianaivo sp. nov., le nombre d’espèces malgaches de Mimusops passant ainsi de 14 à 16. Cet article s’attache ensuite à fournir une description morphologique détaillée et illustrée de ces deux espèces ainsi que des renseignements sur leur distribution et leur écologie. Les diff

  9. Le CERN accueille une conférence sur la communication scientifique

    CERN Multimedia

    CERN Press Office. Geneva

    2001-01-01

    More than 70 communication professionals will try to answer these questions at the conference "Bridging the gap between theory and practise" which takes place at CERN on 1-3 February 2001. This conference is promoted and organised by the Public Communication of Science and Technology network (PCST), an international organisation of individuals interested in all aspects of the relationship between science and the public.

  10. The preliminary study of autophagy induction of SA and MeSA by confocal

    Science.gov (United States)

    Yun, Lijuan; Chen, Wenli

    2010-02-01

    Autophagy appears to be a highly conserved process from unicellular to multicellular eukaryotes which contributes to the equilibrium of intracelluar environment. While it would be harmful to the cells when it is excessive by inducing programmed cell death (PCD). It is a protein degradation process in which cells recycle cytoplasmic contents when subjected to environmental stress conditions or during certain stages of development. Previous studies have demonstrated autophagy can be induced during abiotic or biotic stresses. salicylic acid (SA) and methyl salicytic (MeSA) are endogenous signal molecules. We found SA and MeSA can induce autophagy in Arabidopsis thaliana respectively. While autophagy was not induced by SA or MeSA in tobacco suspension cells under the same concentration and period. The differences in stuctures or physiological states may contribute to the results.

  11. SA3654 Component characterization. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Meir, G.W.

    1996-06-01

    AlliedSignal Inc., Federal Manufacturing & Technologies (FM&T), was provided with production capability assurance program (PCAP) funding to develop, characterize, and qualify purchased product components for use on the PRESS-A program. The SA3654, N-Channel, Power MOSFET was identified as a component needing such activity to support PRESS-A. This report presents the characterization activities and results for the SA3654.

  12. SaVi: satellite constellation visualization

    CERN Document Server

    Wood, Lloyd

    2012-01-01

    SaVi, a program for visualizing satellite orbits, movement, and coverage, is maintained at the University of Surrey. This tool has been used for research in academic papers, and by industry companies designing and intending to deploy satellite constellations. It has also proven useful for demonstrating aspects of satellite constellations and their geometry, coverage and movement for educational and teaching purposes. SaVi is introduced and described briefly here.

  13. Åsa portreed / Åsa Johannesson ; intervjueerinud Kaisa Eiche

    Index Scriptorium Estoniae

    Johannesson, Åsa

    2009-01-01

    Rootsi fotograafist Åsa Johannessonist, kelle portreefotode seeriat "Portraits of Her" eksponeeriti Riias toimunud kunstiüritusel "MOMENT". Tema õpingutest ja elust Londonis. Naiselikkusest ja mehelikkusest

  14. Application de la diffraction des rayons X in situ à haute température pour l'identification d'une nouvelle phase lors de l'oxydation à 900circC de l'acier 304

    Science.gov (United States)

    Riffard, F.; Buscail, H.; Caudron, E.; Cueff, R.; Issartel, C.; El Messki, S.; Perrier, S.

    2004-11-01

    Une nouvelle interprétation du comportement atypique couramment appelé "breakaway" observé lors de l'oxydation à haute température d'alliages chromino-formeurs est proposée grâce à l'utilisation de la diffraction des rayons X in situ à haute température. L'acier chromino-formeur AISI 304 doit établir une couche d'oxyde superficielle généralement dense et majoritairement, constituée de chromine, dont la vitesse de croissance est lente, afin d'assurer sa protection contre la corrosion à haute température. Cette faible vitesse de croissance de la couche d'oxyde est effectivement observée à 1000circC. Elle serait favorisée par l'établissement d'une couche de chromine induite par la présence d'une sous-couche continue de silice à l'interface interne. Cette dernière limiterait la diffusion du fer. Le phénomène du "breakaway" est observé à la température de 900circC après 40 heures d'oxydation. Ce phénomène serait lié à la croissance initiale d'oxydes contenant du fer. L'oxyde Fe{7}SiO{10, }a été identifié{ }pour la première fois grâce à la technique de diffraction des rayons X in situ à haute température. Cet oxyde semble piéger le silicium dans la couche d'oxyde, empêchant son accumulation à l'interface interne et la formation d'une couche continue de silice.

  15. Justice française en Nouvelle-Calédonie  la fin du rêve tropical French judicial practice in Nouvelle-Calédonie: the end of a tropical dream

    Directory of Open Access Journals (Sweden)

    Pierre Frezet

    2009-04-01

    Full Text Available Territoire d’outre-mer. - Nouvelle-Calédonie. - Article 77 de la Constitution de 1958. - Loi organique n°99-209 du 19 mars 1999. - Statut coutumier kanak. – Portée de l’article 7 de la loi précitée. - Composition du tribunal pour enfants saisi en matière d’assistance éducative en présence de parties de statut coutumier Kanak.SOMMAIRE. – Conformément à l’article 7 de la loi organique n°99-209 du 19 mars 1999 les personnes de statut coutumier kanak étant régies, pour l’ensemble du droit civil, ...

  16. Lu Xun, Nouvelles et poèmes en prose, édition de Sebastian Veg,

    OpenAIRE

    Zhang, Yinde

    2015-01-01

    David Damrosch accorde une importance particulière à la traduction dans sa définition de la littérature mondiale, qu’il identifie non pas à un canon établi de textes, mais à un mode de lecture relatif à la « réfraction elliptique des littératures nationales ». La traduction est appelée à jouer un rôle accru dans un contexte où l’intégration de la littérature chinoise à la littérature mondiale se fait encore attendre. Le volume traduit et établi par les soins de Sebastian Veg est d’autant plus...

  17. A Generalized Eigensolver based on Smoothed Aggregation (GES-SA) for Initializing Smoothed Aggregation Multigrid (SA)

    Energy Technology Data Exchange (ETDEWEB)

    Brezina, M; Manteuffel, T; McCormick, S; Ruge, J; Sanders, G; Vassilevski, P S

    2007-05-31

    Consider the linear system Ax = b, where A is a large, sparse, real, symmetric, and positive definite matrix and b is a known vector. Solving this system for unknown vector x using a smoothed aggregation multigrid (SA) algorithm requires a characterization of the algebraically smooth error, meaning error that is poorly attenuated by the algorithm's relaxation process. For relaxation processes that are typically used in practice, algebraically smooth error corresponds to the near-nullspace of A. Therefore, having a good approximation to a minimal eigenvector is useful to characterize the algebraically smooth error when forming a linear SA solver. This paper discusses the details of a generalized eigensolver based on smoothed aggregation (GES-SA) that is designed to produce an approximation to a minimal eigenvector of A. GES-SA might be very useful as a standalone eigensolver for applications that desire an approximate minimal eigenvector, but the primary aim here is for GES-SA to produce an initial algebraically smooth component that may be used to either create a black-box SA solver or initiate the adaptive SA ({alpha}SA) process.

  18. Test des photomultiplicateurs en silicium couplés à un scintillateur plastique pour la nouvelle Tape Station

    CERN Document Server

    sekal, Smain

    2014-01-01

    L’une des parties essentielles de la l’installation ISOLDE est la tape Station (contrôleur de bandes), qui permet la vérification de la qualité du faisceau délivré aux expériences. On prévoit à ISOLDE de remplacer l’ancienne Tape Station, par une nouvelle Tape station; et l’un des paramètres essentiels pour la performance de la tape Station est l’efficacité de détection. Le but de ce travail est de vérifier l’efficacité des détecteurs de particules bêta, composés par l’association des photomultiplicateurs en Silicium à un scintillateur plastique pour differentes distances.

  19. Literaire strategieën: de drie satellieten van La Nouvelle Revue Française (1910-1914

    Directory of Open Access Journals (Sweden)

    Maaike Koffeman

    2000-12-01

    Full Text Available La Nouvelle Revue Française, opgericht in 1908 door een groep schrijvers rond André Gide, is het belangrijkste Franse literaire maandblad van het interbellum geweest. In de jaren voorafgaand aan de Eerste Wereldoorlog is de reputatie van het tijdschrift nog relatief bescheiden, maar er is al wel een duidelijke progressie te constateren. Deze is niet alleen toe te schrijven aan de inhoudelijke kwaliteit van de bijdragen, maar vooral ook aan de manier waaorp de redactie het tijdschrift promoot. De oprichters bedienen zich van een 'mutimedia-strategie': zij ontwikkelen rond de NRF verschillende nevenactiviteiten om de naamsbekendheid van het tijdschrift te vergroten en zijn literatuuropvattingen onder een breder publiek te verspreiden. 

  20. Atlas mundial da saúde

    OpenAIRE

    Barrozo, Ligia Vizeu

    2009-01-01

    O Atlas é de autoria de Zoé Vaillant, mestre de conferências da Universidade Paris-Ouest-Nanterre-La Défense e membro do laboratório Espaço, Saúde e Territórios e de Gérard Salem, professor de geografia da saúde da Universidade Paris-Ouest-Nanterre-La Défense e coordenador do laboratório Espaço, Saúde e Territórios. Cécile Marin, responsável pela cartografia do Atlas, é geógrafa-cartógrafa, formada pela Universidade d’Orléans. O Atlas mondial de la santé faz parte da série Collection Atlas/M...

  1. L.J. van der Veen et S. Bodinga-bwa-Bodinga. Gedandedi sa Geviya/ Dictionnaire Geviya?Fran?ais

    Directory of Open Access Journals (Sweden)

    P.A. Mavoungou

    2011-10-01

    Full Text Available La parution aux ?ditions Peeters de l'ouvrage de r?f?rence lexicographique intitul? Gedandedi sa Geviya/Dictionnaire Geviya?Fran?ais (en abr?g? DGF dans les reste de l'article a ?t? accueilli avec joie et fiert? aussi bien par les locuteurs geviya1 en particulier que par les Gabonais en g?n?ral. Ce dictionnaire, r?sultat d'une longue et fructueuse collaboration scientifique entre Lolke van der Veen et S?bastien Bodinga-bwa-Bodinga, marque le d?but d'une nouvelle ?re dans la r?daction des dictionnaires au Gabon. En effet, la majorit? des ouvrages de r?f?rence lexicographique disponibles dans les langues gabonaises sont des dictionnaires bilingues r?dig?s par les missionnaires catholiques et protestants ou par les administrateurs coloniaux dans la p?riode allant de 1800 ? 1960, date de l'accession du Gabon ? la souverainet? internationale (Nyangone Assam et Mavoungou 2000, Mavoungou 2001.

  2. Crenicichla tigrina, Une nouvelle espèce de cichlidae (Pisces, Perciformes) du Rio Trombetas, Pará, Brésil

    NARCIS (Netherlands)

    Ploeg, Alex; Jégu, Michael; Ferreira, Efrem

    1991-01-01

    Une nouvelle espèce de Cichlidae, Crenicichla tigrina, est décrite et illustrée. La coloration sur le vivant et quelques remarques relatives à l’Pecologie de cette espèce sont présentée. Les relations de C. tigrina avec les autres espèces de Crenicichla à petites écailles et le mode de distribution

  3. Notes sur les limaces 2. Description d’une espèce nouvelle de Gigantomilax provenant des environs de Kouldja (Chine)

    NARCIS (Netherlands)

    Regteren Altena, van C.O.

    1954-01-01

    Parmi les limaces non-identifiées du Musée Zoologique d’Amsterdam, que M. le Professeur Dr. H. Engel et Mme. W. S. S. van der Feen née van Benthem Jutting ont bien voulu me permettre d’étudier, il se trouvait une espèce nouvelle dont je donne ci-après la description. Gigantomilax (Turcomilax) iliens

  4. La mosquée en Algérie.Figures nouvelles et pratiques reconstituées

    Directory of Open Access Journals (Sweden)

    Abderrahmane Moussaoui

    2012-07-01

    Full Text Available La « globalisation » des discours de la mosquée casse les frontières érigées historiquement par les différentes écoles, et tend à réduire la fracture inaugurale entre sunnisme et chiisme. Aujourd’hui il y a un retour à la Salafiya qui ne reconnaît que les fondamentaux. Tout le reste est considéré comme de l’ordre de l’historique et donc non sacré et à ce titre susceptible d’être laissé de côté ou changé. La Salafiya continue cependant à être divisée entre djâmida et djihâdiya.Les pratiques au sein de la mosquée procèdent également par pluralisation où l’individu cherche à la fois à signaler son individualité mais aussi à s’inscrire dans des tendances plus globales. Les récits de vie de différents imams laisse transparaître une sorte de sécularisation interne de la mosquée et une plus grande latitude dans la ré interprétation de l’initial.Les changements sont perceptibles également au niveau des acteurs De nouvelles figures concurrencent celle classique de l’imam. Le prédicateur, sans être une figure tout à fait nouvelle, ni une invention récente, demeure une figure réinventée. Au Maghreb, on connaît l’imam, le mufti, le taleb, mais moins le dâ`îya que les chaînes de télévision à thématique religieuse ont fini par imposer.Ce sont toutes ces transformations qui se déroulent au cœur de l’institution la plus significative de l’Islam que tente d’examiner cette contribution.

  5. La circulation des nouvelles sur l’internet. L’interconnexion médiatique au service du pluralisme ?

    Directory of Open Access Journals (Sweden)

    Emmanuel Marty

    2013-04-01

    Full Text Available L’article consiste en une étude pluri-méthodologique du paysage des actualités en ligne, dans le cadre d’un projet de recherche intitulé Internet Pluralisme et Redondance de l’Information. L’étude cherche à repérer, dans le flux de publication comme dans la circulation d’une nouvelle, les éléments de convergence et de reprise, ou au contraire de créativité et de singularisation des différents types de sites d’information (médias en ligne, infomédiaires, sites natifs de l’internet et blogs à partir de la publication le 8 mars 2011 d’articles sur un sondage donnant Marine Le Pen en tête des intentions de vote pour l’élection présidentielle de 2012. L’article répond essentiellement à deux objectifs. Le premier est d’identifier le volume de production de l’information dédié au sujet dans les différents sites en tenant compte de la circulation de la nouvelle dans sa dimension diachronique. Le second est d’identifier certains standards dans la production des différents sites, par l’étude des sources et signatures, du traitement visuel ainsi que de l’usage des liens hypertextes. Les résultats dessinent des lignes de convergence et de divergence entre les différentes catégories de sites. Là où les médias en ligne, les infomédiaires et dans une moindre mesure certains sites natifs de l’internet (les plus professionnalisés se positionnent sur des stratégies de productivité, de réactivité et de reprise normalisée de l’information, les blogs et une grande partie des sites natifs de l’internet (ceux tournés vers l’amateurisme et la participation optent pour des valeurs fondées sur la singularité, la créativité, le re-traitement de l’information et la mise en avant d’un réseau de sites « amis », au sein de plateformes techniques néanmoins contraignantes du point de vue de l’interface. The article consists in a pluri-methodological study of the online news landscape. It

  6. Atmospheric environment for ASTP (SA-210) launch

    Science.gov (United States)

    Johnson, D. L.

    1976-01-01

    A summary is presented of selected atmospheric conditions observed near ASTP/SA-210 launch time on July 15, 1975, at Kennedy Space Center, Florida. Values of ambient pressure, temperature, moisture, ground winds, visual observations (cloud), density, index of refraction, and wind/wind shear aloft are included. A final meteorological data tape for the ASTP launch, consisting of wind and thermodynamic parameters versus altitude, has been constructed.

  7. 什么是SA8000

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    20世纪末期,欧洲、美国和澳大利亚都先后出现了一些关于“企业社会责任”的多边组织,并逐步形成了一些评价体系和认证制度。SA8000(SOCIAL ACCOUT ABILTY8000的英文简称)是其中最有名的标准之

  8. Peut-on penser le travail par le don ? Débat avec la rédaction de la Nouvelle Revue du Travail Conceptualising work as a gift? Debate with editors of the Nouvelle Revue du Travail ¿Es posible pensar el trabajo a través del don? Debate con el comité de redacción de la Nouvelle Revue du Travail

    Directory of Open Access Journals (Sweden)

    Alain Caillé

    2012-12-01

    Full Text Available Dans un échange avec la Nouvelle Revue du Travail, Alain Caillé et Norbert Alter soutiennent leur lecture maussienne des réalités contemporaines du travail en discutant les questions centrales du capitalisme, du salariat, de l’entreprise et du travail sociologique. Cet échange fait suite aux contributions d’Alain Caillé et Norbert Alter dans ce Chorus « Peut-on penser le travail par le don ? De la mise en œuvre du paradigme du don contre-don en sociologie du travail. »In an exchange with the Nouvelle Revue du Travail, Alain Caillé and Norbert Alter pursue their Maussian analysis of the reality of contemporary work by discussing questions that are central to capitalism, wage-earning, enterprise and the sociology of work. This follows their contribution to this issue of Chorus entitled “Conceptualising work as a gift: Implementing the gift/counter-gift paradigm in the sociology of work” (Peut-on penser le travail par le don? De la mise en œuvre du paradigme du don contre-don en sociologie du travail.En el marco de un debate con la Nouvelle Revue du Travail, Alain Caillé y Norbert Alter apoyan su lectura maussiana de las realidades contemporáneas del trabajo en una discusión de los aspectos centrales del capitalismo, del trabajo asalariado, de la empresa y del trabajo sociológico. Ese debate se suscitó a partir de las contribuciones de Alain Caillé y Norbert Alter en este Chorus: “¿Es posible pensar el trabajo a través del don? Acerca de la aplicación del paradigma del don-contradon en sociología del trabajo”.

  9. Manufacturing of JT-60SA Cryostat Base

    Energy Technology Data Exchange (ETDEWEB)

    Medrano, Mercedes, E-mail: mercedes.medrano@ciemat.es [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Alonso, Javier; Botija, José; Fernández, Pilar; Ramos, Francisco; Rincon, Esther; Soleto, Alfonso [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Davis, Sam; Di Pietro, Enrico [Fusion for Energy, JT-60SA European Home Team, 85748 Garching bei Munchen (Germany); Masaki, Kei; Sakasai, Akira [JAEA, Japan Atomic Energy Agency, Naka Fusion Institute, Ibaraki 311-0193 (Japan)

    2013-10-15

    Highlights: ► JT-60SA Cryostat Base has been fabricated in seven structures fastened by bolts. ► The pieces are fully welded structures further machined to get required tolerances. ► The pre-assembly of the Cryostat Base will be done at the factory to check final tolerances as well as to anticipate problems which could be encountered during final assembly. -- Abstract: JT-60SA is a superconducting tokamak to be assembled and operated at the JAEA laboratories in Naka (Japan) [1]. The tokamak has been designed to prepare, support and complement the ITER experimental programme and will be manufactured and operated under the funding of the Broader Approach Agreement (between the government of Japan and the European Commission) and of the Japan Fusion National Programme. Within the European contribution to JT-60SA, Spain has to provide the cryostat. Due to functional purposes, the cryostat has been divided in two large assemblies: the Cryostat Base (CB) and the Cryostat Vessel Body the latter subdivided into Cryostat Vessel Body Cylindrical Section (CVBCS) and the Top Lid. Spain is committed to provide the design and subsequent manufacturing of the CB and CVBCS (excluding the Top Lid) through the National Laboratory of Fusion at Ciemat. The design of both components has been concluded and the CB is currently being manufactured by a Spanish company, IDESA. This paper aims to present the status of the manufacturing and pre-assembly at the factory of the CB that has to be delivered in November 2012.

  10. Nouvelles questions féministes: 22 años profundizando en una visión feminista, radical, materialista y anti-esencialist Nouvelles questions féministes: 22 years deepening in a radical, materialist and anti-essentialist feminist perspective

    Directory of Open Access Journals (Sweden)

    Jules Falquet

    2004-12-01

    Full Text Available Este artículo presenta las grandes orientaciones teóricas y políticas, así como la história, de la más antigua revista científica feminista francófona Nouvelles Questions Féministes, que fue fundada hace 22 años por Simone de Beauvoir, entre otras.Esta revista se caracteriza por su voluntad de unir calidad teórica y anclaje político y militante, en una perspectiva radical, materialista y anti-esencialista muy firme. A lo largo de su existencia, Nouvelles Questions Féministes ha publicado artículos de especial importancia para el movimiento feminista. A mediados de los difíciles años 90, empieza a tener serias dificultades para mantenerse, sin apoyo institucional, hasta casi cerrar. Sin embargo, ha empezado una nueva vida a partir de 2001, cuando es retomada - con la misma perspectiva política por un dinámico grupo alrededor de la Universidad de Lausanne.This article presents the main theoretical and political perspectives, as well as the herstory, of the oldest french-speaking scientific feminist review, Nouvelles Questions Féministes, which has been created 22 years ago by Simone de Beauvoir and others. One of the main distinctive point of this review, is its will to unite theoretical quality and an activist, political position, embedded in a very firm radical, materialist and anti-essentialist perspective. In the last 22 years, Nouvelles Questions Féministes published articles which have been critical for the feminist movement. In the midst of the "backlash 90ies", the review started facing hard times, with no institucional backing, and almost had to close down. But it started a new life in 2001 - with the same political perspective - , in the hands of a dynamic group based at the Lausanne University.

  11. AGREEMENT BETWEEN CERN AND UBS SA

    CERN Multimedia

    2002-01-01

    We wish to inform you that the agreement between CERN and UBS SA has been renewed for a period of five years with effect from 1st July 2002. This represents the culmination of work carried out since 1999 by a group consisting of representatives of the Finance Division, the SPL Division, the Staff Association and the Users Office. After analysis of the results of a market survey, it emerged that OVERALL the UBS offered the best conditions and guarantees for the CERN personnel. Owing to developments in the banking market, new conditions have had to be negotiated, which will be presented to you by the UBS (see article).

  12. Nouvelles Techniques d'Intervention sur la Corrosion des Armatures du Béton Armé

    CERN Document Server

    Colloca, C

    1999-01-01

    Les principaux dégâts constatés dans les armatures passives du béton armé sont la corrosion généralisée et la corrosion locale. Ces dégradations sont provoquées soit par la carbonatation du béton soit par le contact avec l'eau pure ou l'eau chargée de chlorures pénétrant dans les pores et dans les fissures de surface. Ce document présente de nouvelles techniques d'intervention, fondées sur d'anciens principes, introduites pour le traitement électrochimique des zones altérées liées aux différentes conditions. La réalcalinisation (dans le cas de béton carbonaté) permet d'augmenter le pH du béton et de rétablir un niveau de basicité garantissant la passivation de l'armature. La désalification (dans le cas de béton entamé par les chlorures) provoque l'élimination des ions chlorure à travers la surface du béton. Les avantages de ces traitements, par rapport aux anciennes techniques, sont appréciables si l'on considère la durée d'exécution et leur coût moins élevé.

  13. El relato breve francés a finales del siglo XVIII y principios del siglo XIX : los cuentos y las nouvelles del Caballero de Boufflers

    OpenAIRE

    Vicente-Yagüe Jara, Antonio José de

    2012-01-01

    Stanislas de Boufflers (1738-1815), más conocido en su época como el caballero de Boufflers, es un escritor lorenés algo olvidado, perdido entre esa gran masa de autores que recorrieron el siglo XVIII francés. En estas páginas pretendemos presentar a este gran desconocido de la literatura francesa de finales del siglo XVIII y principios del XIX, al igual que analizar sus cuentos y sus nouvelles, ya que éstos constituyen un elemento imprescindible para comprender la personalidad de nuestro aut...

  14. El relato breve francés a finales del siglo XVIII y principios del siglo XIX: los cuentos y las nouvelles del caballero de Boufflers

    OpenAIRE

    Vicente-Yagüe Jara, Antonio José de

    2012-01-01

    Stanislas de Boufflers (1738-1815), más conocido en su época como el caballero de Boufflers, es un escritor lorenés algo olvidado, perdido entre esa gran masa de autores que recorrieron el siglo XVIII francés. En estas páginas pretendemos presentar a este gran desconocido de la literatura francesa de finales del siglo XVIII y principios del XIX, al igual que analizar sus cuentos y sus nouvelles, ya que éstos constituyen un elemento imprescindible para comprender la personalidad de nuestro aut...

  15. La réception des films de la Nouvelle Vague dans le courrier des lecteurs de Cinémonde

    OpenAIRE

    Sellier, Geneviève

    2014-01-01

    L’auteure propose d’explorer les traces d’une forme ordinaire de cinéphilie, celle des spectatrices qui forment les deux tiers du courrier des lecteurs de l’hebdomadaire français Cinémonde (1928-1966). La période choisie (1959-1960), moment d’émergence de la Nouvelle Vague, suscite parmi les (jeunes) correspondantes régulières de ce magazine populaire une intensification des commentaires et des échanges. Bien que citées partiellement, ces lettres évaluent le plus souvent la performance des ac...

  16. Description de trois espèces nouvelles de Myxosporidies (Myxozoa : Myxosporea parasites de Citharinus citharus (Geoffroy Saint-Hilaire, 1809 (Citharinidae au Tchad (Afrique Centrale

    Directory of Open Access Journals (Sweden)

    Fomena A.

    2004-03-01

    Full Text Available L'examen de Citharinus citharus (Geoffroy Saint-Hilaire, 1809 (Teléostéen, Citharinidae, récolté sur le fleuve Chari au Tchad, a révélé la présence de trois espèces nouvelles de Myxosporidies dont nous donnons ici la description complète : Thelohanellus taguii n. sp., parasite systémique; Myxobolus mbailaoi n. sp., parasite des opercules, de la peau et de l'intestin et Myxobolus charii n. sp., parasite de la peau.

  17. An investigation on SA 213-Tube to SA 387-Tube plate using friction welding process

    Energy Technology Data Exchange (ETDEWEB)

    Rajan, S. Pandia; Kumaraswamidhas, L. A. [Indian Institute of Technology, Jharkhand (India); Kumaran, S. Senthil [RVS School of Engineering and Technology, Tamil Nadu (India); Muthukumaran, S. [National Institute of Technology, Tamil Nadu (India)

    2016-01-15

    Friction welding of tube to tube plate using an external tool (FWTPET) is a relatively newer solid state welding process used for joining tube to tube plate of either similar or dissimilar materials with enhanced mechanical and metallurgical properties. In the present study, FWTPET has been used to weld SA 213 (Grade T12) tube with SA 387 (Grade 22) tube plate. The welded samples are found to have satisfactory joint strength and the Energy dispersive X-ray analysis (EDX), X-ray diffraction (XRD) study showed that inter metallic compound is absent in the weld zone. The different weld joints have been identified and the phase composition is found using EDX and XRD. Microstructures have been analyzed using optical and Scanning electron microscopy (SEM). The mechanical properties such as hardness, compressive shear strength and peel test for different weld conditions are studied and the hardness survey revealed that there is increase in hardness at the weld interface due to grain refinement. The corrosion behavior for different weld conditions have been analyzed and the weld zone is found to have better corrosion resistance due to the influence of the grain refinement after FWTPET welding process. Hence, the present investigation is carried out to study the behavior of friction welded dissimilar joints of SA 213 tube and SA 387 tube plate joints and the results are presented. The present study confirms that a high quality tube to tube plate joint can be achieved using FWTPET process at 1120 rpm.

  18. Perfil de saúde dos trabalhadores de um Centro de Saúde-Escola

    Directory of Open Access Journals (Sweden)

    Nascimento Lucila Castanheira

    2002-01-01

    Full Text Available O estudo buscou descrever o perfil de saúde dos trabalhadores (184 de um Centro de Saúde-Escola de Ribeirão Preto, sob a perspectiva da Promoção de Saúde, modelo epidemiológico de Blum e fatores de risco para doenças crônico-degenerativas. Foi realizado estudo descritivo utilizando-se entrevista estruturada. Concluiu-se que os trabalhadores eram predominantemente do sexo feminino, faixa etária de 35 a 39 anos e escolaridade "superior completo". Dentre os achados, constatou-se que 61,9% tinham sobrepeso e obesidade; a hipertensão foi detectada em 33,1%; 41 (22,3% apresentaram pressão arterial acima do nível da normalidade e a obesidade mostrou-se presente em mais da metade dos indivíduos com pressão arterial alterada. Os dados possibilitaram explorar riscos autocriados para as doenças crônico-degenerativas; identificar fatores relacionados à promoção de saúde e prevenção de doenças e refletir sobre o autocuidado e auto-responsabilidade, visando à qualidade de vida que desfrutarão, em decorrência da transição demográfica e epidemiológica que vivenciamos.

  19. North America and South America (NA-SA) neuropathy project.

    Science.gov (United States)

    Pasnoor, Mamatha; Nascimento, Osvaldo J M; Trivedi, Jaya; Wolfe, Gil I; Nations, Sharon; Herbelin, Laura; de Freitas, M G; Quintanilha, Giseli; Khan, Saud; Dimachkie, Mazen; Barohn, Richard

    2013-08-01

    Peripheral neuropathy is a common neurological disorder. There may be important differences and similarities in the diagnosis of peripheral neuropathy between North America (NA) and South America (SA). Neuromuscular databases were searched for neuropathy diagnosis at two North American sites, University of Kansas Medical Center and University of Texas Southwestern Medical Center, and one South American site, Federal Fluminense University in Brazil. All patients were included into one of the six major categories: immune-mediated, diabetic, hereditary, infectious/inflammatory, systemic/metabolic/toxic (not diabetic) and cryptogenic. A comparison of the number of patients in each category was made between North America and South America databases. Total number of cases in North America was 1090 and in South America was 1034 [immune-mediated: NA 215 (19.7%), SA 191 (18%); diabetic: NA 148 (13.5%), SA 236 (23%); hereditary: NA 292 (26.7%), SA 103 (10%); infectious/inflammatory: NA 53 (4.8%), SA 141 (14%); systemic/metabolic/toxic: NA 71 (6.5%), SA 124 (12%); cryptogenic: NA 311 (28.5%), SA 239 (23%)]. Some specific neuropathy comparisons were hereditary neuropathies [Charcot-Marie-Tooth (CMT) cases] in NA 246/292 (84.2%) and SA 60/103 (58%); familial amyloid neuropathy in SA 31/103 (30%) and none in NA. Among infectious neuropathies, cases of human T-lymphotropic virus type 1 (HTLV-1) neuropathy in SA were 36/141(25%), Chagas disease in SA were 13/141(9%) and none for either in NA; cases of neuropathy due to leprosy in NA were 26/53 (49%) and in SA were 39/141(28%). South American tertiary care centers are more likely to see patients with infectious, diabetic and hereditary disorders such as familial amyloid neuropathies. North American tertiary centers are more likely to see patients with CMT. Immune neuropathies and cryptogenic neuropathies were seen equally in North America and South America.

  20. Tecnologie dell’informazione e nuovi processi di vittimizzazione / Nouvelles technologies et processus de victimisation / Information technologies and new processes of victimisation

    Directory of Open Access Journals (Sweden)

    Marotta Gemma

    2012-08-01

    Full Text Available New technologies, on the one hand, have produced undeniable positive effects, from the acceleration of cultural diffusion to the communication between "worlds" previously unknown; on the other hand, they have become now an instrument to commit new crimes and deviants acts.In the article we will discuss the processes of victimization related to specific offenses (digital identity theft, online paedopornography, cyberstalking and to new forms of addiction due to the new media. The aim is to highlight the dangers of the misuse or abuse of new technologies.S'il est vrai que les nouvelles technologies de communication ont produit des effets positifs indéniables, comme l'accélération de la diffusion culturelle et l'échange entre « mondes » jusque-là inconnus, elles n'en sont pas moins devenues un moyen de commettre des actes déviants et criminels nouveaux.Cet article expose les processus de victimisation liés à certains crimes (comme l'usurpation d'identité, la pédopornographie en ligne, le cyber-harcèlement, et de nouvelles formes de dépendance, afin de mettre en évidence les dangers d'un usage pervers ou délictueux des nouveaux médias.

  1. Monogènes parasites de Clariidae (Teleostei, Siluriformes au Cameroun : I. Description de deux nouvelles espèces du genre Gyrodactylus dans le bassin du Nyong

    Directory of Open Access Journals (Sweden)

    Nack J.

    2005-09-01

    Full Text Available L’étude des parasites branchiaux et cutanés de trois espèces de Poissons du genre Clarias : C. camerunensis, C. jaensis et C. pachynema pêchés dans le bassin du Nyong (Cameroun a révélé la présence de deux espèces nouvelles de Monogènes du genre Gyrodactylus Nordmann : G. camerunensis n. sp. et G. nyongensis n. sp parasites de Clarias camerunensis, C. jaensis et C. pachynema. Gyrodactylus camerunensis n. sp. se sépare aisément de G. nyongensis n. sp. par la taille plus faible des pièces sclérifiées du hapteur. Ces deux nouvelles espèces se distinguent aussi des Gyrodactylus africains les plus proches, G. rysavyi, G. clarii et G. alberti par la morphologie et la taille des sclérites du hapteur. L’étude de leur spécificité montre qu’elle est du type stenoxène (mesosténoxène.

  2. Novas Tecnologias e Saúde

    OpenAIRE

    2013-01-01

    Introdução Comecemos por algo simples: lidar e combater doenças sempre pressupõe alguma forma de domínio técnico, mesmo quando as práticas para obtenção da saúde estão culturalmente associadas a meios mágicos. Um aspecto importante da magia, seu sentido ritualístico estrito, a observância de fórmulas rigorosas, constitui uma forma de racionalização da experiência empírica, que resulta em conhecimento sobre propriedades alucinógenas ou curativas de certos vegetais, por exemplo. A esse resp...

  3. Biodiversidade, biotecnologia e saúde

    Directory of Open Access Journals (Sweden)

    Garcia Eloi S.

    1995-01-01

    Full Text Available Este artigo apresenta a importância da biodiversidade, da biotecnologia a da saúde e discute vários aspectos dos problemas biológicos, ambientais e o dilema ético, relacionados com a expansão e a exploração dos recursos naturais em razão das quais espécies de plantas e animais têm sido extintas. Por outro lado, o conhecimento da biodiversidade tem possibilitado a identificação e a utilização de novos recursos naturais para a melhoria da vida do homem neste planeta. É importante que nossos pesquisadores se envolvam na luta pela preservação do ecossistema tropical. Os programas de exploração da biodiversidade devem estar baseados em sólidos conhecimentos científicos e favorecer ecológica e economicamente a sociedade.

  4. Biodiversidade, biotecnologia e saúde

    Directory of Open Access Journals (Sweden)

    Eloi S. Garcia

    1995-09-01

    Full Text Available Este artigo apresenta a importância da biodiversidade, da biotecnologia a da saúde e discute vários aspectos dos problemas biológicos, ambientais e o dilema ético, relacionados com a expansão e a exploração dos recursos naturais em razão das quais espécies de plantas e animais têm sido extintas. Por outro lado, o conhecimento da biodiversidade tem possibilitado a identificação e a utilização de novos recursos naturais para a melhoria da vida do homem neste planeta. É importante que nossos pesquisadores se envolvam na luta pela preservação do ecossistema tropical. Os programas de exploração da biodiversidade devem estar baseados em sólidos conhecimentos científicos e favorecer ecológica e economicamente a sociedade.

  5. Conséquences des nouvelles formes de commande sur les matériaux de l'isolation statorique

    Science.gov (United States)

    Bellomo, J. P.; Lebey, Th.; Peltier, Fr.; Oraison, J. M.

    1997-05-01

    Use of inverter drive for rotating machines speed control leads to the application of new stress on stator insulation materials. The integrity of these materials under such stresses has therefore to be studied. Thanks to specially equipped motor, the different voltage shapes have been identified. Very short rise time fronts, large overvoltages and high oscillation frequencies are obtained. These voltages are then reproduced on laboratory samples (Polyethylene Terephtalate). The main result is the existence of trapped surface charges related both to the rise front value and to the existence of polar mechanisms in the material bulk. The consequences of this surface charge existence on the reliability of a real system are then discussed. L'utilisation de nouvelles formes de commande pour les machines à courant alternatif se traduit par l'apparition d'un nouveau type de contraintes sur les matériaux de l'isolation statorique. L'étude de leur comportement sous l'action de ce type de contraintes revêt un intérêt tout particulier pour la validation et la stabilité de ces systèmes dans le temps. Nous présentons, tout d'abord, ces différentes formes de tension identifiées à l'aide d'un moteur spécialement instrumenté. L'existence de fronts de tension très élevés, de surtensions importantes (jusqu'à 500V) et d'oscillations hautes fréquences (2MHz), est mise en évidence. La reproduction de ces contraintes en laboratoire sur des échantillons de polyesters (PolyÉthylène Térephthalate) permet alors de déterminer l'influence des formes de tension carrées sur les propriétés intrinsèques du matériau. Elle se traduit par l'existence d'une charge piégée en surface du diélectrique. Cette charge superficielle est associée, d'une part à l'existence de phénomènes de relaxation dans les matériaux étudiés et d'autre part à la valeur des fronts de tension appliqués. Pour finir, les conséquences possibles de l'existence de ces charges superficielles

  6. Nouvelle manga, mon amour. Reflexiones sobre la narración gráfica de historias cotidianas

    Directory of Open Access Journals (Sweden)

    Olalla Hernández Ranz

    2010-03-01

    Full Text Available Desde sus primeras manifestaciones hace más de un siglo, el cómic se ha ido consolidando como un género popular sobretodo dirigido a un lector juvenil. Su evidente atractivo entre los lectores ha hecho que algunos padres, educadores y profesionales del ámbito de la promoción de la lectura se plantearan el por qué de dicha afición, llegando a conclusiones erróneas como la creencia de que se trata de una lectura menor, dirigida esencialmente a la pura distracción de quien los lee. El manga, en concreto, es el género dentro del cómic que más se consume en occidente. Se ha convertido en un fructífero producto de mercado que deriva en videojuegos, series de televisión, películas de cine… Su gran acogida entre el público infantil y juvenil preocupa a mediadores por la supuesta carga violenta y sexual y la baja calidad literaria de sus obras. El presente propuesta tratará de deshacer algunos tópicos en relación con la concepción errónea la historieta nipona, a partir del estudio de un corpus de obras creadas por autores japoneses y europeos que quieren aportar un cómic de calidad tanto en su forma como en el contenido, abriendo así las puertas a nuevas investigaciones de gran interés. La Novelle manga es un nuevo género dentro del cómic nipón que aúna las estrategias comunicativas más destacables de las novelas gráficas japonesas, el valor estético del cómic francés y la sencillez y el tono de las películas de cine francés dentro de la Nouvelle Vague para crear un cómic que narra historias cotidianas de gran valor literario y estético, muy recomendable para lectores juveniles y adultos.

  7. Rheumatoid arthritis specific anti-Sa antibodies target citrullinated vimentin

    NARCIS (Netherlands)

    Vossenaar, E.R.; Despres, N.; Lapointe, E.; Heijden, A.G. van der; Lora, M.; Senshu, T.; Venrooij, W.J.W. van; Menard, H.A.

    2004-01-01

    Antibodies directed to the Sa antigen are highly specific for rheumatoid arthritis ( RA) and can be detected in approximately 40% of RA sera. The antigen, a doublet of protein bands of about 50 kDa, is present in placenta and in RA synovial tissue. Although it has been stated that the Sa antigen is

  8. Saúde oral: um desafio para a equipe de saúde

    Directory of Open Access Journals (Sweden)

    Vera Lúcia de Oliveira Gomes

    2001-03-01

    Full Text Available Esta pesquisa teve como objetivo desvelar o conhecimento dos formandos dos cursos de Enfermagem e Medicina de uma Universidade do Rio Grande do Sul acerca da promoção da Saúde Oral. Participaram do estudo 58 acadêmicos, sendo 26 do Curso de Enfermagem e 32 do Curso de Medicina, estes responderam a um questionário com três perguntas semi-estruturadas. Através da triangulação constatamos que esse conhecimento entre os formandos dos referidos cursos é deficitário. Sabemos que é grande a dificuldade de acesso da população infantil carente aos gabinetes dentários, por esse motivo, acreditamos ser indispensável que os profissionais de Enfermagem e Medicina tenham conhecimentos referentes à promoção de saúde oral em crianças.

  9. Projetos PET-Saúde e Educando para a Saúde: construindo saberes e práticas

    Directory of Open Access Journals (Sweden)

    Pâmela Leites de Souza

    Full Text Available Buscando alcançar ações intersetoriais efetivas e inovadoras, o projeto Educando para a Saúde, vem envolvendo as escolas, academia e serviços de saúde locais no desafio de construir uma sólida relação entre saúde-escola. O presente relato de experiência socializa a trajetória do projeto Educando para a Saúde, uma parceria entre a Equipe de Saúde da Família (ESF de um bairro de Pelotas - RS, a comunidade docente de duas escolas do território e acadêmicos do Programa de Educação pelo Trabalho para a Saúde - PET-Saúde. O objetivo é refletir o papel da ESF e dos acadêmicos do Projeto PET-Saúde na integração saúde-educação. Os temas discutidos são relacionados à educação em sexualidade, direitos sexuais e reprodutivos com ênfase nas DSTs e métodos contraceptivos, prevenção, promoção e recuperação da saúde. A participação do acadêmico nas atividades de integração saúde-educação veio a acrescentar ideias, valores e conceitos, possibilitando a (reconstrução das relações interpessoais, promovendo a reciclagem do processo de trabalho. Pelos laços multiprofissionais e interdisciplinares, essa parceria consiste em aprendizado mútuo, cujos frutos refletem diretamente na melhoria da assistência prestada à comunidade.

  10. Gasto privado com saúde por classes de renda

    Directory of Open Access Journals (Sweden)

    KILSZTAJN SAMUEL

    2002-01-01

    Full Text Available OBJETIVO: O artigo analisa a participação do gasto privado com saúde das famílias no PIB e no total da renda familiar per capita e a distribuição do gasto privado com saúde das famílias por classes de renda. MÉTODOS: A pesquisa utilizou os microdados da Pesquisa Nacional por Amostra de Domicílios de 1998, com a divisão da população em quatro classes de renda familiar per capita e a distribuição dos gastos em planos de saúde, consultas médicas, consultas com outros profissionais de saúde, exames, medicamentos, artigos ortopédicos e aparelhos médicos, óculos e lentes, odontologia, hospitais, enfermagem domiciliar e outros gastos com saúde. RESULTADOS: Apenas 7,2% da população com renda familiar per capita até 1 salário mínimo em 1998 tinha direito a algum plano de saúde, e o gasto privado com saúde das famílias desta classe, que representava 52,5% da população, era em média de R$ 5,36 por pessoa. Para as pessoas com renda familiar per capita acima de 9 salários mínimos, os planos de saúde atingiam 83,2% da população e o gasto privado com saúde das famílias R$ 133,04. CONCLUSÕES: A implantação do Sistema Único de Saúde foi acompanhada pelo crescimento expressivo dos planos de saúde nos anos 90. Mesmo se todo o gasto público com saúde fosse destinado à população sem planos de saúde, ainda assim o gasto destas pessoas em 1998 só alcançaria R$ 352,62, ou seja, 43% do gasto com saúde das pessoas com planos, R$ 819,08.

  11. Saúde mental e trabalho: os problemas que persistem

    Directory of Open Access Journals (Sweden)

    Leny Sato

    Full Text Available Este artigo toma por objeto a Saúde Mental e Trabalho como uma subárea do campo da Saúde do Trabalhador. Parte da constatação de que os problemas de saúde mental e trabalho, já identificados em meados da década de 1980, persistem. Após retomar a taxonomia de tais problemas, busca evidenciar algumas de suas expressões atuais a partir da assistência e da vigilância em saúde do trabalhador, bem como pela perspectiva de alguns sindicatos mais atentos à questão. Para tal, toma como ponto de partida o Centro de Referência em Saúde do Trabalhador (CRST de Campinas. Por fim, pontua algumas características do trabalho no contexto atual para compreender as motivações dessa persistência.

  12. Em busca de uma Teologia Pública da Saúde

    Directory of Open Access Journals (Sweden)

    Alex Villas Boas

    2016-03-01

    Full Text Available A proposta de uma teologia pública da saúde visa o diálogo entre antropologia teológica e antropologias médicas e da saúde de modo a ampliar a percepção da saúde, não somente como fato, mas como valor. Mesmo um Estado Laico, suas tradições religiosas possuem hermenêuticas de saúde, ao interpretar a doença e a morte com razões religiosas distintas, ora conflitantes, ora cooperativas com as ciências da saúde. Ampliar essas hermenêuticas religiosas compondo a sabedoria de vida presente nas expressões religiosas e o conhecimento científico da área de saúde visa uma cooperação para interesses de bem comum da sociedade civil, como é a questão da saúde. Para essa reflexão, a escola de Cós combina a sabedoria mítica asclepíade e a ciência jônia. Os mitos de saúde nomeados no juramento hipocrático pertencem à tradição da teologia poética grega e indica uma espécie de credo no qual a medicina hipocrática professa, no qual o médico além de profissional também possui fé na vida e exerce o ofício de sacerdote da esperança. Interessa ainda o modo como o a teologia da saúde grega foi recebida pela teologia cristã, e como ambas desconstruíram suas teodiceias. Nessa recepção há um caminho para pensar uma teologia pública da saúde. 

  13. Nouvelles techniques de mise en valeur des ressources d'hydrocarbures New Techniques for Valorising Hydrocarbon Resources

    Directory of Open Access Journals (Sweden)

    Boy De la Tour X.

    2006-11-01

    Full Text Available Après avoir montré l'importance des réserves de pétrole non conventionnel et l'enjeu que représente pour l'humanité la mise en exploitation de ces ressources, cette étude examine les axes actuels de recherches et l'état de la technologie pour chacune des sources de nouveau pétrole retenues : mers profondes, récupération assistée, huiles lourdes et sables asphaltiques, schistes bitumineux et conversion du charbon. Il en ressort que si les ressources de nouveau pétrole sont considérables, leur mise en valeur nécessitera des investissements très lourds, et le coût du pétrole ainsi produit restera élevé, comparé au coût actuel du pétrole conventionnel. Compte tenu des délais de mise en oeuvre, des problèmes technologiques restant à résoudre et de la nécessité de réaliser des pilotes semi-industriels très coûteux pour expérimenter les nouvelles techniques, il convient de consentir sans attendre un effort important de recherche technologique, impliquant un accroissement sensible des budgets de R&D, mais aussi des incitations financières appropriées. Cet effort de mise au point de technologies adaptées à ces sources d'hydrocarbures sera favorisé par les nouvelles conditions économiques créées par la rareté relative des réserves d'hydrocarbures classiques, à condition que les Etats, par leur politique, favorisent la production de ressources d'hydrocarbures à coût élevé. A l'heure actuelle, on peut évaluer la production de pétrole difficile à environ 100 Mt, l'essentiel étant réalisé dans le domaine des huiles lourdes et de la récupération assistée ; on estime que la production de nouveau pétrole pourrait représenter 200 à 350 Mt en 1990 et se situer entre 600 et 900 Mt en 2000, soit 5 à 8 % de la production de pétrole en 1990 et 15 à 20 % en 2000. Un tel objectif nécessiterait des investissements de l'ordre de 500 à 750 milliards de dollars 1980. After pointing out the importance of

  14. A Short Story from Canada in the German EFL-Classroom — “Borders” or a Sense of Belonging in a Multicultural Society Une nouvelle canadienne dans l’enseignement de l’anglais langue étrangère en Allemagne : « Borders » ou le sentiment d’appartenance dans une société multiculturelle.

    Directory of Open Access Journals (Sweden)

    Albert Rau

    2009-10-01

    Full Text Available Depuis quelques années, l’apprentissage interculturel joue un rôle central dans l’enseignement de l’anglais langue étrangère. Au lieu de divulguer uniquement des informations factuelles relatives à un pays étranger, l’apprentissage interculturel vise à comprendre une culture, un monde qui diffère du sien. Une façon d’appréhender une culture étrangère peut se faire en lisant sa littérature car les textes littéraires n’offrent pas seulement un sentiment d’empathie envers les personnages ou une impression de vivre leur quotidien par procuration, ils suscitent des questions et des réponses de la part des étudiants. La littérature canadienne se prête bien à l’apprentissage interculturel car les grandes interrogations portant sur le contexte socio-culturel canadien servent de modèles aux étudiants. La nouvelle Borders de Thomas King en est un exemple. Elle relate le vécu d’une famille nouvellement établie, piégée dans un terrain vague situé aux confins du Canada et des Etats-Unis, une famille désireuse de préserver son identité « pied noire » (Blackfoot.

  15. Nouvelle methode d'optimisation du cout d'un vol par l'utilisation d'un systeme de gestion de vol et sa validation sur un avion Lockheed L-1011 TriStar

    Science.gov (United States)

    Gagne, Jocelyn

    Usually, flights optimization and planning will take place before flight, on ground. However, it is not always feasible to do such optimization, or sometime unpredictable events may force pilots to change the flight path. In those circumstances, the pilots can only rely on charts or their Flight Management System (FMS) in order to maintain an economic flight. However, those FMS often rely on those same charts, which will not take into consideration different parameters, such as the cost index, the length on the flight or the weather. Even if some FMS take into consideration the weather, they may only rely on manually entered or limited data that could be outdated, insufficient or incomplete. The alleviate these problems, the function program's that was developed is mainly to determine the optimum flight profile for an aircraft, or more precisely, at the lowest overall cost, considering a take-off weight and weather conditions. The total cost is based on the value of time as well as the cost of fuel, resulting in the use of a ratio called the cost index. This index allows both to prioritize either the time or fuel consumption according to the costs related to a specific flight and/or airline. Thus, from a weight, the weather (wind, temperature, pressure), and the cost index, the program will calculate from the "Performance DataBase" (PDB) of a specific airplane an optimal flight profile over a given distance. The algorithm is based on linear interpolations in the performances tables using the Lagrange method. Moreover, in order to fully optimize the flight, the current program can, according to departure date and coordinates, download the latest available forecast from environment Canada website and calculate the optimum flight accordingly. The forecast data use by the program take the form of a 0.6 × 0.6 degrees grid in which the effects of wind, pressure and temperature are interpolated according to the aircraft geographical position and time. Using these tables, performances and forecasts, the program is therefore able to calculate the optimum profile from ground, but also in flight, if any change would occur on the path. Because all data is tabulated and not calculated, the required calculation power remains low, resulting in a short calculation time. Keywords: optimization, algorithm, simulation, cost.

  16. URGENCES NOUVELLE VERSION

    CERN Multimedia

    Medical Service

    2002-01-01

    The table of emergency numbers that appeared in Bulletin 10/2002 is out of date. The updated version provided by the Medical Service appears on the following page. Please disregard the previous version. URGENT NEED OF A DOCTOR GENEVAPATIENT NOT FIT TO BE MOVED: Call your family doctor Or SOS MEDECINS (24H/24H) 748 49 50 Or ASSOC. OF GENEVA DOCTORS (7H-23H) 322 20 20 PATIENT CAN BE MOVED: HOPITAL CANTONAL 24 Micheli du Crest 372 33 11 382 33 11 CHILDREN'S HOSPITAL 6 rue Willy Donzé 382 68 18 382 45 55 MATERNITY 24 Micheli du Crest 382 68 16 382 33 11 OPHTALMOLOGY 22 Alcide Jentzer 382 84 00 HOPITAL DE LA TOUR Meyrin 719 61 11 CENTRE MEDICAL DE MEYRIN Champs Fréchets 719 74 00 URGENCES : FIRE BRIGADE 118 FIRE BRIGADE CERN 767 44 44 BESOIN URGENT D'AMBULANCE (GENEVE ET VAUD) : 144 POLICE 117 ANTI-POISON CENTRE 24H/24H 01 251 51 510 EUROPEAN EMERGENCY CALL: 112 FRANCE PATIENT NOT FIT TO BE MOVED: call your family doctor PATIENT CAN BE MOVED: ST. JULIE...

  17. Le CERN accueille le dernier élément de son aimant géant

    CERN Multimedia

    Tesnier, Grégory

    2005-01-01

    The giant machinery that will take place in the future particle accelerator LHC of CERN in 2007 grows rich of a new part. The last module of the superconducting magnet of the CMS detector completes a unit which weighs 50 tons and is six metres in diameter

  18. Triagem em saúde mental infantil

    Directory of Open Access Journals (Sweden)

    Fabiana Vieira Gauy

    Full Text Available Este estudo foi conduzido para comparar os resultados de um procedimento grupal aberto e um procedimento individual estruturado para avaliação do comportamento da criança conforme o relato materno. Participaram deste estudo 29 mães que buscavam atendimento para seus filhos em uma unidade de saúde mental infanto-juvenil. As primeiras 15 mães que procuraram o serviço foram entrevistadas individualmente conforme um roteiro estruturado desenvolvido a partir do CBCL e depois foram entrevistadas em grupo, em formato aberto. As outras 14 mães participaram da entrevista grupal aberta e em seguida participaram da entrevista individual estruturada. Os resultados das entrevistas foram comparados tomando como referência as 67 categorias comportamentais identificadas a partir do roteiro individual e quatro variáveis contextuais relatadas nos dois procedimentos. Os resultados mostram que um número substancialmente maior de comportamentos-problema foi identificado através de entrevista individual estruturada do que através de entrevista grupal aberta realizada com os mesmos informantes. É possível que o uso de um roteiro estruturado em entrevistas grupais possa oferecer mais informações com otimização do tempo de avaliação.

  19. On SA, CA, and GA numbers

    CERN Document Server

    Caveney, Geoffrey; Sondow, Jonathan

    2011-01-01

    Gronwall's function $G$ is defined for $n>1$ by $G(n)=\\frac{\\sigma(n)}{n \\log\\log n}$ where $\\sigma(n)$ is the sum of the divisors of $n$. We call an integer $N>1$ a \\emph{GA1 number} if $N$ is composite and $G(N) \\ge G(N/p)$ for all prime factors $p$ of $N$. We say that $N$ is a \\emph{GA2 number} if $G(N) \\ge G(aN)$ for all multiples $aN$ of $N$. In arXiv 1110.5078, we used Robin's and Gronwall's theorems on $G$ to prove that the Riemann Hypothesis (RH) is true if and only if 4 is the only number that is both GA1 and GA2. Here, we study GA1 numbers and GA2 numbers separately. We compare them with superabundant (SA) and colossally abundant (CA) numbers (first studied by Ramanujan). We give algorithms for computing GA1 numbers; the smallest one with more than two prime factors is 183783600, while the smallest odd one is 1058462574572984015114271643676625. We find nineteen GA2 numbers $\\le 5040$, and prove that a GA2 number $N>5040$ exists if and only if RH is false, in which case $N$ is even and $>10^{8576}$.

  20. Educação em saúde como principal alternativa para promover a saúde do idoso

    Directory of Open Access Journals (Sweden)

    Danielli Gavião Mallmann

    2015-06-01

    Full Text Available Trata-se de uma revisão integrativa que objetivou identificar as evidências científicas sobre as ações educativas em saúde voltadas à promoção da saúde do idoso. A busca dos artigos foi realizada nas bases de dados Medline, Lilacs, BDENF, CINAHL e biblioteca virtual SciELO, por meio do cruzamento dos descritores Educação em Saúde, Idoso, Envelhecimento, Saúde do Idoso, Promoção da Saúde e Qualidade de vida, incluindo-se artigos publicados no período de 2003 a 2013, nos idiomas inglês, espanhol e português, realizados com idosos. Foram selecionados oito artigos, dos quais percebeu-se a qualidade de vida e a promoção do envelhecimento saudável como fatores resultantes das estratégias de educação em saúde. As ações de educação em saúde para idosos necessitam de metodologias que atentem para a complexidade do processo de envelhecimento e relacionem os fatores que cercam o indivíduo, como as crenças, os valores, as normas e os modos de vida.

  1. Une espèce nouvelle du genre Scarabaeus d’Afrique du Nord (Coleoptera : Scarabaeidae, Scarabaeini

    Directory of Open Access Journals (Sweden)

    Khalid BOURAADA

    2015-12-01

    Full Text Available In the context of a dedicated entomological survey mission of mobile sandy formations (dunes, nebkhas ... and fixed by various perennial grasses in eastern Morocco, a newly identified specimen of the genus Scarabaeus of male sex has particularly caught our attention. Indeed, the great family of Scarabaeoidea whose species are mostly attracted to dung feces dominates the dune ecosystems in terms of number of species and individuals. The great taxonomic richness is denoted in Bouârfa region. It is the same for the abundance of which the high values are noted in this desertic station (Bouârfa. The low numbers of beetles in Saïdia region is related to the isolation of this type of dune in the region it is due primarily to the influence of the Mediterranean climate.

  2. A saúde mental em cuidados de saúde primários

    OpenAIRE

    Santos, Ana Isabel Monteiro dos

    2009-01-01

    As perturbações psiquiátricas no contexto da Clínica Geral / Medicina Geral e Familiar constituem um tema que tem vindo a ser estudado desde a década de 1960, sendo uma matéria complexa e com múltiplas implicações. Os estudos epidemiológicos mais recentes demonstram que as perturbações psiquiátricas e os problemas de saúde mental se tornaram a principal causa de incapacidade e uma das principais causas de morbilidade nas sociedades modernas. E, para além dos indivíduos que apresentam uma ...

  3. Les énergies marines renouvelables : qu'est-ce que c'est ? Quelles perspectives en Nouvelle-Calédonie.

    OpenAIRE

    De Roeck, Yann-herve; Loubersac, Lionel

    2013-01-01

    Ce texte présente une revue des différentes technologies d’exploitation des ressources énergétiques qui peuvent être tirées de la mer. On expose ainsi les solutions offertes par la marée et les courants, la houle et les vagues, l’éolien marin, l’énergie thermique des mers, l’énergie osmotique et on précise les degrés de maturité technologique très échelonnés de chaque solution. Cette nouvelle activité économique sur l’espace littoral et côtier comporte également des effets indirects en termes...

  4. Benoît Lambert, Cyclopolis, ville nouvelle : Contribution à l’histoire de l’écologie politique

    OpenAIRE

    Duchemin, Eric

    2004-01-01

    Chaque matin, ou une fois par semaine, vous chevauchez votre destrier urbain pour vous déplacer. Ce faisant, si nous en croyons l’auteur de Cyclopolis, ville nouvelle : contribution à l’histoire de l’écologie politique, vous faites partie d’un mouvement d’écologie politique. Avec une écriture fluide, Benoît Lambert nous fait découvrir les dessous de l’utilisation du vélo. Après la lecture de ce livre, on regarde notre cher vélo, qu’il soit rouillé, tordu ou brillant comme un sou neuf, sous un...

  5. Le projet ALIAS, inventaire des sites aquacoles en Nouvelle Calédonie = The ALIAS project, inventorying aquaculture sites in New Caledonia

    OpenAIRE

    Loubersac, L; Populus, J.; Grotte, A.; Burban, P.Y.

    1992-01-01

    Le projet ALIAS Calédonie, sélectionné dans le cadre du programme d'études préliminaires SPOT a permis la conception et l'élaboration de produits dérivés de SPOT destinés à étudier et inventorier le potentiel en sites aquacoles (bassins à terre en vue d'élevage de crevettes tropicales) des côtes Ouest et Nord de la Nouvelle Calédonie. Après une présentation du problème posé, on explicite la forme des produits cartographiques d'inventaire retenus. On expose les résultats globaux du projet expr...

  6. New method of determining the thermal utilization factor of a cell; Nouvelle methode de determination du facteur d'utilisation thermique d'une cellule

    Energy Technology Data Exchange (ETDEWEB)

    Amouyal, A.; Benoist, P. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1956-07-01

    A new formula for the thermal utilization factor is derived, which, while comparable in simplicity to the formula given by elementary diffusion theory, furnishes much more precise results. This is clearly brought out by comparison with the results given by the S{sub n} and spherical harmonics methods. (author) [French] Une nouvelle expression du facteur d'utilisation thermique, d'une simplicite comparable a celle de Ia theorie elementaire, est etablie. La comparaison avec les resultats fournis par la methode S{sub n} et les methodes d'harmoniques spheriques montre que la precision obtenue par cette formule est tres superieure a celle que donne la theorie elementaire. (auteur)

  7. Chapitre III. Un aspect de la condition féminine en nouvelle-Espagne : Trois béates au XVIIe siècle

    OpenAIRE

    2014-01-01

    La Nouvelle-Espagne des Habsbourg ne pouvait manquer de connaître ces affaires communes à toute l’Europe des xvie et xviie siècles et qui relevaient du religieux, du pathologique, du social et parfois même, du moins en Espagne et en France, du politique ; nous évoquons bien sûr ici ces procès retentissants contre les illuminés, ilusos, béates vraies ou fausses, nonnes possédées du Démon, qu’il nous faut considérer pour l’instant d’un regard superficiel en l’absence, sans doute provisoire, d’u...

  8. Les nouvelles perspectives d'analyse spatiale des nuisances sonores. Le projet SIGAUR (Système d'Information Géographique et Acoustique URbaine

    Directory of Open Access Journals (Sweden)

    Erwan Quesseveur

    1999-06-01

    Full Text Available Ce rapport présente un projet de recherche sur l’intégration d’une couche d’information de nuisances acoustiques dans un système d’information géographique.Après un développement sur l’état de la pollution et des moyens aujourd’hui en vigueur pour la combattre, on va montrer les nouvelles perspectives offertes pour l’analyse spatiale du bruit. En confrontant cette nuisance aux enjeux du territoire, elle peut devenir un véritable critère de décision en aménagement du territoire.Ce projet résulte d’une collaboration entre le Centre Scientifique et Technique du Bâtiment C.S.T.B. et l’équipe " S.I.G. " de l'Institut de Géographie Alpine (IGA

  9. Une nouvelle technique de stabilisation en fréquence d'un laser sur une cavité de Fabry-Perot

    OpenAIRE

    1987-01-01

    Nous présentons une nouvelle méthode pour stabiliser la fréquence d'un laser sur le pic de transmission d'un résonateur de Fabry-Perot (F.P.). Au moyen d'un modulateur acousto-optique, on décale en fréquence une fraction du faisceau laser d'une quantité voisine de l'écart entre modes du F.P. Les faisceaux direct et décalé sont polarisés orthogonalement et appliqués à l'entrée du F.P. Les faisceaux transmis sont séparés par un prisme de Glan. En effectuant la différence entre ces deux pics de ...

  10. L'auteure mise en scène et mise à nu. Sur les fausses confessions de La nouvelle pornographie

    Directory of Open Access Journals (Sweden)

    Joëlle Papillon

    2010-11-01

    Full Text Available L'inclusion dans La nouvelle pornographie (2000 du nom propre de l'auteure est perçue comme une implication qui la met en danger. La métalepse est utilisée pour inscrire le roman dans la mouvance des confessions sexuelles et se jouer de leurs codes. Comme le discours publicitaire, Marie Nimier utilise la rhétorique pornographique afin de « vendre » un contenu domestique : la pornographie de surface dissimule un récit qui réinscrit l'amour comme moteur du désir féminin. Nimier joue de la métalepse pour déjouer les scènes pornographiques et séduire le lecteur par l'intelligence de ses manipulations plutôt que par ses dévoilements.

  11. Journée d’études « Littérature et politique en Nouvelle-Angleterre | 2 »

    Directory of Open Access Journals (Sweden)

    Thomas Constantinesco

    2010-09-01

    Full Text Available Poursuivant des travaux entamés en janvier 2009 à l’occasion d’une première journée d’études, les cinq communications présentées à l’Université Charles de Gaulle – Lille 3 ont permis de prolonger la réflexion sur les rapports entre littérature et politique en Nouvelle-Angleterre au cours de la période que, depuis l’ouvrage pionnier de F. O. Matthiessen, on appelle la « Renaissance américaine » tout en l’élargissant à l’époque contemporaine, à travers les exemples de Robert Frost et de Susan H...

  12. Les nouvelles formes de la communication autour des projets urbains : modalités, impacts, enjeux pour un débat participatif

    Directory of Open Access Journals (Sweden)

    Hélène Bailleul

    2008-09-01

    Full Text Available Dans cet article, nous observons les évolutions que l’usage des nouvelles technologies implique dans la communication autour des projets urbains. Notre analyse des nouvelles modalités qu’Internet a pu importer dans la participation des habitants aux projets urbains (partie 1 nous pousse à observer, plus spécifiquement, les modifications qui ont trait, dans ce contexte, à la nature et au statut de l’information sur l’espace. La démocratisation des techniques de représentation de l’espace par ordinateur (3D, simulation entraîne le recours quasi systématique à des images virtuelles du projet, d’une grande qualité (partie 2, mais dont on ne connaît que très peu les impacts sur la perception et la réception que les habitants font du projet (partie 3.In this article, we observe the evolutions involved by the use of new technology in the communication around urban projects. Our analysis of the new modalities, Internet was able to import in the participation of inhabitants in urban projects (chapter 1 urges us to examine, more specifically, the modifications concerning the nature and the status of the information about space. The democratization of computer-based spatial representation’s tools (3D, simulation entails more and more systematic recourse to virtual images of the project, with high definition (chapter 2. But, nowadays, we still know little about their impacts on the perception and the reception, the inhabitants make of the project (chapter 3.

  13. A interdisciplinaridade vivenciada no PET-Saúde = The interdisciplinarity experienced in the PET- Saúde program

    Directory of Open Access Journals (Sweden)

    Assega, Mariana Lieka

    2010-01-01

    Full Text Available Introdução: A incorporação da equipe de saúde bucal na Estratégia de Saúde da Família (ESF, em 2000, possibilitou a adoção de uma postura mais ativa de atenção primária nesta área, visto que a saúde bucal consiste em parte integrante e inseparável da saúde do indivíduo. A interação dos profissionais da saúde torna-se possível por meio de iniciativas como o PET-Saúde, o qual fomenta a formação profissional articulada com os profissionais da ESF, bem como, o processo de integração ensino-serviço-comunidade na perspectiva da interdisciplinaridade. Objetivo: Relatar a vivência de estudantes ao realizar uma pesquisa interdisciplinar. Descrição da experiência: Esse relato foi vivenciado no projeto PET-Saúde da Faculdade de Medicina de Marília, no sub projeto Saúde do Homem, visando construir e validar um instrumento de coleta de dados por meio da Técnica Delphi, para auxiliar a equipe de saúde detectar precocemente agravos odontológicos, visto que no Brasil, o perfil de saúde bucal, na faixa etária de 35 a 44 anos, está comprometido. Os participantes, deste estudo, são discentes de enfermagem e medicina, preceptora cirurgiã-dentista e tutora docente enfermeira. Para as atividades educacionais utilizou-se a metodologia ativa de ensino-aprendizagem. Conclusão: Os movimentos reflexivos, os espaços de diálogos propiciaram o desenvolvimento da investigação científica. Além disso, a aproximação do processo de validação pela Técnica Delphi, também permitiu ampliação do conhecimento multidisciplinar sobre saúde bucal. Esta vivência possibilitou qualificar a formação acadêmico-profissional na linha da interdisciplinaridade, sendo importante sua multiplicação para o fortalecimento da interação entre os profissionais e a articulação das ações de saúde

  14. Cumulative Production Per Township - SaMiRa

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This dataset contains a selected township grid within the Sagebrush Mineral Resource Assessment project (SaMiRa) study area attributed with cumulative oil and gas...

  15. Desenvolvimento econômico, desigualdade e saúde

    Directory of Open Access Journals (Sweden)

    Pedro Reginaldo Prata

    1994-09-01

    Full Text Available O autor se refere a dimensão socioeconômica, individual e coletiva do fenômeno saúde-doença. Refere-se também ao fato das populações estarem sobre a influência desigual de fatores de risco e de proteção à saúde. Discute as desigualdades no desenvolvimento e a relação entre desenvolvimento, riqueza, saúde e justiça social. Questiona as teorias de desenvolvimento econômico, diferenciando desenvolvimento de crescimento. Cunha os conceitos de armadilha do desenvolvimento e refugiados sociais. Define uma comunidade saudável. Propõe a necessidade de mudança no modelo de desenvolvimento. Baliza o papel e as limitações do setor saúde no que diz respeito a iniqüidade social.

  16. Discussion of CoSA: Clustering of Sparse Approximations

    Energy Technology Data Exchange (ETDEWEB)

    Armstrong, Derek Elswick [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-03-07

    The purpose of this talk is to discuss the possible applications of CoSA (Clustering of Sparse Approximations) to the exploitation of HSI (HyperSpectral Imagery) data. CoSA is presented by Moody et al. in the Journal of Applied Remote Sensing (“Land cover classification in multispectral imagery using clustering of sparse approximations over learned feature dictionaries”, Vol. 8, 2014) and is based on machine learning techniques.

  17. Desigualdade social e saúde no Brasil

    Directory of Open Access Journals (Sweden)

    Neri Marcelo

    2002-01-01

    Full Text Available Esse artigo estuda a relação entre desigualdade social e saúde no Brasil. A estratégia usada foi avaliar as necessidades e o consumo dos serviços de saúde, bem como o acesso a seguro saúde ao longo da distribuição de renda. Adicionalmente, por meio da estimação de uma regressão logística, foram avaliados outros determinantes do consumo dos serviços de saúde, com o intuito de se conhecer aonde e quem utiliza esses serviços no país. Os dados foram extraídos da Pesquisas Nacional de Amostra por Domicilio da Fundação Instituto Brasileiro de Geografia e Estatística levada a campo em 1998. Em geral, observou-se que os indivíduos nos primeiros décimos da distribuição de renda têm pior acesso a seguro saúde, necessitam de maiores cuidados médicos, mas consomem menos os serviços de saúde. As outras características extra rendimento indicam que os principais determinantes para o consumo dos serviços de saúde estariam fortemente associados aos grupos sociais mais privilegiados (de maior escolaridade, acesso a seguro saúde, água, esgoto, luz, coleta de lixo e a fatores que apontam para capacidade de geração de oferta desses serviços no país.

  18. Review of underground salt attenuation measurements for SalSA

    Energy Technology Data Exchange (ETDEWEB)

    Connolly, Amy, E-mail: connolly@mps.ohio-state.edu [1040 Physics Research Building, 191 West Woodruff Avenue, Columbus, OH 43210-1117 (United States)

    2012-01-11

    We report on the status of the Salt Sensor Array (SalSA), a proposed experiment for detecting ultra-high energy neutrinos through the radio Cherenkov technique with an array of radio-microwave antennas embedded in a large, naturally occurring salt formation. We review the measurements to date aimed at assessing SalSA's feasibility, including a return visit of the Hockley Salt Mine in Hockley, Texas, and discuss the current status of the project.

  19. Apoio social e saúde entre idosos

    Directory of Open Access Journals (Sweden)

    Ramos Marília P.

    2002-01-01

    Full Text Available O presente artigo trata da relação entre a saúde dos idosos e relacionamentos sociais, bem como na interpretação e entendimento desta problemática sob a luz de dois enfoques teóricos: um macro, centrado na Teoria da Integração Social de Emile Durkheim e outro micro, centrado na Teoria das Trocas, de Peter Blau, com ênfase na Teoria da Eqüidade. A integração social (freqüência de contatos pode ter efeitos negativos na saúde, mas isto tem de ser medido pela qualidade dos contatos. Algumas conclusões apresentadas indicam que as relações sociais têm um efeito na saúde, no sentido de que as pessoas, nas sociedades modernas, esperam a reciprocidade, e, quando isto não é possível, principalmente na fase do envelhecimento, as pessoas sentem-se dependentes, e isso pode afetar a saúde de diferentes maneiras. Por outro lado, quando as pessoas têm problemas de saúde, elas experienciam uma falta de relações sociais balanceadas devido à incapacidade para trocar em bases iguais. Sendo assim, conclui-se que a relação entre relações sociais e saúde na população idosa pode ser uma relação recíproca.

  20. Saúde, direito à saúde e justiça sanitária

    Directory of Open Access Journals (Sweden)

    João Arriscado Nunes

    2012-10-01

    Full Text Available Propõe‑se uma abordagem preliminar dos processos heterogéneos e contingentes através dos quais se definem e constituem mutuamente a saúde e o direito à saúde. São apresentadas e discutidas duas manifestações recentes dessa dinâmica. A primeira situa‑se na linha das transformações associadas às orientações de inspiração neoliberal no campo da saúde, apontando para a passagem da saúde como direito à saúde como imperativo, centrado na responsabilização individual e na centralidade da vigilância e da prevenção. A segunda, designada justiça sanitária, é exemplificada através de situações em que cidadãos, através da acção colectiva e mobilizando os vocabulários dos direitos e da justiça, procuram o reconhecimento como portadores de uma doença, os direitos associados a essa condição e a acção pública sobre situações que afectam a sua saúde.

  1. Ang Demokratikong Sistema at ang mga Modelo ng Pamumuno sa Pilipinas

    Directory of Open Access Journals (Sweden)

    F. P. A. Demeterio

    2010-06-01

    Full Text Available Maraming paraan ang pagsusuri sa problema ng pulitika sa Pilipinas.Para sa mga moralista at ideyalista, halimbawa, maaari itong tingnangamit ang perspektibo ng sistema ng pagpapahalaga (values at moralidad; para sa mga materyalista naman, maaari din itong himayin gamit ang perspektibo ng pagka-di-pantay-pantay ng kayamanan at kapangyarihan(unequal wealth and power ng ating mga mamamayan; o hindi kaya para sa mga eksperto sa sistema at istraktura, maaari din itong dalumatin gamit ang perspektibo ng ating marupok na burukrasya. Susubukan ng papel na ito na pag-aralan ang paksa sa pamamagitan ng pagsusuri sa konsepto ng pamumuno na hinihiling ng ating demokratikong sistema at sa kaparehong konseptong umiiiral naman sa kamalayan ng ating mga kababayan. Gagamitin ng pagsusuring ito, bilang teoretikal na balangkas, ang isang uri ng antropolohikalna teorya at pamamaraan na kilala bilang “kognitibong antropolohiya”(cognitive anthropology.

  2. La place du groupe de pairs dans l’intégration des nouvelles aides-soignantes dans les EHPAD

    Directory of Open Access Journals (Sweden)

    François Aubry

    2010-12-01

    Full Text Available Cet article propose une problématisation de l’intégration des aides-soignantes dans les organisations gériatriques de type EHPAD, en France, à partir du postulat théorique de l’habilitation, défini par Marcelle Stroobants. Devenir aide-soignante n’est pas uniquement le prolongement continu d’une formation, de l’acquisition d’un diplôme et de l’obtention d’un emploi. Le processus d’intégration des nouvelles aides-soignantes dans l’organisation est une étape informelle fondamentale au fait d’entrer dans le métier. À travers l’analyse de vingt-quatre entretiens biographiques, nous avons pu relever la contradiction entre les propos des acteurs, proposant une vision naturalisée du choix professionnel, et le récit de leur parcours professionnel. Ce décalage met en avant l’importance du processus de construction identitaire par le groupe de pairs. Les différentes approches sociologiques de la compétence ne proposent pas une vision aussi globale que celle de l’habilitation, qui permet un renversement de la perspective individualiste de formation. Dans le prolongement de cette théorie, nous insisterons ainsi sur le rôle central du jugement des pairs, attributif de compétence, pour ce métier fortement dominé socialement.The role of peer group in integration of new nursing’s aides in geriatric nursing homesThis paper proposes a problematization of the integration of nursing’s aides in organizations like geriatric nursing homes in France, from the theoretical premise of “habilitation”, defined by Marcelle Stroobants. Becoming a nursing’s aides not only the continuous extension of training, acquisition of a diploma and getting a job.The process of integrating new nursing’s aides in the organization is a fundamental informal stage in the fact of entering the profession.Through analysis of twenty-four biographical interviews, we could note the contradiction between what actors speech, offering a

  3. Gestion par projets et risques pour la santé psychologique au travail dans la nouvelle économie

    Directory of Open Access Journals (Sweden)

    Marie-Josée Legault

    2006-05-01

    Full Text Available Y a-t-il des problèmes de santé mentale propres au travail dans la nouvelle économie ? Quoiqu’on puisse constater que le modèle de demande psychologique - autonomie décisionnelle de Karasek et Theorell- trouve aussi son application dans les milieux de travail qui empruntent cette forme, on observe, en fait, des formes particulières de ces facteurs dans la forme d’organisation du travail propre à la gestion par projets. Assimilables à « l’hypersollicitation par le client » comme il a été repéré par Christophe Dejours, ces formes ont été observées lors d’une enquête menée récemment sur la conciliation entre la vie privée et la vie professionnelle dans sept organisations montréalaises. La recherche qualitative a recueilli en tout le discours de 88 répondants distribués également selon le sexe et exerçant des fonctions liées au génie informatique. Ces observations permettent d’envisager une nuance au modèle théorique de la santé mentale ci-haut mentionné, visant à tenir compte des effets délétères d’une très grande latitude décisionnelle assortie de très grandes responsabilités chez des travailleurs hautement qualifiés.Are there distinct mental health problems among workers in the new economy? Although we may observe that the psychological demand - decision latitude model of Karakek and Theorell is appropriate and also finds its application in this type of workplace, we also notice some particular forms that these factors take in the management-by-project work organization model. Akin to the so-called "client’s hyper-demanding activity" as identified by Christophe Dejours, these forms were observed during a recent field study about balancing work and family in seven Montreal organizations. The qualitative study collected data from 88 individual interviews of information technology engineers, evenly distributed by gender. These observations allow a nuance of the above-mentioned theoretical

  4. MimoSA: a system for minimotif annotation

    Directory of Open Access Journals (Sweden)

    Kundeti Vamsi

    2010-06-01

    Full Text Available Abstract Background Minimotifs are short peptide sequences within one protein, which are recognized by other proteins or molecules. While there are now several minimotif databases, they are incomplete. There are reports of many minimotifs in the primary literature, which have yet to be annotated, while entirely novel minimotifs continue to be published on a weekly basis. Our recently proposed function and sequence syntax for minimotifs enables us to build a general tool that will facilitate structured annotation and management of minimotif data from the biomedical literature. Results We have built the MimoSA application for minimotif annotation. The application supports management of the Minimotif Miner database, literature tracking, and annotation of new minimotifs. MimoSA enables the visualization, organization, selection and editing functions of minimotifs and their attributes in the MnM database. For the literature components, Mimosa provides paper status tracking and scoring of papers for annotation through a freely available machine learning approach, which is based on word correlation. The paper scoring algorithm is also available as a separate program, TextMine. Form-driven annotation of minimotif attributes enables entry of new minimotifs into the MnM database. Several supporting features increase the efficiency of annotation. The layered architecture of MimoSA allows for extensibility by separating the functions of paper scoring, minimotif visualization, and database management. MimoSA is readily adaptable to other annotation efforts that manually curate literature into a MySQL database. Conclusions MimoSA is an extensible application that facilitates minimotif annotation and integrates with the Minimotif Miner database. We have built MimoSA as an application that integrates dynamic abstract scoring with a high performance relational model of minimotif syntax. MimoSA's TextMine, an efficient paper-scoring algorithm, can be used to

  5. Tungo sa Hardin ng Tao: “Si Bonifacio ang pinakauna, hindi lamang sa Pilipinas, kundi sa buong Indonesia, oo, sa buong Asia na nanggaling sa, at edukado bilang, proletaryado, na nag-organisa ng mga proletaryo.” ni Tan Malaka

    Directory of Open Access Journals (Sweden)

    Ramon Guillermo

    2013-06-01

    Full Text Available Salin ito ng sanaysay na “Ke Taman Manusia” (sinulat taong 1943 nakathang-isip ng Indones na lider komunista na si Tan Malaka o Ibrahimgelar Datuk Tan Malaka (1897-1949 hinggil sa isang “Taman Manusia”o “Hardin ng Tao” na itatayo ng darating na Republika ng Indonesia sahinaharap. Dahil sa futuristiko nitong perspektiba, maihahalintuladang obrang ito ni Tan Malaka sa sanaysay ni Jose Rizal na “Filipinasdentro de cien años” (Ang Pilipinas sa loob ng isang dantaon (1891.Galing ito sa napakalaking akdang pilosopikal ni Tan Malaka napinamagatang Madilog: Materialisme, Dialektika, Logika (1948(Larawan 1 at tila tumatayo bilang pansarang mga repleksyon nito(Magnis-Suseno, 2005, pp. 205-233. Ang akdang ito ay unanginilathala noong 1951 ng Terbitan Widjaya sa Jakarta.

  6. Le programme ARTEMIS : nouvel outil pour la datation radiocarbone AMS (Spectromètre de Masse par Accélérateur et nouvelles problématiques

    Directory of Open Access Journals (Sweden)

    Cyrille Billard

    2012-04-01

    Full Text Available La mise en route du nouvel équipement ARTEMIS (Accélérateur pour la Recherche en sciences de la Terre, Environnement, Muséologie, Implanté à Saclay à partir de 2004 ouvre de nouvelles perspectives scientifiques et conduit à de nouvelles procédures de soumission des échantillons destinés à une datation 14C. Le MCC dispose aujourd’hui de droits alloués aux services régionaux de l'archéologie, services du ministère de la Culture, confrontés à ce type de demandes (musées, monuments historiques. Il impose désormais une nouvelle démarche de programmation scientifique des datations, associant une analyse critique des demandes.Since 2004, the availability at Saclay of a new ARTEMIS installation (Accélérateur pour la Recherche en sciences de la Terre, Environnement, Muséologie has opened new scientific perspectives and led to new procedures for submitting samples for carbon-14 dating. The French Ministry of Culture has the possibility of using this tool for radiocarbon dating at the request of its regional archaeological services or other services, such as museums and the historic monuments administration. This use now implies a new approach to the scientific planning for dating problems, associated with a critical analysis of the requests.

  7. Print Culture and the New Maritime Frontier in Rangoon and Penang Culture de l’imprimé et nouvelle frontière maritime à Rangoon et Penang

    Directory of Open Access Journals (Sweden)

    Su Lin Lewis

    2012-10-01

    Full Text Available From the mid-19th century, vast improvements in steamship and communication technology created an interlinked network of port-cities in the Indian Ocean and maritime Asia. Though Rangoon and Penang had starkly different relationships to colonial rule, they shared a lineage as multi-ethnic ports where various communities had existed side-by-side for centuries. The advent of the Victorian era fostered new class and racial divisions between them, yet also created a new feuilleton culture in the port-city with the mushrooming of newspapers, books, and a new reading public. Diverse ethnic and linguistic communities sought platforms to articulate their concerns and inform themselves of the affairs of the world, and their place within it. Burmese in Rangoon, imbued with a renewed sense of cultural pride, absorbed the rising tide of anticolonialism nationalism echoing throughout the world. Penangites transformed their society using the liberal, cosmopolitan tenants of imperial citizenship to make political and cultural claims for a multi-ethnic society. The vibrant, outward-looking atmosphere of the colonial port-city as a node of information and cultural exchange made Penang and Rangoon the intellectual staging grounds for new visions of the nation.À compter du milieu du xixe siècle, d’importantes améliorations dans la navigation à vapeur et les technologies des communications ont créé un réseau de villes portuaires dans l’Océan indien et l’Asie maritime. Même si Rangoon et Penang avaient des relations divergentes avec la puissance coloniale, elles participaient d’un type identique comme ports où cohabitaient depuis des siècles des communautés d’ethnies différentes. L’ère victorienne conduisit à de nouvelles divisions sociales et ethniques, mais suscita dans la ville portuaire une nouvelle culture littéraire avec le foisonnement des journaux, des livres et un nouveau lectorat. Les communautés ethniques et linguistiques

  8. L’inventaire des lieux de mémoire de la Nouvelle-France au Québec

    Directory of Open Access Journals (Sweden)

    Daniel Lauzon

    2012-04-01

    Full Text Available Un projet d’inventaire du patrimoine immobilier issu de l’époque de la Nouvelle–France a été amorcé en 1998 par le ministère de la Culture et des Communications du Québec, à l’instigation de la Commission franco–québécoise des lieux de mémoire communs. L’article présente les enjeux conceptuels d’un projet pilote qui explore des axes novateurs en terme d’inventaire, que ce soit sur le plan des fondements scientifiques (conception élargie du patrimoine, mise en relation des lieux et phénomènes historiques, de la réalisation (une collaboration internationale Québec–France ou de sa diffusion (utilisation des technologies de l’information.In 1998, the Ministère de la Culture et des Communications du Québec initiated an inventory of architectural and archaeological heritage from the New France period at the instigation of the Commission franco–québécoise des lieux de mémoire communs. This article describes the conceptual issues that arose in the course of a pilot project aimed at exploring innovative approaches to inventory work, be they related to its scientific bases (broader concept of heritage, relationship between historic sites and historic events, realization (international collaboration between Québec and France or the dissemination of its results (use of information technology.

  9. SA8000标准的来历

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    社会道德责任标准Social Accoutability 8000或简称SA8000。自1997年问世以来,受到了公众极大的关注,在美欧工商界引起了强烈反响。专家们认为,SA8000是ISO9000、ISO14000之后出现的又一个重要的国际性标准,并迟早会转化为ISO标准;通过SA8000认证将成为国际市场竞争中的又一重要武器。有远见的组织家应未

  10. Sindicalismo, SUS e planos de saúde

    Directory of Open Access Journals (Sweden)

    José Augusto Pina

    Full Text Available Este artigo discute a interlocução do sindicalismo brasileiro com o Sistema Único de Saúde (SUS e os planos e seguros privados de saúde. São ponderadas algumas teses na Saúde Coletiva à luz de estudos mais recentes nas Ciências Sociais sobre o sindicalismo e realizada análise documental para o caso da Central Única dos Trabalhadores (CUT, tomado aqui como referência. Aponta-se a necessidade de considerar os pesos relativos que a ação sindical atribuiu a cada um dos aspectos da relação, SUS e planos privados de saúde, pelas distintas conjunturas do país. O conflito entre trabalhadores e empresas somado ao desemprego e à precarização do trabalho expõe os limites das coberturas assistenciais privadas e impele a representação sindical a pleitear a intervenção estatal. O trabalho refletiu sobre as distintas modalidades de ação sindical na empresa e no Estado. A complexidade dessa dinâmica fez emergir um setor sindical interessado na gestão da previdência complementar e dos planos de saúde e, ao mesmo tempo, recria as circunstâncias e traz novas possibilidades de as organizações sindicais se colocarem na cena política e aglutinar os interesses de amplos segmentos dos trabalhadores para pressionar o Estado na defesa da melhoria do sistema público de saúde.

  11. FaSa: A Fast and Stable Quadratic Placement Algorithm

    Institute of Scientific and Technical Information of China (English)

    HOU WenTing(侯文婷); HONG XianLong(洪先龙); WU WeiMin(吴为民); CAI YiCi(蔡懿慈)

    2003-01-01

    Placement is a critical step in VLSI design because it dominates overall speed andquality of design flow. In this paper, a new fast and stable placement algorithm called FaSa is pro-posed. It uses quadratic programming model and Lagrange multiplier method to solve placementproblems. And an incremental LU factorization method is used to solve equations for speeding up.The experimental results show that FaSa is very stable, much faster than previous algorithms andits total wire length is comparable with other algorithms.

  12. Product policy of SC Electrecord S.A.

    Directory of Open Access Journals (Sweden)

    Ph. D. Candidate Cristina Andreescu (Manolache

    2009-12-01

    Full Text Available The global brand has the advantage of the scale economy, facilitates the company image and prestige and sometimes benefits even from its origin country effect. Its use is quite difficult (the semantic variations can impede the use of the same brand. The international brands act as a restriction against standardisation (the product should not be differentiated as there are internationally accepted and recognized brands. This paper makes an overview description of the general market environment, but also of the arket environment of SC ELECTRECORD S.A.; it underlines the product characteristics as well as the commercial diagnosis within SC ELECTRECORD S.A.

  13. SaRDIn - A Safe Reconfigurable Distributed Interlocking

    DEFF Research Database (Denmark)

    Fantechi, A.; Gnesi, S.; Haxthausen, Anne Elisabeth;

    2016-01-01

    Current computer-based interlocking systems most often have a centralized design, with all logic residing in a single computer. Centralized interlockings are complex to design. Following the general trend in Cyber-Physical Systems, the SaRDIn (Safe Reconfigurable Distributed Interlockings) concept...... promises a radically simpler solution. The novelty of the SaRDIn concept is a fine-grained distribution of the logic over all processors deployed at the sensors and actuators along the track layout, i.e. within the track circuits, point machines, signals, etc. The advantages and drawbacks...

  14. For-LySa: UML for Authentication Analysis

    DEFF Research Database (Denmark)

    Buchholtz, Mikael; Montangero, Carlo; Perrone, Lara;

    2005-01-01

    The DEGAS project aims at enriching standard UML-centred development environments in such a way that the developers of global applications can exploit automated formal analyses with minimal overhead. In this paper, we present For-LySa, an instantiation of the DEGAS approach for authentication...... analysis, which exploits an existing analysis tool developed for the process calculus LySa. We discuss what information is needed for the analysis, and how to build the UML model of an authentication protocol in such a way that the needed information can be extracted from the model. We then present our...

  15. Mga Kuwento-Kuwento ng Baliw: Lihis na Pagkilos sa Mga Maikling-Kuwentong Tagalog

    Directory of Open Access Journals (Sweden)

    Diana Ziganay

    1990-12-01

    Full Text Available Ang sulating ito ay nalikha upang magbigay ng isang pagsusuri at pagtatalakay sa pagbuo ng konsepto ng abnormalidad o kakaibang kilos o pananaw buhat sa mga piling uri ng panitikang Pilipinong naisulat sa wikang Ingles noong ika-1900 hanggang 1945. Pag-uukulan ng pansin dito ang panahon at kalagayang binanggit, ang mga suliraning binanggit, ang maga suliranin ng pagbuo ng panitikang Pilipino sa Ingles, at ang daloy ng kaisipan ng mga manunulat na may kaugnayan sa pag-unawa ng konsepto ng abnormalidad na sumasalamin sa ilang mga piling sulatin, tuwiran man o di tuwiran.

  16. Ressignificando Promoção de Saúde em Grupos para Profissionais da Saúde

    Directory of Open Access Journals (Sweden)

    Siegrid Kurzawa Zwiener dos Santos

    Full Text Available RESUMO Diferenças entre os conceitos de promoção e prevenção não estão claras para parte dos profissionais de saúde, incluindo médicos e estudantes de Medicina. Este trabalho objetivou problematizar o conceito de grupos de promoção de saúde para contribuir com o desenvolvimento da autonomia de profissionais de modo a avaliarem criticamente a maneira como vinham realizando educação em saúde e a refletirem sobre novas práticas. Foram realizados seis encontros no formato de círculos de cultura com profissionais da Estratégia Saúde da Família (ESF. Após esse trabalho, o grupo compreendeu a diferença entre promoção e prevenção. Promoção foi entendida como abordagem de condições de vida, cidadania, moradia, dinâmica familiar, como um processo que capacita para enfrentamentos, desenvolvimento do afeto, da discussão, do ouvir, do aceitar, do opinar e do oferecer. Os profissionais concluíram que é necessário desenvolver a autonomia dos grupos e indivíduos, ouvir a comunidade para compreender suas necessidades, resgatar o saber que a população possui e ver a saúde como um todo. Fatores biológicos foram relacionados à prevenção, e os sociais e psicológicos à promoção. O grupo é um instrumento importante para a promoção de saúde e deve ter uma metodologia problematizadora.

  17. Saúde mental nas práticas em saúde: a experiência do PROLIG

    Directory of Open Access Journals (Sweden)

    Samantha Mucci

    Full Text Available O presente trabalho apresenta o relato de experiências do Serviço de Atenção Psicossocial Integrada em Saúde (SAPIS nos Programas de Ligação (PROLIG. O SAPIS foi implantado em junho de 2002, no Hospital São Paulo (HSP, com o objetivo de promover uma atenção mais ampla às necessidades gerais e específicas do hospital no que diz respeito aos aspectos psicossociais bem como de reorganizar a inclusão de profissionais de saúde mental nas enfermarias e ambulatórios. Esse estudo tem como objetivo descrever a atuação do psicólogo como profissional de ligação em saúde mental no atendimento às demandas específicas de unidades do HSP. A tarefa do profissional de ligação em saúde mental envolve a assistência psicológica ao paciente e seu familiar assim como o desempenho do papel de especialista em saúde mental junto à equipe multiprofissional. Temos encontrado em nossa prática, no entanto, algumas dificuldades para a implementação e a manutenção de algumas propostas. Concluímos que a atuação do psicólogo como profissional de ligação de saúde mental tem promovido mudanças nos cuidados em saúde nessa instituição, porém ainda exige uma profunda reflexão e maior envolvimento da instituição e de políticas de saúde que viabilizem mudanças estruturais para a construção de uma efetiva prática integral e integrada nessa área.

  18. La catalyse d'épuration des gaz d'échappement automobiles. Situation actuelle et nouvelles orientations Catalytic Automotive Exhaust Gas Depollution. Present Status and New Trends

    Directory of Open Access Journals (Sweden)

    Prigent M.

    2006-11-01

    Full Text Available Cet article passe en revue les différents systèmes catalytiques de post-traitement utilisés actuellement sur la plupart des automobiles pour limiter leurs rejets de polluants. Les systèmes sont différenciés par leur mode de fonctionnement, le type de moteur à dépolluer (deux-temps, quatre-temps, diesel ou essence ou par leur mode de réalisation. Les nouvelles orientations, prévues pour respecter les futures réglementations antipollution, sont également décrites. On montre que certains véhicules prototypes, équipés de moteurs à combustion interne, sont capables d'avoir des émissions très proches de zéro tout comme les véhicules électriques. A review is made of the various types of exhaust gas aftertreatment systems presently used on most vehicles to reduce pollutant emissions. The systems are differentiated by their mode of action, according to the engine type to be depolluted (two-stroke, four-stroke, diesel or spark-ignition, and by their type of make-up. The major developments foreseen in the future, in view of compliance with the new legislations, are described. It is shown that some prototype vehicles with internal combustion engines are able to emit pollutant quantities really close to zero, such as electric cars.

  19. IMPACT DE L’ORIENTATION SUR LE CONFORT THERMIQUE INTERIEUR DANS L’HABITATION COLLECTIVE : Cas de la nouvelle ville Ali Mendjeli, Constantine

    Directory of Open Access Journals (Sweden)

    S BELLARA LOUAFI

    2009-06-01

    Une étude est effectuée sur le site de la nouvelle ville ALI MENDJELI de Constantine afin de comparer et de chercher la relation entre les éléments du climat et l’orientation. Une investigation sur terrain (relevé des températures, humidité relatives, températures de surfaces est entreprise pour évaluer la réponse quantitative globale pour ce type de climat (semi aride. Parallèlement à cela une simulation à l’aide d’un logiciel TRNSYS (version 14.1 a été effectuée pour tester plusieurs possibilités d’orientations et d’améliorations afin de déterminer les éléments qui peuvent servir à des conditions meilleures. Les résultats montrent que la prise en compte du critère orientation fait participer le bâtiment à une conception plus performante thermiquement et plus économe énergétiquement.

  20. Une nouvelle puce du genre Allopsylla Beaucournu et Fain, 1982 (Siphonaptera : Ischnopsyllidae en République Centrafricaine, sur un chiroptère Molossidae méconnu

    Directory of Open Access Journals (Sweden)

    Barrière P.

    2002-09-01

    Full Text Available Un couple d'Allopsylla lobayensis Beaucournu et Barrière sp. n. a été récolté le 1er novembre 1999 en forêt de Ngotto, dans la partie sud-ouest du bassin de la Lobaye, République Centrafricaine (RCA. Le spécimen hôte, un chiroptère molossidé méconnu (Myopterus whitleyi, constitue la première collecte de l'espèce en RCA. La nouvelle puce s'apparente à A. hetera Beaucournu et Fain, 1982, l'une des deux autres espèces du genre Allopsylla connues jusqu'alors de régions fauniques distinctes (A. alloides au Nigéria et A. hetera en République Démocratique du Congo. L'identification de trois hôtes parmi les trois espèces d'Allopsylla interpelle sur la spécificité hôte-parasite au sein de ce groupe.

  1. Une nouvelle famille de pyrochlores: les oxynitrures Ln2Ta 2O 5N 2. Préparation et étude cristallochimique

    Science.gov (United States)

    Pors, F.; Marchand, R.; Laurent, Y.

    1993-11-01

    Par action de l'ammoniac à 900-950°C sur les tantalates de terres rares LnTaO 4, on a mis en évidence une nouvelle famille d'oxynitrures dont la structure est de type pyrochlore. Ces composés Ln2Ta 2O 5N 2 ont été obtenus pour les lanthanides de rayon inférieur ou égal à celui du néodyme, ainsi que pour l'yttrium. La maille cristalline est de symétrie cubique (10,2 Å < a < 10,6 Å). La stoechiométrie anionique impose un désordre oxygène-azote au moins partiel entre les deux sites cristallographiques correspondants. New oxynitrides Ln2 Ta 2O 5N 2 ( Ln = Nd → Yb, Y), belonging to the pyrochlore type structure, have been prepared by heating at 900-950°C the LnTaO 4 corresponding tantalates. The a parameter of the cubic unit cell is comprised between 10.2 and 10.6 Å. Because of the anionic stoichiometry, oxygen and nitrogen atoms are disordered, at least partially.

  2. 78 FR 12256 - Airworthiness Directives; Embraer S.A. Airplanes

    Science.gov (United States)

    2013-02-22

    ...). SUMMARY: We propose to adopt a new airworthiness directive (AD) for certain Embraer S.A. Model ERJ 170 and... unit (APU) electronic starter controller (ESC) power cables and the airplane tail cone firewall. This... written relevant data, views, or arguments about this proposed AD. Send your comments to an address...

  3. Fonoaudiologia em saúde pública

    Directory of Open Access Journals (Sweden)

    Regina M. Freire

    1992-06-01

    Full Text Available Objetivou-se obter o entendimento das funções do fonoaudiólogo enquanto profissional da saúde. Discutem-se as dificuldades ligadas à implantação de um serviço novo, estranho às Unidades Básicas de Saúde. A seguir, analisa-se a demanda pelo serviço de Fonoaudiologia em postos de saúde, e verifica-se que 32% da população que busca esse serviço está em idade escolar e vem encaminhada pelas escolas, com queixa de problemas de aprendizagem. Uma aproximação maior dessas crianças, através do atendimento fonoaudiológico, delineia uma outra realidade: a de que não se pode considerar como distúrbio/desvio/problema/patologia marcas gráficas que se constituem como indícios do choque entre o processo de letramento e o de alfabetização. Entendendo a problemática do ponto de vista da saúde pública, propõe-se um programa de atendimento ao professor, cujo objetivo é o esclarecimento da escola com relação ao seu papel de co-construtora do processo de letramento da criança, devolvendo-lhe a responsabilidade pelo sucesso e/ou fracasso da alfabetização.

  4. Programa de saúde mental Programme in mental health

    Directory of Open Access Journals (Sweden)

    Cid Guimarães

    1975-12-01

    Full Text Available É apresentado o programa de Saúde Mental decorrente de convênio estabelecido pela Secretaria da Saúde do Estado de São Paulo com a Universidade de São Paulo, através da Faculdade de Saúde Pública. Este convênio tem por finalidade a realização de estudos na área de Saúde Mental, tais como assistência psiquiátrica preventiva e pesquisas visando a medir transtornos mentais através de casos de óbito e na população da cidade e de cursos e atividades curriculares e extra-curriculares.The School of Public Health is conducting a project, sponsored by the Health Department of the State of S. Paulo Government, aiming at: studying the integration of a team of mental health workers in a polivalent community health center; carrying out two large surveys on the incidence and prevalence of mental disorders and some of their characteristics; promoting courses and seminars on Mental Health for the personnel of Community Health Centers.

  5. KELEMBAGAAN DAN STRATEGI PENINGKATAN DAYA SAING KOMODITAS CABAI KAPUPATEN GARUT

    Directory of Open Access Journals (Sweden)

    Silmi Tsurayya

    2015-03-01

    Full Text Available The objectives of this study were to identify supply chains, analyze the institutions, formulate strategies for competitiveness enhancement, design competitiveness enhancement model, and determine the main strategies in competitiveness enhancement of chili pepper in Garut District. This study used primary data (observations, interviews, and questionnaires and secondary data (literature study. The data were processed and analyzed by Descriptive Analysis, SWOT Analysis, the House Model, and Pairwise Comparison. The results of this study showed that: 1 there were 6 supply chain structures in chili pepper distribution; 2 the major institutional sectors contributed to competitiveness enhancement of chili pepper including public sector, voluntary sector, and private sector; 3 SWOT Analysis obtained 15 alternative strategies; 4 the House Model as competitiveness enhancement model had 3 pillars consisting of products, human resource, and institutional and marketing; 5 the main strategies in competitiveness enhancement of chili pepper included Increase in the number of productions, Market expansion, and Partnership Strengthening and development. The managerial implications of the study suggest: 1 land expansion and plant arrangement pattern to ensure continuity of production quantities; 2 Optimization of the role of Agribusiness Sub-Terminal as the marketing institution; and 3 Maximization in the government’s role in facilitating farmer groups with associations or corporations.Keywords: institutional, the house model, competitiveness, chili, SWOTABSTRAKPenelitian ini bertujuan mengidentifikasi rantai pasok, menganalisis kelembagaan, merumuskan strategi peningkatan daya saing, merancang model peningkatan daya saing, dan menentukan strategi utama dalam peningkatan daya saing  komoditas cabai di Kabupaten Garut. Data yang digunakan terdiri dari data primer (observasi, wawancara, dan kuesioner dan data sekunder (studi literatur. Metode pengolahan dan

  6. Description de nouvelles espèces de Lépidoptères Hétérocères des Indes orientales

    NARCIS (Netherlands)

    Snellen, P.C.T.

    1886-01-01

    Ce lépidoptère appartient au même genre que la Teinopyga reticularis Felder (Lepidoptera der Novara-Reise. II, 2. pl. 106, fig. 18) et vient se placer dans la section Haliadea des Lithosides. Il se distingue de la reticularis par les dessins et la couleur des ailes antérieures qui sont d’un rouge sa

  7. WRKY Transcription Factors Involved in Activation of SA Biosynthesis Genes

    Directory of Open Access Journals (Sweden)

    Bol John F

    2011-05-01

    Full Text Available Abstract Background Increased defense against a variety of pathogens in plants is achieved through activation of a mechanism known as systemic acquired resistance (SAR. The broad-spectrum resistance brought about by SAR is mediated through salicylic acid (SA. An important step in SA biosynthesis in Arabidopsis is the conversion of chorismate to isochorismate through the action of isochorismate synthase, encoded by the ICS1 gene. Also AVRPPHB SUSCEPTIBLE 3 (PBS3 plays an important role in SA metabolism, as pbs3 mutants accumulate drastically reduced levels of SA-glucoside, a putative storage form of SA. Bioinformatics analysis previously performed by us identified WRKY28 and WRKY46 as possible regulators of ICS1 and PBS3. Results Expression studies with ICS1 promoter::β-glucuronidase (GUS genes in Arabidopsis thaliana protoplasts cotransfected with 35S::WRKY28 showed that over expression of WRKY28 resulted in a strong increase in GUS expression. Moreover, qRT-PCR analyses indicated that the endogenous ICS1 and PBS3 genes were highly expressed in protoplasts overexpressing WRKY28 or WRKY46, respectively. Electrophoretic mobility shift assays indentified potential WRKY28 binding sites in the ICS1 promoter, positioned -445 and -460 base pairs upstream of the transcription start site. Mutation of these sites in protoplast transactivation assays showed that these binding sites are functionally important for activation of the ICS1 promoter. Chromatin immunoprecipitation assays with haemagglutinin-epitope-tagged WRKY28 showed that the region of the ICS1 promoter containing the binding sites at -445 and -460 was highly enriched in the immunoprecipitated DNA. Conclusions The results obtained here confirm results from our multiple microarray co-expression analyses indicating that WRKY28 and WRKY46 are transcriptional activators of ICS1 and PBS3, respectively, and support this in silico screening as a powerful tool for identifying new components of stress

  8. Promoção da saúde, qualidade de vida e iniquidade em saúde: reflexões para a saúde pública.

    Directory of Open Access Journals (Sweden)

    Aline Rodrigues de ALMEIDA

    2016-01-01

    Full Text Available A ideia de promover saúde tem se tornado uma energia fundamental no movimento de saúde coletiva, no qual saúde é um fenômeno social e marcado por iniquidades. Este trabalho teve como objetivo compreender as relações entre promoção da saúde e iniquidades de acesso e assistência em saúde, identificandoos entraves para uma prática equânime da saúde pública com ênfase à qualidade de vida. Os diferentes perfis de doença e suas mediações sociais ultrapassam os estudos de variação biológica e incorpora o foco na dimensão social das vulnerabilidades. Para promover saúde no Brasil, é indissociável do enfrentamento de uma realidade de iniquidades históricas de grandes proporções que impõem desafios cotidianos não apenas ao setor de saúde, mas a todos aqueles que constroem políticas públicas. A qualidade de vida depende da satisfação das necessidades básicas de todos os cidadãos, propondo uma gestão baseada na solidariedade social, uma visão holística dos problemas e a redução das iniquidades. A promoção da saúde em um país tão desigual como o Brasil propõe um desafio constante aos atores envolvidos no sistema de saúde. A compreensão das iniquidades em saúde para estabelecer uma assistência holística é um processo difícil, mas extremamente relevante para a saúde pública.

  9. Sequence determinants for DNA packaging specificity in the S. aureus pathogenicity island SaPI1.

    Science.gov (United States)

    Bento, Joana C; Lane, Kristin D; Read, Erik K; Cerca, Nuno; Christie, Gail E

    2014-01-01

    The SaPIs and their relatives are a family of genomic islands that exploit helper phages for high frequency horizontal transfer. One of the mechanisms used by SaPIs to accomplish this molecular piracy is the redirection of the helper phage DNA packaging machinery. SaPIs encode a small terminase subunit that can be substituted for that of the phage. In this study we have determined the initial packaging cleavage sites for helper phage 80α, which uses the phage-encoded small terminase subunit, and for SaPI1, which uses the SaPI-encoded small terminase subunit. We have identified a 19nt SaPI1 sequence that is necessary and sufficient to allow high frequency 80α transduction of a plasmid by a terminase carrying the SaPI1-encoded small subunit. We also show that the hybrid enzyme with the SaPI1 small terminase subunit is capable of generalized transduction.

  10. Isolation of Asticcacaulis sp. SA7, a novel agar-degrading alphaproteobacterium.

    Science.gov (United States)

    Hosoda, Akifumi; Sakai, Masao

    2006-03-01

    An agar-degrading bacterium, strain SA7, was isolated from plant roots cultivated in soil. Analysis of the 16S rDNA sequence showed that strain SA7 is affiliated with the genus Asticcacaulis. Strain SA7 produced extracellular agarase, and grew utilizing agar in the culture medium as sole carbon source. Zymogram analysis showed that strain SA7 extracellularly secreted single agarase protein (about 70 kDa).

  11. 76 FR 7511 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2011-02-10

    ... Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes; and Model ERJ 190-100..., contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Technical Publications Section (PC 060), Av.... 39.13 by adding the following new AD: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket...

  12. Política de recursos humanos em saúde: análise de documentos oficiais do ministério da saúde

    OpenAIRE

    Luciana Pavanelli Von Gal de Almeida

    2007-01-01

    A reforma do setor saúde no Brasil levou à criação do Sistema Único de Saúde que contemplou a saúde como um direito social. Dessa forma, na atualidade, a saúde é tratada como um bem universal a ser provido para todos os cidadãos, implicando no princípio da equidade, em que cada cidadão tem direito a ações e serviços requeridos para manutenção e recuperação de sua saúde. Esse ideário tem forte implicação com os recursos humanos em saúde, em termos de definições políticas e técnicas relacionada...

  13. Aspectos relevantes sobre tuberculose para profissionais de saúde

    Directory of Open Access Journals (Sweden)

    Alexandre Daronco

    2012-01-01

    Full Text Available A Tuberculose (TB é uma patologia infectocontagiosa com clínica ampla cujo agentecausador é o Mycobacterium tuberculosis (Bacilo de Koch, uma micobactéria aeróbia estrita. Apesar de tratar-se dedoença antiga, que acomete seres humanos há séculos, sendo uma importante causa de morte no mundo inteiro,diferentes pesquisas do Ministério da Saúde apontam números preocupantes no tocante a novos casos. Materiais eMétodos: O presente artigo de revisão procura, de forma objetiva e clara, explicitar os principais aspectos de interessepara profissionais de saúde no tocante a Tuberculose doença. O artigo divide-se em tópicos: Defi nição, Sintomatologia,Diagnóstico, Tratamento, Multirresistência, Profi laxia, Formas de Contágio e Formas de Prevenção. Foram utilizadasreferências atuais sobre o tema, incluindo Manuais, Guidelines e Artigos científicos diversos de bases de dados comoUp to Date e Science Direct. Discussão: Sinais e sintomas da doença aumentam o grau de suspeição da mesma, oque torna o pedido de exames para confirmação da infecção dentro de tempo hábil para instituição da terapêuticaadequada. Assim como diagnóstico e tratamento, medidas para evitar o contágio, em serviços de saúde, locaiscom aglomerações humanas e em residências, são de fundamental importância no combate a tuberculose. Osprofissionais de saúde devem atentar para possíveis casos de resistência aos fármacos e as indicações de profilaxia,pois tais variáveis são de extrema relevância no controle da disseminação da doença. Conclusão: Por tratar-se dedoença infecciosa que pode acometer todas as classes sociais, além de possuir formas diferentes de acometimento,o conhecimento básico acerca da Tuberculose é deveras imprescindível em serviços de saúde, desde a atençãoprimária até os centros de saúde com alta tecnologia.

  14. The interdisciplinarity experienced in the PET- Saúde program A interdisciplinaridade vivenciada no PET-Saúde

    Directory of Open Access Journals (Sweden)

    Sueli Moreira Pirolo

    2010-01-01

    Full Text Available Introduction: The incorporation of the oral health team in the Family Health Strategy (ESF, in 2000, enabled the adoption of a more active attitude of Primary Health Care in this field, in as much as oral health consists of an inseparable and integral part of the individual’s health. The interaction of health professionals becomes possible through policies like “PET-Saúde” which promotes the professional formation articulated with the ESF professionals as well as the process of integration of teaching, service and community in the perspective of interdisciplinarity. Objective: To report the experience of students during an interdisciplinary research. Description of the experience: This report was experienced in “PET-Saúde” of the Faculty of Medicine of Marília, at the “Man’s Health” subproject aiming at elaborating and validating a data collection instrument through Delphi Technique in order to help the health care team to detect early dental problems because of the damaged oral health pattern of the age group between 35 and 44 in Brazil. The members of this study are: medical and nursing students, a dentist preceptor and a nursing tutor. For the educational activities, the active methodology of teaching-learning was used. Conclusion: The reflexive actions, the moments for discussions provided the development of scientific investigation. The approximation of the process of validation through Delphi Technique also allowed the expansion of multidisciplinary knowledge on oral health. This experience made it possible to qualify the academic-professional formation on the interdisciplinary approach, and it’s important to strengthen the interaction among professionals and the articulation of health actions.Introdução: A incorporação da equipe de saúde bucal na Estratégia de Saúde da Família (ESF, em 2000, possibilitou a adoção de uma postura mais ativa de atenção primária nesta área, visto que a saúde bucal consiste

  15. Andragogia na saúde: estudo bibliométrico

    OpenAIRE

    Draganov, Patrícia Bover [UNIFESP; Friedländer,Maria Romana; Sanna, Maria Cristina [UNIFESP

    2011-01-01

    O sucesso da aprendizagem envolve o uso de estratégias adequadas. Como a clientela de formação profissional e de educação permanente e a população assistida, para quem se dirigem as ações de educação em saúde, são majoritariamente adultas, metodologias como a Andragogia, que é a arte e ciência de conduzir adultos ao aprendizado, são uma alternativa interessante. Com o objetivo de quantificar e descrever a produção científica sobre Andragogia nas Ciências da Saúde no período de 1999 a 2009, re...

  16. Vibration analysis of the SA349/2 helicopter

    Science.gov (United States)

    Heffernan, Ruth; Precetti, Dominique; Johnson, Wayne

    1991-01-01

    Helicopter airframe vibration is examined using calculations and measurements for the SA349/2 research helicopter. The hub loads, which transmit excitations to the fuselage, are predicted using a comprehensive rotorcraft analysis and correlated with measuring hub loads. The predicted and measured hub loads are then coupled with finite element models representing the SA349/2 fuselage. The resulting vertical acceleration at the pilot seat is examined. Adjustments are made to the airframe structural models to examine the sensitivity of predicted vertical acceleration to the model. Changes of a few percent to the damping and frequency of specific models lead to large reductions in predicted vibration, and to major improvements in the correlations with measured pilot-seat vertical acceleration.

  17. Analysis and correlation of SA349/2 helicopter vibration

    Science.gov (United States)

    Heffernan, Ruth; Precetti, Dominique; Johnson, Wayne

    1991-01-01

    Helicopter airframe vibration is examined using calculation and measurements for the SA349/2 research helicopter. The hub loads, which transmit excitation to the fuselage, are predicted using a comprehensive rotorcraft analysis and correlated with measured hub loads. The predicted and measured hub loads are then coupled with finite element models representing the SA349/2 fuselage. The resulting vertical acceleration at the pilot seat is examined. Adjustments are made to the airframe structural models to examine the sensitivity of predicted vertical acceleration to the model. Changes of a few percent to the damping and frequency of specific modes lead to large reductions in predicted vibration and to major improvements in the correlations with measured pilot seat vertical acceleration.

  18. Quantitation of Staphylococcus aureus in seawater using CHROMagar SA.

    Science.gov (United States)

    Tice, Alan D; Pombo, David; Hui, Jennifer; Kurano, Michelle; Bankowski, Matthew J; Seifried, Steven E

    2010-01-01

    A microbiological algorithm has been developed to analyze beach water samples for the determination of viable colony forming units (CFU) of Staphylococcus aureus (S. aureus). Membrane filtration enumeration of S. aureus from recreational beach waters using the chromogenic media CHROMagar SA alone yields a positive predictive value (PPV) of 70%. Presumptive CHROMagar SA colonies were confirmed as S. aureus by 24-hour tube coagulase test. Combined, these two tests yield a PPV of 100%. This algorithm enables accurate quantitation of S. aureus in seawater in 72 hours and could support risk-prediction processes for recreational waters. A more rapid protocol, utilizing a 4-hour tube coagulase confirmatory test, enables a 48-hour turnaround time with a modest false negative rate of less than 10%.

  19. Le décodage biologique. Diffusion d’une nouvelle médecine non-conventionnelle contre le cancer Biodecoding. Dissemination of a New Unconventional Therapy against Cancer

    Directory of Open Access Journals (Sweden)

    Aline Sarradon-Eck

    2011-05-01

    Full Text Available De nouvelles médecines alternatives, regroupées sous l’appellation « décodage biologique », reposent sur une conception psychosomatique du cancer. Elles sont apparues en Europe dans les années 1990. Dans une perspective critique, l’article tente de comprendre la diffusion de ces nouvelles thérapies. S’inspirant du travail de D. Fassin sur les réseaux de l’ethnopsychiatrie, il analyse la construction d’une légitimation du décodage biologique et de ses praticiens, en décrivant les réseaux qui diffusent les théories et favorisent l’adoption de la pratique. L’article montre l’enracinement de ces nouvelles thérapies dans des représentations sociales et des modèles culturels de l’étiologie du cancer et du “faire face” à la maladie qui permettent ou renforcent l’adoption et l’appropriation de la pensée psychosomatique alternative.New alternative therapy called « bio-decoding » based on a psychosomatic perception of cancer appeared in the 1990s. Using a critical approach, the article aims to understand the therapy’s growth. Drawing on D. Fassin’s work about ethnopsychiatric networks, this paper analyses the construction of bio-decoding and bio-therapist legitimacy, by unravelling the networks which allow for theory dissemination and enable the practice’s growth. The article shows that these new therapies are deeply rooted in social and cultural models of cancer etiology and coping, which allow or reinforce approval and appropriation of alternative psychosomatic thought.

  20. Using SA508/533 for the HTGR Vessel Material

    Energy Technology Data Exchange (ETDEWEB)

    Larry Demick

    2012-06-01

    This paper examines the influence of High Temperature Gas-cooled Reactor (HTGR) module power rating and normal operating temperatures on the use of SA508/533 material for the HTGR vessel system with emphasis on the calculated times at elevated temperatures approaching or exceeding ASME Code Service Limits (Levels B&C) to which the reactor pressure vessel could be exposed during postulated pressurized and depressurized conduction cooldown events over its design lifetime.

  1. Gripe Suína: Saúde em destaque

    Directory of Open Access Journals (Sweden)

    HELOÍZA FELTRIN BANDEIRA

    2009-05-01

    Full Text Available

    O texto tem por objetivo analisar alguns

    fatos ligados à crise mundial na saúde causada pelo

    virus da Influenza A.

  2. A narrativa nas pesquisas qualitativas em saúde

    Directory of Open Access Journals (Sweden)

    Marcelo Eduardo Pfeiffer Castellanos

    2014-04-01

    Full Text Available O forte interesse das ciências sociais e humanas em saúde nos estudos narrativos levou a várias formas de incorporação das contribuições desses estudos na pesquisa qualitativa em saúde. Torna-se importante refletir sobre os contextos e as características dessa incorporação. Para tanto, destacamos as principais questões teóricas aí envolvidas, assim como situamos essa incorporação no contexto da produção científica mais ampla das ciências sociais e humanas em saúde. Apontamos, também, a contribuição dos estudos narrativos para reflexão sobre as relações entre estrutura e ação social ou entre contextos específicos de interação social e contextos societários mais amplos. Essa contribuição pode ser identificada na análise das relações narrativamente estabelecidas entre interpretação, experiência e ação, ao longo do processo de saúde-doença-cuidado. Argumenta-se que as narrativas não somente organizam interpretações, mas também consistem em uma forma específica de agenciamento social. Nesse sentido, as interpretações narrativas e as performances narrativas podem ser vistas como elementos centrais da construção social de experiências e trajetórias de adoecimento e cuidado.

  3. Eventos de massa, desastres e Saúde Pública

    Directory of Open Access Journals (Sweden)

    Camilla Figueiredo de Castro

    2014-09-01

    Full Text Available O Brasil tem sediado eventos de massa (EM e seus participantes estão sujeitos a riscos à saúde. Objetivou-se sistematizar as principais relações, de interesse da Saúde Pública, entre eventos de massa e ocorrência de desastres. Foram realizadas três estratégias metodológicas: revisão da literatura de EM, com busca sistemática, sistematização das principais informações sobre EM e seleção e sistematização das Referências que tratavam do tema desastre em suas palavras-chave, título ou Resumo. Foram selecionadas 28 Referências sobre EM, a maioria artigo científico, revisão de literatura, de 2012 e de natureza esportiva. Os principais assuntos abordados foram sistemas de vigilância e planejamento dos EM. Evidenciou-se a pouca informação analítica sobre os EM, bem como a importância de eventos não transmissíveis para a ocorrência de desastres, com destaque aos relacionados à multidão. O risco de desastres deve ser considerado no planejamento dos EM, para aumentar a capacidade de resposta considerando áreas estratégicas como: emergência médica, vigilância de doenças transmissíveis e vetores, segurança alimentar e dos serviços de saúde, saúde ambiental e laboratório. Ressalta-se a importância de pesquisas analíticas e de registro das experiências relacionadas aos EM, para a redução de risco de desastres.

  4. Structural analysis of the JT-60SA cryostat vessel body

    Energy Technology Data Exchange (ETDEWEB)

    Botija, José, E-mail: jose.botija@ciemat.es [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Alonso, Javier; Fernández, Pilar; Medrano, Mercedes; Ramos, Francisco; Rincon, Esther; Soleto, Alfonso [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Davis, Sam; Di Pietro, Enrico; Tomarchio, Valerio [Fusion for Energy, JT-60SA European Home Team, 85748 Garching bei Munchen (Germany); Masaki, Kei; Sakasai, Akira; Shibama, Yusuke [JAEA – Japan Atomic Energy Agency, Naka Fusion Institute, Ibaraki 311-0193 (Japan)

    2013-10-15

    Highlights: ► Structural analysis to validate the JT-60SA cryostat vessel body design. ► Design code ASME 2007 “Boiler and Pressure Vessel Code. Section VIII”. ► First buckling mode: load multiplier of 10.644, higher than the minimum factor 4.7. ► Elastic and elastic–plastic stress analysis meets ASME against plastic collapse. ► Bolted fasteners have been analyzed showing small gaps closed by strong welding. -- Abstract: The JT-60SA cryostat is a stainless steel vacuum vessel (14 m diameter, 16 m height) which encloses the Tokamak providing the vacuum environment (10{sup −3} Pa) necessary to limit the transmission of thermal loads to the components at cryogenic temperature. It must withstand both external atmospheric pressure during normal operation and internal overpressure in case of an accident. The paper summarizes the structural analyses performed in order to validate the JT-60SA cryostat vessel body design. It comprises several analyses: a buckling analysis to demonstrate stability under the external pressure; an elastic and an elastic–plastic stress analysis according to ASME VIII rules, to evaluate resistance to plastic collapse including localized stress concentrations; and, finally, a detailed analysis with bolted fasteners in order to evaluate the behavior of the flanges, assuring the integrity of the vacuum sealing welds of the cryostat vessel body.

  5. Performance verification tests of JT-60SA CS model coil

    Energy Technology Data Exchange (ETDEWEB)

    Obana, Tetsuhiro, E-mail: obana.tetsuhiro@LHD.nifs.ac.jp [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Murakami, Haruyuki [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan); Takahata, Kazuya; Hamaguchi, Shinji; Chikaraishi, Hirotaka; Mito, Toshiyuki; Imagawa, Shinsaku [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Kizu, Kaname; Natsume, Kyohei; Yoshida, Kiyoshi [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)

    2015-11-15

    Highlights: • The performance of the JT-60SA CS model coil was verified. • The CS model coil comprised a quad-pancake wound with a Nb{sub 3}Sn CIC conductor. • The CS model coil met the design requirements. - Abstract: As a final check of the coil manufacturing method of the JT-60 Super Advanced (JT-60SA) central solenoid (CS), we verified the performance of a CS model coil. The model coil comprised a quad-pancake wound with a Nb{sub 3}Sn cable-in-conduit conductor. Measurements of the critical current, joint resistance, pressure drop, and magnetic field were conducted in the verification tests. In the critical-current measurement, the critical current of the model coil coincided with the estimation derived from a strain of −0.62% for the Nb{sub 3}Sn strands. As a result, critical-current degradation caused by the coil manufacturing process was not observed. The results of the performance verification tests indicate that the model coil met the design requirements. Consequently, the manufacturing process of the JT-60SA CS was established.

  6. Cuidados paliativos: o desafio das equipes de saúde

    Directory of Open Access Journals (Sweden)

    Fernanda de Carvalho Braga

    2013-12-01

    Full Text Available O avanço tecnológico possibilitou tanto a redução da morte quanto o prolongamento da vida. Essa última traz consigo a necessidade de se pensar em como cuidar de pessoas fora de perspectiva de cura, especialmente porque tal cuidado inclui aspectos psicossociais, com implicações tanto para as relações entre os profissionais quanto com o paciente e sua família. Este estudo teve como objetivo buscar na literatura nacional artigos sobre equipes de saúde que oferecem cuidados paliativos. Realizou-se uma revisão de produção em periódicos nacionais com os descritores cuidados paliativos, equipe de saúde e neonatologia. Foram identificados 62 trabalhos, porém somente 11 atenderam ao critério de relacionar pelo menos dois descritores. Nenhum artigo relacionou as três palavras-chaves. O baixo número de publicações evidencia a necessidade de mais pesquisas nessa área, pois proporcionar qualidade de vida desde o diagnóstico da doença até o momento do óbito representa grande estresse para os profissionais de saúde.

  7. Saúde, este obscuro objeto de desejo

    Directory of Open Access Journals (Sweden)

    Fernando Lefèvre

    1997-07-01

    Full Text Available Exploram-se no presente ensaio as relações entre saúde e desejo, envolvendo um dado querer denominado "saúde" e as formas que este querer adquire no contexto do viver contemporâneo. Aponta-se ao final para uma situação radical no que toca à saúde, vítima de um processo irreversível de expansão, que acaba por inviabilizar qualquer tentativa de defini-la, levando a uma perda total de sentido, no contexto de um universo humano tentendo à completa robotização.The present essay explores the relations between health and desire involving a given yearning named "health" and the forms that such feeling acquires in the contemporaneous context of living. It ultimately points to a radical situation in terms of health, victim of a irreversible process of expansion that eventually makes any attempt of definition not viable, leading to a total loss of meaning within a human universe tending to complete robotization.

  8. O impacto da homofobia na saúde do adolescente

    Directory of Open Access Journals (Sweden)

    Taison Regis Penariol Natarelli

    2015-12-01

    Full Text Available Resumo Objetivo: Objetivou-se conhecer os tipos de violência sofrida por adolescentes homossexuais e compreender a influência da homofobia na saúde dessa população. Métodos: Foram realizadas entrevistas, em profundidade, com nove adolescentes residentes em um município do interior de São Paulo que se autodeclararam homossexuais. Resultados: Os tipos de violência sofridos e referidos pelos adolescentes foram: física, verbal, psicológica e sexual. A homofobia provoca percepções negativas sobre si mesmo e a não adoção de hábitos de vida saudáveis relacionados aos cuidados com alimentação, prática de atividades físicas, padrão de sono e ideações suicidas. Foram relatadas situações de homofobia nos serviços de saúde. Conclusão: Adolescentes homossexuais são vulneráveis a diferentes tipos de violência. A dificuldade de acesso aos serviços de saúde é um fator concorrente ao aumento da vulnerabilidade. A contribuição deste estudo reside na problematização de tópicos que podem auxiliar na construção do cuidado integral dos adolescentes homossexuais.

  9. Phlébotomes de Bolivie: V. Lutzomyia brisolai n.sp., nouvelle espèce de phlébotome anthropophile de région subandine (Diptera, Psychodidae

    Directory of Open Access Journals (Sweden)

    Francois Le Pont

    1987-09-01

    Full Text Available Les auteurs décrivent le mâle et la femelle d'une nouvelle espèce de phlébotome Lutzomyia brisolai n.sp., anthropophile, rencontrée dans plusieurs stations du piémont andin. Cette espèce, difficile à classer, présente des caractères l'apparentant à L. oliveirai et L. minasensis mais aussi aux espèces du sous-genre Nyssomyia.

  10. Biologie, éco-éthologie et dynamique des populations du scolyte des grains de café, Hypothenemus hampei Ferr. (Coleoptera, Scolytidae), en Nouvelle-Calédonie

    OpenAIRE

    Giordanengo, Philippe

    1992-01-01

    Séminivore strictement monophage, #Hypothenemus hampei$ Ferr. (#Coleoptera, Scolytidae$) est l'ennemi majeur de la caféiculture en Nouvelle-Calédonie. L'accouplement qui a lieu dans la graine d'émergence est facilité par l'intervention de signaux, de nature vraisemblablement olfactive, émis par les femelles. Environ douze jours après leur émergence, ces dernières quittent leur baie d'éclosion à l'issue d'une inversion de leurs comportements phototropique et thigmotactique. La dispersion qui s...

  11. DAYA SAING DAN STRATEGI PENGEMBANGAN MINYAK SAWIT DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Jauhar Samudera Nayantakaningtyas

    2012-11-01

    Full Text Available ABSTRACTThe aims of this study were to analyze the competitiveness of Indonesian Crude palm oil CPO products in the international market and to analyze the strategy to improve the competitiveness of Indonesian CPO. The analysis methods used this research were descriptive qualitative methods. The tools used to analyze the competitiveness of palm oil is Revealed Comparative Advantages and Porter Diamond Theory, while the development of the strategy used to determine the SWOT method. Based on the analysis of Porter's Diamond System and revealed comparative advantages, this study concluded that the competitiveness of Indonesian CPO was pretty strong, but it still needed a strategy to strengthen its competitiveness especially on derivative products. Some of the routine strategies that need to be done every year, are the development of the CPO industry human resources through training and innovation activities, paying attention to national and international issues by improving government policies, downstream industrial development and palm oil value-added increase, enhance cooperation with manufacturers from other countries through promotions.Keywords: crude palm oil, competitiveness, strategy, analysis of porter's diamondABSTRAKTujuan penelitian ini adalah menganalisis daya saing produk Crude Palm Oil (CPO Indonesia di pasar internasional dan menganalisis strategi peningkatan daya saing CPO Indonesia. Metode pengolahan dan analisis data yang digunakan dalam penelitian ini adalah metode deskriptif kualitatif. Alat  yang digunakan untuk menganalisis daya saing minyak sawit  adalah Revealed Comparative Advantages dan Teori Berlian Porter, sedangkan untuk mengetahui strategi pengembangan digunakan metode SWOT. Hasil analisis Sistem Berlian Porter dan revealed comparative advantages disimpulkan bahwa daya saing CPO Indonesia cukup kuat, namun masih diperlukan adanya strategi untuk memperkuat terutama pada produk turunan CPO. Strategi rutin yang harus

  12. O Direito à Saúde no Sistema Prisional

    Directory of Open Access Journals (Sweden)

    Gabrielle Jacobi KOLLING

    2013-04-01

    Full Text Available O direito à saúde é objeto de constante análise e, a cada momento, visualiza-se a necessidade de enfrentar diferentes interfaces desse direito fundamental. A complexidade inerente ao sistema social, e, por conseguinte, ao da saúde também, demanda-nos romper com a classificação de cidadãos de primeira e de segunda classe; isso não é republicano, tampouco democrático. A lógica dos desumanizados e excluídos (esquecidos e negligenciados deve ser cambiada pela lógica da inclusão. A análise enfocará a saúde no sistema prisional. Para isso, é condição de possibilidade analisarmos os condicionantes de saúde e os seus efeitos no panorama prisional-sanitário brasileiro. Observaremos, ainda, as ações governamentais para efetivar o direito à saúde no sistema prisional, em especial a Política Pública de Saúde “Plano Nacional de Saúde no Sistema Penitenciário”, que se apresenta como uma tentativa concreta de romper com a negligência do Estado em relação aos integrantes do sistema prisional, aos esquecidos, aos sem voz. ABSTRACT The right to health is matter of constant analysis and, at each moment the need to challenge the different interfaces of this basic right is visible. The innate complexity of the social system and, by consequence to the health system as well, demands that we break with the concept of first and second class citizens; this is not republican or even democratic. The de-humanized and excluded logic (forgotten and neglected must be traded for the inclusion logic. The analysis will focus the prison system’s health. For this is condition of possibility to analyze the health conditions and its effects in the Brazilian prison-sanitary scope. We will also observe the government’s actions to make the right to heath effective in the prison system, in special the Public Health Policy “Nacional Health Plan in the Prison System”, which is presented as a real attempt to break with the state’s negligence

  13. Caso Ouro Fino Saúde Animal Caso Ouro Fino Saúde Animal Ouro Fino Saúde Animal case

    Directory of Open Access Journals (Sweden)

    Bernardo Hauch Ribeiro de Castro

    2012-04-01

    Full Text Available O Caso Ouro Fino Saúde Animal ilustra uma tomada de decisão, pelos executivos da empresa, sobre a entrada em um novo mercado, de vacinas para bovinos. Diante da necessidade de dar um passo maior em direção ao crescimento sustentável, a empresa não poderia deixar de entrar nesse segmento, que representava mais de metade do mercado brasileiro de produtos veterinários. No entanto, era um passo arriscado. A principal questão do caso é avaliar as alternativas de comprar vacinas de terceiros ou produzir internamente suas próprias vacinas. A empresa do caso é a Ouro Fino Saúde Animal, empresa brasileira de produtos veterinários, instalada no Estado de São Paulo, com faturamento de mais de R$ 100 milhões anuais. Os dois principais personagens deste caso são os diretores financeiro e industrial da empresa. A situação passa-se em 2005. Como instrumento de ensino, o caso foi concebido para o ensino de estratégia em cursos de pós-graduação em administração, levando os alunos a avaliar vantagens e desvantagens de cada uma das alternativas. Como objetivo secundário, o caso propicia alguns elementos para uma estimativa da viabilidade financeira da opção de implantar uma nova unidade produtiva e a possibilidade de refletir sobre uma decisão já tomada, de entrada no novo mercado. Por fim, o caso traz uma série de informações sobre o mercado brasileiro e sobre o mercado mundial de produtos veterinários. É possível, com base nestes dados, trabalhar questões ligadas à segmentação e posicionamento da empresa no setor, ficando a critério do professor este tipo de uso.El Caso Ouro Fino Saúde Animal ilustra una toma de decisiones por los ejecutivos de la empresa, a la entrada en un nuevo mercado de las vacunas para el ganado. Ante la necesidad de dar un paso importante hacia el crecimiento sostenible, Ouro Fino Saúde Animal no podía dejar de entrar, ya que representaba más de la mitad del mercado de productos veterinarios

  14. Level of Need for Cognition and Metacognitive Thinking among Undergraduate Kindergarten Female Students at King Sa'ud University in Sa'udi Arabia

    Science.gov (United States)

    Daghistani, Bulquees

    2015-01-01

    This study aims at examining the level of need for cognition and metacognitive thinking among undergraduate kindergarten female students in Education Faculty at King Sa'ud University in Sa'udi Arabia from their own perceptions. Results showed that the need for the cognition level was moderate, but metacognitive thinking level was high. In…

  15. Grupo PET-Saúde/Vigilância em Saúde do Trabalhador Portuário: vivência compartilhada

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Ferreira Queiróz

    2015-12-01

    Full Text Available Trata-se de um relato de vivência compartilhada do Grupo PET-Saúde/ Vigilância em Saúde do Trabalhador Portuário, da Universidade Federal de São Paulo – Unifesp e o Centro de Referência em Saúde do Trabalhador – CEREST, de Santos, SP. O objetivo é descrever a experiência desse grupo tutorial e sua contribuição para o fortalecimento de ações de vigilância em saúde do trabalhador de Santos. O trabalho portuário é a temática do PET-Saúde por sua importância no cenário nacional e por sofrer transformações que geram fatores de agravos à saúde dos trabalhadores. As ações são desenvolvidas englobando o CEREST, os serviços da rede de saúde de Santos e a comunidade portuária santista. Observa-se que os participantes têm compartilhado conhecimento teórico e prático profissional, contribuindo nas ações dos trabalhadores do CEREST e apontando na direção de aproximação com a rede básica de atenção à saúde.

  16. 认识SA8000更要关注ISO26000%Concerned on SA 8000, and Focused on ISO 26000 Further

    Institute of Scientific and Technical Information of China (English)

    张振明

    2006-01-01

    @@ 近年来,在我国形成来势凶猛的SA 8000运动浪潮,特别是2004年初,国内部分媒体的相关报道铺天盖地,各种收费培训班或专题讲座火爆异常,一时间人们谈及社会责任,言必称SA 8000,笔者同年6月参加在深圳举办的SA 8000专题讲座,授课人甚至称SA 8000是国际标准,似乎SA 8000就是社会责任的代名词.

  17. DAYA SAING PRODUK TURUNAN SUSU INDONESIA DI PASAR DUNIA

    Directory of Open Access Journals (Sweden)

    Lina Yanti

    2012-06-01

    Full Text Available ABSTRACTThis research purposes were (1 to measures the competitiveness of Indonesian milk derivative product in international market based on its comparative advantage, (2 to analyze the dynamics of Indonesian milk and also to analyze the commodity’s competitive position in the international market through its dynamic export product performance, (3 to analyze dominant factors that influencing Indonesian dairy export growth based on constant market share analysis. The analysis methods used to measure the competitiveness of Indonesian milk in this research are based on revealed comparative advantage analysis, Export product dynamic analysis (EPD, and constant market share analysis. The result from RCA showed that the Indonesian milk derivative products which are Milk not concentrated nor sweetened 1–6% fat (HS 040120, Milk and cream, concentrated or sweetened (HS 0402 and Buttermilk, curdled milk, cream, kephir, etc (HS 040390 do not have comparative advantage but for Milk and cream powder unsweetened > 1,5%  fat (HS 040221, Milk and cream nes sweetened or concentrated (HS 040299 and Cereal, flour, starch, milk preparations and products (HS19 have comparative advantage. The EPD found that all Indonesian milk derivative products are included in the Rising Star position. The result test using CMS analysis concluded that the most significant factor which affect the export growth for Indonesian HS 040390 and HS 0402 derivative products are the import growth effect, HS 19 is mainly dominated by commodity composition effect, and the export growth for the rest derivative products are dominated with the competitiveness effect. Therefore, it needs to be implemented efforts to enhance the competitiveness of dairy derived products IndonesiaKeywords: milk, competitiveness, revealed comparative advantage (RCA, export product dynamic (EPD, constant market share analysis (CMSAABSTRAKPenelitian ini bertujuan (1 menganalisis daya saing komoditas susu

  18. Indutores de mudança na formação dos profissionais de saúde: pró-saúde e PET-SAÚDE

    Directory of Open Access Journals (Sweden)

    Isabel Cristina Luck Coelho de Holanda

    2012-12-01

    Full Text Available Na última década, a formação de profissionais de saúde tem sido reformulada no intuito de atender às necessidades de saúde das pessoas e não somente suas demandas. Políticas públicas de educação e saúde promovidas em parceria com o Ministério da Educação (MEC e o Ministério da Saúde (MS sinalizaram uma reforma curricular imprescindível nos cursos de graduação da área de saúde(1,2 .A formalização dessa mudança teve seu marco com a instituição das Diretrizes Curriculares Nacionais (DCN para os cursos de graduação no campo da saúde. Todos os instrumentos vigentes orientam a construção do perfil dos egressos por meio de um modelo acadêmico e profissional em que atitudes, habilidades e conteúdos almejem a formação generalista, humanista, crítica e reflexiva, com competência para a atuação em todos os níveis de atenção à saúde, embasando suas condutas nos rigores científico e ético(3-7.Não por acaso, todos os documentos ressaltam os mesmos campos de competência a serem desenvolvidos durante a formação dos diferentes profissionais da área: atenção à saúde, tomada de decisões, comunicação, liderança, educação permanente, administração e gerenciamento(3-7, pois a saúde, como um complexo campo de atuação, não consegue imprimir ações resolutivas através de uma única disciplina ou área do saber.A proposta preconizada pelo MEC e MS de produzir transformação nos processos de formação, trabalho e ampliação da cobertura dos serviços tem sido concretizada mediante programas indutores, como o Programa Nacional de Reorientação da Formação Profissional em Saúde (Pró-Saúde e o Programa de Educação pelo Trabalho para a Saúde (PET–Saúde(1,2.O Pró-Saúde, implementado no país desde 2005 através da divulgação de editais, pretende sintonizar a formação em saúde com as necessidades sociais, considerando as dimensões históricas, culturais e econômicas da população(8

  19. Desigualdades socioeconômicas na saúde

    Directory of Open Access Journals (Sweden)

    Diaz Maria Dolores M.

    2003-01-01

    Full Text Available Este artigo analisa as desigualdades socioeconômicas na área da saúde no Brasil, por meio da mensuração de índice de concentração para a variável autoavaliação do estado de saúde. Utilizou-se a base de dados originada pela Pesquisa Domiciliar sobre Padrões de Vida - PPV - realizada pelo IBGE no período de março/1996 a março/1997, em convênio com o Banco Mundial. Entre os principais resultados, deve-se destacar a constatação de que existem diferenças estatisticamente significativas entre índices calculados a partir de distintas variáveis caracterizadoras do nível socioeconômico dos indivíduos. Neste caso, em particular, os indicadores calculados a partir da classificação baseada na variável renda indicou, sistematicamente, a presença de desigualdades na saúde ligeiramente superiores àquelas identificadas a partir da utilização das despesas familiares. Constatou-se, ainda, que os resultados obtidos são bastante robustos em relação às distintas ponderações utilizadas na construção das escalas de equivalência entre os indivíduos. Todas as simulações realizadas revelaram a presença de desigualdades que favorecem os indivíduos pertencentes às camadas mais elevadas das escalas socioeconômicas adotadas.

  20. La RSE : nouvelle forme de dé-marchandisation du monde ? CSR: a new way of de-marchanisation of the world?

    Directory of Open Access Journals (Sweden)

    Richard Sobel

    2010-12-01

    Full Text Available Le mouvement dit de « RSE » entend concilier l’actuel mode d’accumulation à dominante financière avec certaines exigences sociales et environnementales. Or, ce mouvement s’inscrit assez bien dans l’analyse historique et institutionnaliste que Karl Polanyi a faite des limites de la marchandisation du monde. En effet, ce mouvement consiste à revenir sur la trop forte marchandisation du rapport à la nature et au travail qu’aurait entraîné le développement d’un capitalisme financiarisé. En réaction, ce mouvement mobilise l’engagement volontaire des entreprises pour bâtir une nouvelle « grande transformation », c’est-à-dire une forme inédite d’articulation entre le juste et l’efficace visant à assurer la viabilité du capitalisme. Cela revient à élargir l’engagement économique à autre chose que la simple maximisation des intérêts individuels de court terme. Cet article vise à exploiter cette proximité entre le mouvement de la RSE et l’analyse polanyienne de la marchandisation, proximité selon nous fructueuse et qui n’a jamais fait l’objet d’une analyse systématique. L’enjeu est de déterminer dans quelle mesure la RSE constitue aujourd’hui une réponse pertinente à la nécessaire gestion collective de la fiction que constitue la marchandisation apparente de la monnaie, de la terre et du travail.The movement says about "CSR" tries to reconcile the current financial mode of accumulation with certain social and environmental requirements. This movement joins well enough in the historic and institutionnalist analysis which Karl Polanyi made of the limits of marchandisation of the world. Indeed, this movement consists in returning on excess strong marchandisation of the relationship with the nature and with the work which would have pulled the new capitalism. In reaction, this movement mobilizes the individual commitment to build a new "great transformation", that is new articulation

  1. Littérature arabe en Israël : vers une sensibilité nouvelle Arabic Literature in Israel: Towards a New Sensibility ספרות ערבית בישראל

    Directory of Open Access Journals (Sweden)

    Sobhi Boustani

    2011-10-01

    Full Text Available La cause palestinienne chez les poètes arabes israéliens. Le présent article s’évertue à montrer les mouvements marquant l'évolution de la poésie arabe en Israël, dans un contexte contradictoire. Il souligne trois tendances principales. La première, explicitement militante, développée dans le giron de la Rakah, parti communiste israélien. Destinée à un public particulier et animée par une idéologie de combat, elle sacrifie parfois la poétique au profit de la politique. La deuxième tendance semble d'une nouvelle esthétique poétique basée sur l'individualité et l'expérience personnelle. La troisième voix poétique, profondément intimiste, est représentée par la poétesse Nida Khoury. Son approche de la résistance et du militantisme, ainsi que son approche originale de la langue révèle la profondeur d'une déchirure personnelle et la finesse d'un engagement subtilement exprimé.Enfin, le tiraillement intérieur entre deux appartenances et la recherche identitaire constituent l'un des principaux thèmes qui unissent les poètes de ces trois tendances.The present article focuses on showing the movements marking the evolution of Arabic poetry in Israel in a conflicting context. It points out three main tendencies. The first one, explicitly militant, developed in the lap of the Israeli communist party Rakah. Intended for a general public and animated by an ideology of fight, it sometimes sacrifices the poetics for the benefit of politics. The second tendency looks for a new poetic aesthetics based on individuality and personal experience. The third poetic voice, profoundly intimist, is represented by the poet Nidâ 'Khoury. Its approach of the resistance and the militancy as well as its original approach of the language reveal the depth of a personal tearing and the finesse of a subtly expressed commitment.Finally, the interior tugging between two belongings and the identical seeking constitute one of the main themes

  2. The rebranding of Electrica Soluziona SA - a case study

    Directory of Open Access Journals (Sweden)

    Monica GOMOESCU

    2016-07-01

    Full Text Available This article intends to present the design and implementation stages of a rebranding campaign that took place in the Electrica Soluziona SA company. The rebranding targets a company that provides consultancy services and software solutions and that underwent a change of its main shareholders structure, as it was taken over by Indra Group. After being taken over by Indra, Electrica Soluziona has considerably enlarged its product portfolio and the market segments targeted. Thus, it was mandatory to define a complex rebranding campaign. The rebranding process was not determined only by the broadening of activity, but also by the change of visual identity elements, along with the desire of repositioning.

  3. Genética, saúde e sociedade

    OpenAIRE

    2013-01-01

    O documentário apresenta quatro projetos de pesquisa realizados pelo Instituto de GenéticaMédica Populacional (INAGEMP) em diferentes regiões do país.As atividades mencionadasrepresentam uma amostra do trabalho do INAGEMP, que se estruturou de modo a colocar agenética médica populacional na prática ao associar pesquisa e atenção em saúde parapopulações afetadas por doenças com forte componente genético em sua etiologia.

  4. SA8000基本知识解读

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    1SA8000的含义 社会责任国际标准体系(Social Accountability 8000 Intemational standard,简称SAS000)是一种基于国际劳工组织宪章(ILO宪章)、联合国儿童权利公约、世界人权宣言而制定的,以保护劳动环境和条件、劳工权利等为主要内容的管理标准体系。

  5. SA8000基础知识解读

    Institute of Scientific and Technical Information of China (English)

    黎友焕

    2004-01-01

    社会责任国际标准体系(Social Ac-countability 8000 International slandard,简称SA8000)是一种基于国际劳工组织宪章(ILO宪章),联台国儿童权利公约,世界人权宣言而制定的.以保护劳动环境和条件、劳工权利等为主要内容的管理标准体系。

  6. Impacto de ingrediente funcional sobre a saúde intestinal

    OpenAIRE

    Gabriela Santos Souza

    2014-01-01

    O microbioma intestinal influencia de maneira positiva e/ou negativa o bem estar e o equilíbrio da saúde no organismo humano. Carboidratos não disponíveis, tais como frutanos e amido resistente (encontrado na farinha de banana verde), são ingredientes funcionais que resistem à digestão, estimulam o peristaltismo e o trânsito intestinal, e podem aumentar população de bactérias benéficas. O presente estudo teve como objetivo avaliar o impacto do consumo regular e descontinuado (durante 6 semana...

  7. Caso Molinos Roa S.A.: historia empresarial

    OpenAIRE

    2013-01-01

    Durante su trayectoria empresarial Molinos Roa S.A. ha enfocado sus estrategias gerenciales al logro de objetivos basados en principios y valores corporativos, por lo anterior el documento presenta el estudio de la historia empresarial, donde se da un reflejo de la pujanza y la visión de gestores y administradores. Sin embargo se analiza el impacto que trae en el negocio de la industria arrocera la firma de los tratados de libre comercio, así como el contrabando desmedido de este cereal y el ...

  8. Programa de Monitoreo Ambiental para Cementos Cienfuegos S.A

    OpenAIRE

    Mario A. Curbelo Hernández; José Luis Romero Cabrera; Henrry Ricardo Cabrera

    2012-01-01

    La presente investigación se realizó en las instalaciones de Cementos Cienfuegos S.A. Cuba, con el objetivo de diseñar e implementar un programa de monitoreo de las variables de concentración de polvo en aire, tasa de deposición y concentración de metales pesados, para la valoración de la calidad del aire a partir de índices establecidos en la norma NC ISO 111:2004. Este programa incluye también el monitoreo de los parámetr...

  9. Significado da massagem com aromaterapia em saúde mental

    OpenAIRE

    Domingos,Thiago da Silva; Braga,Eliana Mara

    2014-01-01

    Objetivo Compreender o significado da intervenção de massagem com aromaterapia em saúde mental para o usuário durante a internação psiquiátrica.Métodos Pesquisa qualitativa que incluiu 22 participantes com diagnóstico de Transtornos de Personalidade internados em unidade psiquiátrica de um hospital geral. Foram realizadas entrevistas semiestruturadas, com uma questão norteadora aos participantes, os quais se submeteram a intervenç...

  10. Percepção do processo saúde-doença: significados e valores da educação em saúde

    Directory of Open Access Journals (Sweden)

    Ana Maria Chagas Sette Câmara

    Full Text Available A relevância sociológica do estudo das representações sociais do processo saúde-doença está no fato de que elas fundamentam práticas e atitudes dos seus atores, assim como as relações que eles estabelecem com o seu contexto social e com aquilo que lhes acontece. O problema dessa pesquisa consiste em conhecer as representações sociais do processo saúde-doença dos profissionais do PSF, considerando que esse conhecimento pode ser fundamental para o desenvolvimento de práticas educativas em saúde. A abordagem metodológica desta pesquisa foi qualitativa, tendo por base as representações sociais dos profissionais de apoio e das equipes de saúde da família do Centro de Saúde Milionários, em Belo Horizonte, Minas Gerais. Para a coleta de dados, foi utilizada entrevista individual semi-estruturada abordando os seguintes aspectos: processo saúde-doença; educação em saúde; e barreiras ou dificuldades para prescrição/adoção de hábitos saudáveis. Os dados foram analisados pela técnica de análise de conteúdo, a partir das categorias: dimensões do processo saúde-doença; barreiras ou dificuldades para adoção de hábitos saudáveis; e significados e valores da educação em saúde. Os dados apontam que há necessidade de modificações conceituais na formação permanente desses profissionais e da inclusão do enfoque coletivo, abordando o conceito ampliado de saúde com seus determinantes sociais e contextuais. Faz-se necessária também a busca de novas metodologias de educação em saúde, para que os profissionais do PSF possam ir além da informação e consigam a ressignificação dos conceitos do processo saúde-doença, podendo de fato estabelecer novas práticas e novos processos de trabalho em saúde.

  11. Le train au féminin dans la nouvelle “Viens, ma Brune” de l’écrivaine mexicaine Elena Poniatowska

    OpenAIRE

    Lavoie, Sophie

    2013-01-01

    Dans le récit Viens ma brune, l’auteur mexicain Elena Poniatowska décrit les relations très complexes entre un cheminot et sa locomotive à vapeur. Par une comparaison habile, l’écrivain crée un parallèle entre cet attachement et les comportements machistes ancrés dans la société mexicaine, et les remet en question tacitement à travers une association originale de la femme et de la locomotive. En el relato Viens ma brune, la autora mexicana Elena Poniatowska describe las complejas relacione...

  12. Psicologia da saúde crítica no contexto hospitalar

    Directory of Open Access Journals (Sweden)

    Denis Barros de Carvalho

    Full Text Available O texto apresenta uma discussão sobre a Psicologia da saúde no contexto hospitalar a partir de uma perspectiva histórica e ética, mostrando como o desenvolvimento desse campo foi caracterizado pelo surgimento de duas perspectivas: a Psicologia da saúde tradicional e a Psicologia da saúde crítica. O modelo de quatro abordagens à Psicologia da saúde é apresentado e reformulado com a inclusão do conceito de Psicologia sanitária, e a prática em Psicologia da saúde é discutida à luz do conceito de reflexividade. Por fim, alguns questionamentos derivados da Psicologia da saúde crítica são feitos à prática do psicólogo no contexto hospitalar.

  13. Reflexões sobre o papel das unidades de economia da saúde no âmbito de sistemas nacionais de saúde

    Directory of Open Access Journals (Sweden)

    Fabiola Sulpino Vieira

    Full Text Available Resumo O objetivo deste texto é apresentar algumas reflexões sobre o papel e a relevância das unidades de economia da saúde (UES no âmbito de sistemas nacionais de saúde. Parte-se dos fundamentos deste campo de conhecimento e de sua contribuição à gestão em saúde para tecer considerações sobre o papel e a relevância dessas unidades. São discutidas questões como o conhecimento dos gestores da saúde e lideranças políticas sobre economia da saúde, a necessidade de atuação transversal da UES na organização e de corpo técnico multidisciplinar qualificado, assim como a natureza técnica e política do trabalho, as possibilidades e limites para sua atuação, seus aspectos e a relação com grupos externos de pesquisa. Por fim, ressalta-se que o trabalho de equipe interna especializada em economia da saúde constitui um dos meios para qualificar o processo de tomada de decisão nas organizações públicas de saúde, visando à otimização do uso dos recursos e à equidade em sua alocação.

  14. Contribuições do PET-Saúde/Redes de Atenção Psicossocial à Saúde da Família

    Directory of Open Access Journals (Sweden)

    Larissa de Almeida Rézio

    2015-12-01

    Full Text Available O estudo objetivou analisar as contribuições do Programa de Educação pelo Trabalho para a Saúde – PET-Saúde/Redes de Atenção Psicossocial à Saúde - a uma unidade de Estratégia de Saúde da Família em Cuiabá, Mato Grosso, Brasil. Trata-se de um estudo descritivo, com abordagem qualitativa, utilizando entrevista com cinco profissionais de saúde e dois acadêmicos bolsistas e registros de atividades realizadas no serviço. À luz da análise de conteúdo temática, sistematizamos quatro subtemas: “articulação da rede”; “qualificação da assistência à saúde mental”, “melhora do conhecimento dos profissionais” e “superação de estigmas sobre o paciente em sofrimento psíquico”. Houve sensibilização dos profissionais e bolsistas sobre a importância do acompanhamento das pessoas com sofrimento mental na atenção básica, em articulação com serviços de saúde mental.

  15. Joint Service Aircrew Mask (JSAM) - Strategic Aircraft (SA): Noise Attenuation Performance

    Science.gov (United States)

    2015-08-25

    AFRL-RH-WP-TP-2015-0026 Joint Service Aircrew Mask (JSAM) – Strategic Aircraft (SA): Noise Attenuation Performance...2015 – July 2015 4. TITLE AND SUBTITLE Joint Service Aircrew Mask (JSAM) – Strategic Aircraft (SA): Noise Attenuation Performance 5a. CONTRACT...determine if the Joint Service Aircrew Mask (JSAM) –Strategic Aircraft (SA) performance specification requirements were being met. The requirement stated

  16. Cuidados em saúde entre portadores de diabetes mellitus autorreferido no Brasil, Pesquisa Nacional de Saúde, 2013

    Directory of Open Access Journals (Sweden)

    Deborah Carvalho Malta

    2015-12-01

    Full Text Available Resumo: Objetivo: Descrever medidas do cuidado assistencial destinadas ao paciente com diabetes mellitus autorreferido no Brasil. Métodos: Foram utilizados dados da Pesquisa Nacional de Saúde(2013, estudo transversal de base populacional, referentes ao cuidado em saúde com o diabetes mellitus autorreferido, quanto ao uso de serviços de saúde e acesso a medicamentos. Resultados: A prevalência de diabetes mellitus autorreferido foi de 6,2%, e 11,5% da população nunca fez uma glicemia na vida. Dos adultos que referiram diabetes mellitus , 80,2% tomaram medicamentos nas duas semanas anteriores à entrevista, 57,4% usaram o Programa Farmácia Popular, 73,2% receberam assistência médica e 47,1% realizaram o atendimento nas Unidades Básicas de Saúde. Em 65,2%, o médico que atendeu na última consulta era o mesmo das consultas anteriores, 95,3% dos pacientes conseguiram realizar os exames complementares solicitados e 83,3% conseguiram fazer as consultas com o médico especialista. A avaliação de pés e olhos foi relatada por 35,6 e 29,1% dos portadores de diabetes mellitus , respectivamente. Relataram internação hospitalar por causa do diabetes ou de alguma complicação 13,4% dos adultos, e outros 7,0% relataram limitações nas atividades diárias. Em geral, mulheres, assim como a população mais idosa, de maior escolaridade, brancos e residentes nas regiões Sul e Sudeste, tiveram maior prevalência da doença e maior acesso aos serviços, medicamentos e consultas. Discussão: Os cuidados aos portadores de diabetes foram recebidos de forma adequada, na maioria dos casos, o que é essencial para manter a qualidade de vida dos pacientes e prevenir desfechos mais graves.

  17. Altera – Technical update, presented by Sascoholz SA

    CERN Multimedia

    FI Department

    2008-01-01

    Thursday 28 August 2008 From 9h00 to 12h00 (welcome at 08h45) in Room B (Main Building 61/1-009) SascoHolz SA cordially invites you to an informative and interesting technical update on the latest Altera FPGA developments. Introducing Altera’s Stratix IV Device Family 40-nm high-performance, high-end FPGAs with 8.5-Gbps transceiver option The Stratix IV FPGA family gives you the highest density, highest system performance, and the lowest power available in an FPGA, enabling innovation without compromise. Speaker Ole Horn, FAE Sascoholz Agenda Altera Stratix IV Device FamilyIntroduction Logic Fabric Architecture DSP Blocks Tri-Matrix Memory PLL and Clock Networks Design Security I/O Connectivity High-Speed Transceiver Low Power Consumption Language: English As a member of the globally active distribution group, Arrow Electronics, SascoHolz SA does more than just following the concepts of classic broadline distributors. In fact, we offer a depth of service throughou...

  18. Enredando lutas cotidianas: dispositivos de saúde pela cidade

    Directory of Open Access Journals (Sweden)

    Arielle Rocha de Oliveira Silva

    2009-12-01

    Full Text Available A partir das experiências de intervenções em serviços públicos de saúde e em outros setores da cidade, este trabalho afirma uma prática oficineira descentralizada capaz de compor na construção de redes sociais, servindo de instrumento de análise e possibilitando a invenção de modos de vida e afirmação de singularidades. As intervenções na cidade abrem caminhos para mudanças nos processos em curso e contribuem para a produção de saúde/cidadania por meio da potência conectiva das lutas. O enlace dessas temáticas visa ampliar o campo problemático da atenção psicossocial e fortalecer a luta antimanicomial no Espírito Santo, apostando em novas formas de atuação.

  19. New Young Star Candidates in CG4 and Sa101

    CERN Document Server

    Rebull, L M; Hoette, V; Kim, J S; Laine, S; Foster, M; Laher, R; Legassie, M; Mallory, C R; McCarron, K; Sherry, W H

    2011-01-01

    The CG4 and Sa101 regions together cover a region of ~0.5 square degree in the vicinity of a "cometary globule" that is part of the Gum Nebula. There are seven previously identified young stars in this region; we have searched for new young stars using mid- and far-infrared data (3.6 to 70 microns) from the Spitzer Space Telescope, combined with ground-based optical data and near-infrared data from the Two-Micron All-Sky Survey (2MASS). We find infrared excesses in all 6 of the previously identified young stars in our maps, and we identify 16 more candidate young stars based on apparent infrared excesses. Most (73%) of the new young stars are Class II objects. There is a tighter grouping of young stars and young star candidates in the Sa101 region, in contrast to the CG4 region, where there are fewer young stars and young star candidates, and they are more dispersed. Few likely young objects are found in the "fingers" of the dust being disturbed by the ionization front from the heart of the Gum Nebula.

  20. Magnetic field measurements of JT-60SA CS model coil

    Energy Technology Data Exchange (ETDEWEB)

    Obana, Tetsuhiro, E-mail: obana.tetsuhiro@LHD.nifs.ac.jp [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Takahata, Kazuya; Hamaguchi, Shinji; Chikaraishi, Hirotaka; Mito, Toshiyuki; Imagawa, Shinsaku [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Kizu, Kaname; Murakami, Haruyuki; Natsume, Kyohei; Yoshida, Kiyoshi [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)

    2015-01-15

    Highlights: • Magnetic fields of the JT-60SA CS model coil were measured. • While the coil current was held constant at 20 kA, magnetic fields varied slightly with several different long time constants. • We investigated coils consisting of CIC conductors and having long time constants. - Abstract: In a cold test of the JT-60SA CS model coil, which has a quad-pancake configuration consisting of a Nb{sub 3}Sn cable-in-conduit (CIC) conductor, magnetic fields were measured using Hall sensors. For a holding coil current of 20 kA, measured magnetic fields varied slightly with long time constants in the range 17–571 s, which was much longer than the time constant derived from a measurement using a short straight sample. To validate the measurements, the magnetic fields of the model coil were calculated using a computational model representing the positions of Nb{sub 3}Sn strands inside the CIC conductor. The calculated results were in good agreement with the measurements. Consequently, the validity of the magnetic field measurements was confirmed. Next, we investigated other coils consisting of CIC conductors and having long time constants. The only commonality among the coils was the use of CIC conductors. At present, there is no obvious way to prevent generation of such magnetic-field variations with long time constants.

  1. Finite element analysis of (SA) mechanoreceptors in tactile sensing application

    Science.gov (United States)

    N, Syamimi; Yahud, S.

    2015-05-01

    This paper addresses the structural design of a fingertip model in order to analyse the sensory function of slow adapting (SA) mechanoreceptors by using the finite element analysis (FEA) method. A biologically inspired tactile sensor was designed to mimic a similar response of the human mechanoreceptors in the human glabrous skin. The simulation work was done by using COMSOL Multiphysics. The artificial skin was modelled as a solid square block of silicone elastomer with a semi cylinder protrusion on top. It was modelled as a nearly incompressible and linear hyperelastic material defined by Neo Hookean constitutive law. The sensing element on the other hand was modelled by using constantan alloy mimicking the SA1 receptor. Boundary loads of 1 N/m² to 4 N/m² with the increment of 1 N/m² were applied to the top surface of the protrusion in z and x-direction for normal and shear stress, respectively. The epidermal model base was constrained to maintain the same boundary conditions throughout all simulations. The changes of length experienced by the sensing element were calculated. The simulations result in terms of strain was identified. The simulated result was plotted in terms of sensing element strain against the boundary load and the graph should produce a linear response.

  2. Nas Trilhas (desconhecidas da saúde: a política pública de saúde para os homens no Brasil.

    Directory of Open Access Journals (Sweden)

    Marlene Neves Strey

    2012-11-01

    Full Text Available Neste estudo abordamos as diferentes formas de masculinidades e sua relação com a saúde, contempladas na Política de Atenção Integral à saúde do Homem (PNAISH implementada no Brasil no ano de 2009. Através de uma análise documental dessa política, pretendemos compreender os discursos masculinos que nela estão, bem como analisar a relação entre o discurso da política e as diferentes formas de produção de saúde. Devido a não estarem acostumados a se expor a um profissional de saúde, os homens sentem-se envergonhados, e além disso, atribuem sua baixa procura aos serviços de saúde, à falta de cuidados e escuta adequadas com um olhar de gênero que possa dar conta de suas demandas. Essa nova política de saúde para os homens criada no Brasil pretende atuar de maneira a atingir uma mudança cultural, que possibilite aos homens maior cuidado com sua saúde. Além disso, olhar para os modos de produção de masculinidades nos dias atuais e seus discursos sobre saúde é estar atento aos comportamentos que, devido à herança pautada nas diferenças entre os sexos, contribui para obstaculizar o acesso dos homens aos serviços de saúde.

  3. A política de saúde bucal em pauta no Conselho Municipal de Saúde no Município de Nova Friburgo - RJ

    Directory of Open Access Journals (Sweden)

    Rafael Gomes Ditterich

    Full Text Available Objetivo O presente estudo teve como objetivo analisar, por meio dos documentos técnicos do Conselho Municipal de Saúde (CMS, a organização dos serviços de saúde bucal no Município de Nova Friburgo - RJ, a partir da institucionalização da Política Nacional de Saúde Bucal. Metodologia Para a análise documental, utilizou-se o registro de frequência e categorização por assunto: saúde bucal das atas do CMS de junho/2006 a agosto/2011, do Plano Municipal de Saúde de 2003-2005 e 2010-2013, e os documentos encaminhados entre 2005 e 2011. Resultado Os registros analisados até 2012 indicaram que a população estava desassistida na questão da média complexidade, como também no acesso à água fluoretada. As equipes de saúde bucal ainda não tinham sido qualificadas e ampliadas, como é bem colocado como prioridade no Brasil Sorridente. O Município ainda não desenvolvia programas de prevenção e promoção de saúde bucal de forma contínua e efetiva. Conclusão Concluiu-se que a Política Nacional de Saúde Bucal, até o ano de 2012, não tinha ainda reflexo nas ações de saúde bucal em Nova Friburgo.

  4. Cobertura de Planos de Saúde na população brasileira, segundo a Pesquisa Nacional de Saúde, 2013

    Directory of Open Access Journals (Sweden)

    Deborah Carvalho Malta

    Full Text Available Resumo O objetivo do estudo é descrever as coberturas de planos de saúde no Brasil, conforme características sociodemográficas, a partir dos dados da Pesquisa Nacional de Saúde, realizada em 2013, e comparar com dados administrativos da Agencia Nacional de Saúde Suplementar para este mesmo ano. Foram utilizados dados da Pesquisa Nacional de Saúde e do Sistema de Informações de Beneficiários da Agência Nacional de Saúde para o ano de 2013. Foi descrita a cobertura dos planos de saúde segundo estratificação para Brasil, urbano/rural, Grandes Regiões, Unidades da Federação e Capitais, sexo, faixa etária, nível de instrução, posição na força de trabalho, cor/raça e estado de saúde. Como resultado, a proporção de pessoas que referiu ter algum plano de saúde no Brasil foi de 27,9% (IC95%: 27,1-28,8. Foi observada diferença significativa com relação a nível de instrução, sendo maior para os que referiram ter educação superior completa (68,8% IC95%: 67,2-70,4 e para aqueles que referiram ter ocupação (32,5% IC95%: 31,5-33,5. O aumento da cobertura de planos de saúde na população brasileira reflete a melhora da oferta de empregos e do crescimento da economia do país na época.

  5. Finance d'entreprise:voix nouvelles et nouvelles voies

    OpenAIRE

    Hélène Rainelli-Le Montagner

    2008-01-01

    (VF)Cet article examine les implications sur les recherches en finance d’entreprise du renouvellement récent des conceptions théoriques sur le fonctionnement des marchés financiers. En distinguant les approches issues de la finance comportementale de celles portées par les conventionnalistes ou par les tenants de l’utilisation des études sociales de la finance ou de la sociologie économique, le travail présenté ici permet d’identifier un certain nombre de perspectives pour les recherches futu...

  6. ANALISIS DAN MODEL STRATEGI PENINGKATAN DAYA SAING PRODUK EDAMAME BEKU

    Directory of Open Access Journals (Sweden)

    Sandryas Alief Kurniasanti

    2015-03-01

    penelitian ini adalah untuk menganalisis daya saing dan merumuskan prioritas alternatif strategi peningkatan daya saing produk edamame beku di PT MT 27. Metode yang digunakan dalam penelitian ini adalah Revealed Comparative Advantage untuk mengetahui kinerja ekspor dari produk edamame beku di pasar dunia, kemudian menganalisis faktor persaingan dengan menggunakan Diamond Porter’s Theory. Alternatif strategi dihasilkan dari analisis SWOT dan ditentukan prioritasnya dengan menggunakan analytical hierarchy process dari satu narasumber ahli. Hasil penelitian menunjukkan bahwa prioritas alternatif strategi peningkatan daya saing produk edamame beku PT MT 27 secara berurutan meliputi: (1 diversifikasi pasar, (2 diversifikasi produk, (3 meningkatkan kerjasama luar negeri, (4 pengembangan divisi Research and Development, (5 mengembangkan program Corporate Social Responsibility, (6 pengelolaan keuangan secara baik dan benar, serta (7 mengembangkan areal pertanian yang berbasis rumah kaca untuk menghindari cuaca buruk karena beriklim tropis. Implikasi Manajerial dari penelitian ini adalah mengembangkan pasar yang sudah ada, dan mengembangkan jenis produk yang diproduksi untuk memenuhi selera pasar ekspor dan juga penghematan biaya produksi. Kata kunci: daya saing, edamame beku, Mitratani Dua Tujuh, strategi daya saing

  7. The visualization of DHSI based on the relationship model of CL and SA

    Science.gov (United States)

    Wang, Haibo; Guo, Huijuan; Xue, Chengqi

    2013-03-01

    The source and cause of cognitive load (CL) and situation awareness (SA) in digital human-system interface (DHSI) is explained. Based on the analysis of cognitive procedure and the relation of CL and SA, The relationship model of CL and SA in DHSI is put forward. Using the association target and the relationship model of CL and SA, the method and strategy of information visualization of DHSI is presented which is based on the cognitive psychology. Selecting the Boeing 757 autopilot as the case, the comparison of design is shown.

  8. Software reference for SaTool - a Tool for Structural Analysis of Automated Systems

    DEFF Research Database (Denmark)

    Lorentzen, Torsten; Blanke, Mogens

    2004-01-01

    This software reference details the functions of SaTool – a tool for structural analysis of technical systems. SaTool is intended used as part of an industrial systems design cycle. Structural analysis is a graph-based technique where principal relations between variables express the system...... of the graph. SaTool makes analysis of the structure graph to provide knowledge about fundamental properties of the system in normal and faulty conditions. Salient features of SaTool include rapid analysis of possibility to diagnose faults and ability to make autonomous recovery should faults occur....

  9. A participação do enfermeiro de saúde pública na saúde familiar

    Directory of Open Access Journals (Sweden)

    Zélia Sena Costa

    1986-09-01

    Full Text Available As autoras partem do pressuposto de que o avanço da epidemiologia tem demonstrado que muitas enfermidades estão associadas a determinadas estruturas sociais. Face a um enfoque científico, humanístico e personalizado, o Enfermeiro tem conquistado um papel de destaque junto à família, uma vez que este grupo social se constitui em uma via estratégica para utilização de parâmetros psicossocias tendo em vista a função básica de ajuda e apoio. Considerando que a contribuição do Enfermeiro de Saúde Pública é de vital importância para a melhoria do nível de saúde familiar, concluem que existe uma necessidade premente da aplicação adequada do Processo de Enfermagem a nível familiar, propondo a inserção da concepção - unidade familiar - como princípio básico da Assistência de Enfermagem.

  10. Nouvelles conversations avec Jacques Fontanille

    OpenAIRE

    2015-01-01

    Cette interview réalisée de février à mai 2014 aborde les développements les plus récents de l’œuvre de Jacques Fontanille, sémioticien français qui est une des figures phares de la sémiotique européenne. Ici le sémioticien fait le point sur la sémiotique des pratiques et sur le concept de formes de vie, sujet de son dernier ouvrage encore inédit. Au cours de ces conversations, qui prolongent celles réalisées en 2006 (PORTELA, 2006), Fontanille parle de la situation actuelle de la ...

  11. Bangalore, ville des nouvelles technologies

    Directory of Open Access Journals (Sweden)

    Clarisse Didelon

    2003-06-01

    Full Text Available Bangalore est devenue la Silicon Valley de l’Inde. Une partie de ses habitants y vit à l’occidentale mais le reste de la population souffre de la croissance spectaculaire de la ville. Face à l’insuffisance des infrastructures, Bangalore devient de moins en moins attractive pour les entreprises internationales.

  12. O conceito de saúde The health's concept

    Directory of Open Access Journals (Sweden)

    Marco Segre

    1997-10-01

    Full Text Available Questiona-se a atual definição de saúde da Organização Mundial da Saúde: "situação de perfeito bem-estar físico, mental e social" da pessoa, considerada ultrapassada, primeiramente, por visar a uma perfeição inatingível, atentando-se as próprias características da personalidade. Menciona-se como principal sustentação dessa idéia, a renúncia necessária a parte da liberdade pulsional do homem, em troca da menor insegurança propiciada pelo convívio social. Discute-se a validade da distincão entre soma, psique e sociedade, esposando o conceito de homem "integrado", e registrando situações em que a interação entre os três aspectos citados é absolutamente cristalina. É revista a noção de qualidade de vida sob um vértice antipositivista. Essa priorização e proposta de resgate do subjetivismo, reverte a um questionamento da atual definição de saúde, toda ela embasada em avaliações externas, "objetivas", dessa situação.Objections to the present WHO (World Health Organization definition of HEALTH, as "the state of perfect physical, mental and social well-being", are expressed. It is considered to be anachronistic, first because it aims at perfection which is unaltainelle because of distict personality characteristics. As the main support for this idea, the necessary renunciation of part of man's drive to liberty in exchange for the lesser insecurity provided by social life (Freud, Castoriadis and Mc Dougall, is groted. The validity of distinguishing between "soma", "psyche" and "society" is questioned and the concept of the "integrated man", alluding to Pierre Marty and to Freud himself is adapted, and situations are recalled in which the interaction of the three aspects mentioned above is actually evident. Finally, the notion of the quality of life, in accordance with an antipositivistic taken from Bion, point of view, is discussed, and the concept that reality is that of each human being, is adapted. This

  13. Comunicação entre usuários e trabalhadores de saúde em colegiados de Saúde da Família

    Directory of Open Access Journals (Sweden)

    Marcelen Palu Longhi

    2013-02-01

    Full Text Available Atualmente, têm sido observados problemas relativos à comunicação nos fóruns de participação social da saúde. O presente estudo tem o objetivo de analisar a comunicação entre usuários e trabalhadores de saúde, em colegiados da Saúde da Família. O referencial teórico utilizado foi a Teoria da Ação Comunicativa de Habermas. Realizou-se uma pesquisa qualitativa. Os dados coletados revelaram duas dimensões que se entrelaçavam: distanciamentos e aproximações entre usuários e trabalhadores de saúde. Quanto aos distanciamentos, destacaram-se a presença de relações assimétricas, de coerção e de manipulação por parte dos trabalhadores de saúde, processos que prejudicam a participação dos usuários. Por outro lado, estiveram presentes momentos de interação e lutas por direitos, abordados nas aproximações entre usuários e trabalhadores de saúde. Por fim, consideramos que a comunicação nos colegiados da Saúde da Família apresenta potencialidades e limites, sendo que estes devem ser problematizados, especialmente, por meio da educação permanente em saúde.

  14. Editorial challenges of the Revista de Saúde Pública.

    Science.gov (United States)

    Antunes, José Leopoldo Ferreira; França Júnior, Ivan; de Andrade, Maria Teresinha Dias; Barata, Rita de Cássia Barradas; Monteiro, Carlos Augusto

    2015-07-01

    The editors of the Revista de Saúde Pública describe the journal's editorial profile and discuss the challenges of scientific publication in the area. A historical overview of almost 50 years of the journal is reported, with the temporal projection of their bibliometric indicators. Qualitative and quantitative parameters of its editorial profile and indexes are also reported. Budget constraints and the actions being taken to address them are discussed. The difficulty in allocating reviewers for manuscripts submitted to the editorial process is also discussed; an issue that affects scientific publication in many areas of knowledge. In particular, we sought to reflect on the proposal of measures to boost the editorial process by alleviating the shortage of reviewers and their possible harmful consequences for the editorial process.

  15. Impacto da microbiota intestinal na saúde mental

    OpenAIRE

    Landeiro, Joana Almeida Vilão Raposo

    2016-01-01

    Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz A microbiota intestinal consiste no conjunto de microrganismos residentes no intestino humano e que é responsável pela execução de diversas funções, sendo essencial para a manutenção da homeostase. Esta encontra-se em comunicação com o sistema nervoso central através do eixo intestino-cérebro, sendo esta comunicação bidirecional. Vários estudos têm revelado que a microbiota intestinal influenc...

  16. STRATEGI PENINGKATAN DAYA SAING RUMAH POTONG AYAM PT XYZ

    Directory of Open Access Journals (Sweden)

    Arli Arli

    2012-07-01

    chicken-based food company in Indonesia.Keywords:  competitiveness, global value chain, poultry slaughterhouse, PT XYZABSTRAKTujuan penelitian ini adalah (1 menganalisis peran aktor-aktor di dalam rantai nilai Rumah Potong Ayam (RPA PT XYZ  yang berpengaruh terhadap daya saingnya, (2 menganalisis para pemain kunci dalam stakeholders RPA PT XYZ , (3 menganalisis faktor-faktor internal dan eksternal (IE yang berpengaruh terhadap daya saing RPA PT XYZ , (4 memformulasikan tujuan dan sasaran jangka panjang strategik untuk meningkatkan daya saing RPA PT XYZ , (5 menganalisis alternatif dan prioritas strategi untuk meningkatkan daya saing RPA PT XYZ . Metode yang digunakan adalah analisis deskriptif. Analisis yang digunakan adalah global value chain, analisis stakeholder, internal factor evaluation, external factor evaluation, matriks IE, SWOT, dan quantitative strategic planning matrix. Hasil dari analisis global value chain, analisis stakeholders, analisis internal dan eksternal, dan visi-misi perusahaan, tujuan jangka panjang adalah (a menyediakan nilai tambah bagi pelanggan, (b memaksimalkan laba dari hasil operasi bisnis, (c meningkatkan kesejahteraan stakeholders, (d melakukan kegiatan sustainable business. Hasil matriks IE dan analisis SWOT, strategi untuk mencapai sasaran dan tujuan jangka panjang strategik adalah (a meningkatkan efektivitas dan efisiensi manajemen rantai pasok; (b mengimplementasikan evaluasi kinerja untuk pegawai dan partner bisnis; (c memperkuat  citra sebagai perusahaan domestik penghasil makanan olahan berbasis daging ayam berkualitas tinggi di Indonesia; (d meningkatkan kegiatan penelitian dan pengembangan; (e membangun aliansi strategik dengan pemasok ayam hidup eksternal; (f melakukan sosialisasi mengenai pentingnya konsumsi protein hewani kepada masyarakat Indonesia. Tiga strategi prioritas dari analisis QSPM adalah meningkatkan efektivitas dan efisiensi rantai pasok, mengimplementasikan evaluasi kinerja untuk pegawai dan partner bisnis, dan

  17. Saúde mental: reconstruindo saberes em enfermagem

    Directory of Open Access Journals (Sweden)

    Francisca Bezerra de Oliveira

    2003-02-01

    Full Text Available O manicômio, apesar de criticado, reformado ou mesmo negado, ainda é uma prática preponderante no cuidado às pessoas com transtornos mentais. Tal prática tem como princípio básico o isolamento do doente mental, contrariando todas as possibilidades de assistência centrada num humanismo ético. Este ensaio procura interpretar a institucionalização do asilo, da psiquiatria, da doença mental e o processo da reforma psiquiátrica, buscando contribuir para as reflexões acerca da desinstitucionalização e dos saberes e práticas de enfermagem em saúde mental.

  18. SalSA: A Teraton UHE Neutrino Detector

    Energy Technology Data Exchange (ETDEWEB)

    Reil, Kevin; /SLAC

    2006-04-19

    The observed spectrum of ultra-high energy cosmic rays virtually guarantees the presence of ultra-high energy neutrinos due to their interaction with the cosmic microwave background. Unlike cosmic rays, each of these neutrinos will point back directly to its source and will arrive at the Earth unattenuated, from sources perhaps as distant as z = 20. The neutrino telescopes currently under construction, should discover a handful of these events, probably too few for detailed study. This paper describes how an array of VHF and UHF antennas embedded in a large salt dome, SalSA (Salt dome Shower Array) promises to yield a teraton detector (> 500 km{sup 3 sr}) for contained neutrino events with energies above 10{sup 17} eV. Our simulations show that such a detector may observe several hundreds of these neutrinos over its lifetime with excellent angular resolution providing source locations.

  19. Teaching Computer System-DMT DESIGN(SA.1

    Directory of Open Access Journals (Sweden)

    A. O. Shteynberg

    2012-01-01

    Full Text Available Тhe paper introduces the training computer system of sub- agential type based on a didactic multidimensional technology. The methodology bases incorporate the systematic activity approach, some elements of artificial intelligence theory, and the instrumental didactic theory and technology developed by Scientific Experimental Laboratory at Bashkirsky State Pedagogical University. The above training system – Didactic Multidimensional Technology Design of Sub-Agential Type (DMT_DESIGN (SA.1 – has been developed for raising teachers’ technological competence and creativity regarding both the general and vocational education. Its training structure is specified by invariant socio-cultural and anthropological bases; logically semantic modeling of course materials is provided. The research data can be used by people, engaged in developing educational information technologies; practicing teachers; and post-graduates conducting research and implementing the findings. 

  20. 美国SA8000标准介绍

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    20世纪末期,欧洲、美国和澳大利亚都先后出现了一些关于“企业社会责任”的多边组织,并逐步形成了一些评价体系和认证制度。SA8000(Social Accoutability 8000的英文简称)是其中最有名的标准之一。企业社会责任是指企业在赚取利润的同时,主动承担对环境、社会和利益相关者的

  1. MENDORONG PASAR MODAL EFISIEN DAN BERDAYA SAING GLOBAL

    Directory of Open Access Journals (Sweden)

    Satia Nur Maharani

    2006-01-01

    Full Text Available Globalisasi semakin memperpendek jarak dan waktu. Kemampuannya mampu  merubah wajah planet bumi menjadi” just a small village “ melalui peningkatan ilmu pengetahuan dan teknologi. Perubahan tersebut bertransformasi pula pada  sistem ekonomi. Modal berdiri sendiri tanpa identitas dan siapa saja berhak untuk berinvestasi tanpa batas melalui sebuah mekanisme antar negara dan benua. Salah satu lintasan modal untuk meraih keuntungan adalah melalui mekanisme pasar modal. Pasar modal manakah yang diminati oleh arus modal masuk adalah pasar modal yang mampu memberikan jamuan terbaik berupa keuntungan yang tinggi dengan resiko yang optimal. Maka untuk mencapai pelayan yang maksimal bagi masyarakat pemodal , pasar modal harus efisien dan berdaya saing global. Maka keterbukaan informasi, peningkatan teknologi, efisiensi biaya penegakan hukum, partisipasi masyarakat dan pemerintah, inovasi produk mutlak untuk dievaluasi dan ditingkatkan

  2. 企业社会责任与SA8000

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    国际市场正逐渐认可的一种新兴的标准体系——SA8000(Social Accoutability 8000,社会责任标准8000),社会责任国际(Social Accountability International,简称SAI)是SA8000标准(即社会责任标准)的制订和执行机构,其前身为1997年成立的美国经济优先认可委员会(CEPAA),总都设在美国纽约,2001年该组织更改为现名。这个全球首个对企业进行道德规范的标准自1997年问世以来,受到了公众极大的关注,如同ISO9000、ISO14000、HACCP等标准体系,已成为国际市场的“通行证”。尽管国内对这个标准还有不同意见,但是通过规范的制度化的约束机制来推动企业社会责任建设,是一个必然的趋势。海尔集团首席执行官张瑞敏说;“责任和利润不是博弈关系。人们对百年老店做过调查,他们都倡导社会责任第一,利益、利润第二。”(以下中译文仅供参考)

  3. A música popular brasileira na construção do conhecimento em Saúde Pública: o tema processo de trabalho e saúde

    Directory of Open Access Journals (Sweden)

    José Augusto Pina

    2014-01-01

    Full Text Available Este estudo destaca temas relativos ao trabalho e à saúde na música popular brasileira, especialmente no samba. Tem como objetivo apresentar um corpo de conhecimentos sobre o tema processo de trabalho e saúde. Nas canções selecionadas foram identificadas categorias tomadas como ponto de partida para discussão com a literatura. Com o desenvolvimento do texto, percebe-se o manancial da canção popular para proporcionar conteúdos sobre múltiplas dimensões do processo de trabalho e do processo saúde-doença dos trabalhadores, inclusive a dimensão coletiva e histórica da luta pelo direito à saúde. Esta pesquisa resultou na valorização da música popular brasileira como uma forma de se entenderem as relações trabalho-saúde e de se desenvolver conhecimento em Saúde Coletiva.

  4. Saúde mental na Estratégia Saúde da Família: a avaliação de apoio matricial

    Directory of Open Access Journals (Sweden)

    Fernanda Barreto Mielke

    2010-12-01

    Full Text Available O objetivo deste artigo é avaliar o apoio matricial na perspectiva de 14 profissionais de uma unidade de saúde da família em um estudo avaliativo qualitativo realizado a partir da Avaliação de Quarta Geração. Os dados foram coletados por meio de observação e entrevistas e analisados pelo Método Comparativo Constante, enfocando a inclusão de ações de saúde mental na Estratégia Saúde da Família. Os profissionais das equipes estudadas avaliaram a necessidade de retaguarda assistencial e orientações técnicas de equipes especializadas em saúde mental para a realização de ações de saúde mental no território, o que poderia ser implementado por meio do apoio matricial. Avaliamos que este arranjo organizacional é importante na construção de ações de saúde mental no território.

  5. Homossexualidade e o direito à saúde: um desafio para as políticas públicas de saúde no Brasil

    Directory of Open Access Journals (Sweden)

    Grayce Alencar Albuquerque

    Full Text Available Objetivou-se evidenciar a atuação das políticas públicas direcionadas à saúde da população homossexual brasileira. Trata-se de uma revisão integrativa da literatura, realizada na Scientific Eletronic Library Online (SciELO e na Literatura Latino-Americana e do Caribe em Ciências da Saúde (Lilacs, utilizando os Decs: políticas públicas, assistência integral à saúde e homossexualidade. A saúde LGBT é apontada como vulnerável mesmo após a publicação de importantes documentos que garantem o acesso e a inclusão do grupo na saúde. A fragilidade na efetivação das propostas preconizadas vão ao encontro ao atendimento discriminatório e heteronormativo prestado pelos profissionais de saúde.

  6. 78 FR 5712 - Airworthiness Directives; CFM International, S.A. Turbofan Engines Modified by Supplemental Type...

    Science.gov (United States)

    2013-01-28

    ..., S.A. Turbofan Engines Modified by Supplemental Type Certificate SE00034EN AGENCY: Federal Aviation... directive (AD) for CFM International, S.A. CFM56-3, CFM56-3B, and CFM56-3C turbofan engines. This AD... of multiple turbine blades, damage to the engine, and damage to the airplane. DATES: This AD...

  7. Educação Popular e Saúde e democracia no Brasil

    Directory of Open Access Journals (Sweden)

    Eduardo Navarro Stotz

    2014-12-01

    Full Text Available O ensaio se propõe a entender os limites, as possibilidades e os desafios do controle social do Sistema Único de Saúde à luz de uma reflexão sobre a democracia no Brasil com base nas referências da Educação Popular e Saúde.

  8. Data of evolutionary structure change: 1O2SA-2FOHA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available entryIDChain>1O2SA SLNSG-----YHFCG >EEE ----- EE...ID>2FOH A 2FOHA SLQYRSGSSWAHTCG ...>EEEEEE EEE EEucture> ATOM 123 CA SER A 32 53....yIDChain>1O2SA PVVCS----GKLQG >EEEE ---- EEEE...LHCLVNGQYAVHG >EEEEEE EEEEEEe>

  9. Best Practices Case Study: S&A Homes, East Liberty, PIttsburgh, PA

    Energy Technology Data Exchange (ETDEWEB)

    None

    2010-12-01

    S&A Homes worked with Building America's IBACOS and architects Pfaffmann & Associates and Moss Associates to design energy-efficient homes for urban in-fill lots. This is a new market for S&A Homes, which builds over 500 homes a year using suburban designs.

  10. The Staphylococcus aureus Membrane Protein SA2056 Interacts with Peptidoglycan Synthesis Enzymes

    Directory of Open Access Journals (Sweden)

    Brigitte Berger-Bächi

    2013-01-01

    Full Text Available The yet uncharacterized membrane protein SA2056 belongs to the ubiquitous RND (Resistance-Nodulation-cell Division family of transmembrane efflux transporters. The sa2056 gene is located downstream of femX, the gene encoding the essential, non-ribosomal peptidyl-transferase adding the first glycine in the staphylococcal cell wall pentaglycine interpeptide. Due to its proximity to and weak co-transcription with femX, we assumed that sa2056 may somehow be involved in peptidoglycan synthesis. Specific antibodies against SA2056 showed that this protein is expressed during growth and present in the membrane fraction of cell preparations. Using a bacterial two hybrid system, SA2056 was shown to interact (i with itself, (ii with FemB, which adds glycines 4 and 5 to the peptidoglycan interpeptide and (iii with the essential penicillin binding proteins, PBP1 and PBP2, required for cell division and incorporation of the peptidoglycan into the cell wall. Unexpectedly, deletion of sa2056 led to no phenotype regarding growth, antibiotic resistances or cell morphology; nor did sa2056 deletion in combination with femB inactivation alter b-lactam and lysostaphin sensitivity and resistance, respectively, pointing to possible redundancy in the cell wall synthesis pathway. These results suggest an accessory role of SA2056 in S. aureus peptidoglycan synthesis, broadening the range of biological functions of RND proteins.

  11. Draft Genome Sequence of Ochrobactrum intermedium Strain SA148, a Plant Growth-Promoting Desert Rhizobacterium

    KAUST Repository

    Lafi, Feras Fawzi

    2017-03-03

    Ochrobactrum intermedium strain SA148 is a plant growth-promoting bacterium isolated from sandy soil in the Jizan area of Saudi Arabia. Here, we report the 4.9-Mb draft genome sequence of this strain, highlighting different pathways characteristic of plant growth promotion activity and environmental adaptation of SA148.

  12. Intersetorialidade na política de saúde do idoso

    Directory of Open Access Journals (Sweden)

    Grossi, Patricia Krieger

    2006-01-01

    Full Text Available Este artigo versa sobre a intersetorialidade na política de saúde do idoso. Apresenta uma discussão referente à conceituação e à construção da intersetorialidade. Aborda a saúde do idoso nos aspectos conceituais, legais e no enfrentamento de problemas concretos

  13. 77 FR 25644 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. Airplanes

    Science.gov (United States)

    2012-05-01

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira...) that apply to all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ 190 airplanes... information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A....

  14. 75 FR 47190 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135...

    Science.gov (United States)

    2010-08-05

    ...-212-AD; Amendment 39-16378; AD 2010-16-02] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135 Airplanes; and Empresa Brasileira de Aeronautica S.A..., 44701. Sec. 39.13 0 2. The FAA amends Sec. 39.13 by adding the following new AD: 2010-16-02...

  15. 75 FR 52263 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2010-08-25

    ...; AD 2010-18-04] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A... [Amended] 0 2. The FAA amends Sec. 39.13 by adding the following new AD: 2010-18-04 Empresa Brasileira de..., contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Technical Publications Section (PC 060),...

  16. 77 FR 36224 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2012-06-18

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135 airplanes, and Model EMB-145... information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A....

  17. 76 FR 27237 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2011-05-11

    ...-153-AD; Amendment 39-16684; AD 2011-10-03] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2011-10-03 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16684... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE, and -100...

  18. 78 FR 66258 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2013-11-05

    ...-194-AD; Amendment 39-17650; AD 2013-22-18] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... directive (AD) for certain Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135ER, - 135KE, -135KL... information identified in this AD, contact Empresa Brasileira de Aeronautica S.A. (EMBRAER),...

  19. 75 FR 260 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2010-01-05

    ...; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes; and Model ERJ 190-100 STD, -100... Friday, except Federal holidays. For service information identified in this proposed AD, contact Empresa... amends Sec. 39.13 by adding the following new AD: Empresa Brasileira de Aeronautica S.A....

  20. Une nouvelle lecture du Contre Colotès de Plutarque A New Reading of Plutarch's Against Colotes Una Nuova Lettura del Contro Colote di Plutarco

    Directory of Open Access Journals (Sweden)

    Pierre-Marie Morel

    2013-05-01

    Full Text Available Le Contre Colotès (Adversus Colotem de Plutarque est une œuvre à la fois singulière et fondamentale. Singulière par la complexité de sa structure : Plutarque s’attaque à un épicurien de stricte obédience, Colotès, en se référant non seulement au traité polémique que ce dernier avait composé contre les écoles philosophiques autres que celle d’Épicure, mais aussi aux textes des auteurs attaqués et aux propres positions du Maître du Jardin. ...

  1. Nouvelle approche métrique de l'épaule du genre Archaeolemur : caractéristiques morphologiques et myologiques1

    OpenAIRE

    2011-01-01

    L’insularité de Madagascar a permis à une faune endémique importante de se développer. Il existe notamment des lémuriens subfossiles, moins bien minéralisés que les fossiles. Ils sont beaucoup plus grands que les actuels et ont été retrouvés dans des sites du Quaternaire récent datés de 26 000 ans à 500 ans BP. Parmi ces lémuriens, il existe un genre particulier : Archaeolemur. La présente étude montre que sa position se rapproche plus des Indriidae que des Lemuridae actuels, notamment par de...

  2. 22 Des dialogues pour une nouvelle pensée théorique et critique sur le phénomène de la criminalisation du VIH

    Directory of Open Access Journals (Sweden)

    Christine Vézina

    2014-07-01

    Full Text Available Dans son état actuel, le droit criminel engendre des injustices et des incohérences qui sont documentées dans la littérature juridique et en sciences sociales. Alors que plus de 75 médecins se sont récemment regroupés pour adopter un énoncé de consensus destiné à promouvoir une application du droit conforme aux données probantes, nous proposons de dégager de nouvelles pistes de recherche en convoquant des chercheurs qui, en ayant développé des expertises théoriques et méthodologiques dans d’autres champs, peuvent contribuer à renouveler la réflexion critique en matière de criminalisation du VIH.

  3. Blandine Laperche, Anne-Marie Crétiéneau, Dimitri Uzunidis (dir., 2009, Développement durable : pour une nouvelle économie, P.I.E. Peter Lang, Bruxelles, 295 p.

    Directory of Open Access Journals (Sweden)

    Marc-Hubert Depret

    2010-05-01

    Full Text Available Cet ouvrage collectif, coordonné par Blandine Laperche, Anne-Marie Crétiéneau et Dimitri Uzunidis, fait suite au Forum de l’innovation III qui s’est tenu en 2008 à Poitiers sur le thème « Services, innovation et développement durable ». Il contient 12 contributions dont le point commun est de s’interroger sur les conditions et la faisabilité du passage à une nouvelle économie plus soutenable conciliant (selon la définition désormais consacrée à la fois, et sur le long terme, progrès économiq...

  4. A eterna busca da verdade em Die Lehrlinge zu Saïs, de Novalis

    Directory of Open Access Journals (Sweden)

    Natália Corrêa Porto Sanches Fadel

    2010-01-01

    Full Text Available The purpose of this essay is to undergo an investigation geared towards identifying the consolidation of the symbolized Upper or Ideal Truth illustrated by the figure of the goddess Saïs in the fragmentary novel Die Lehrlinge zu Saïs, from Novalis, written in 1801. As part of our approach, we traced a parallel between the allegorical use of Saïs myth by Novalis and in Schiller´s poem Das verschleierte Bild zu Saïs, aiming at a better characterization of Novalis' concept of the Ideal Truth. Lastly, we analyzed the fairy tale Hyazinth und Rosenblüte, which is part of the novel Die Lehrlinge zu Saïs, where it is possible to envisage the finding of the Ideal Truth searched by the poets of German Early Romanticism, especially by Novalis.

  5. An efficient hybrid evolutionary optimization algorithm based on PSO and SA for clustering

    Institute of Scientific and Technical Information of China (English)

    Taher NIKNAM; Babak AMIRI; Javad OLAMAEI; Ali AREFI

    2009-01-01

    The K-means algorithm is one of the most popular techniques in clustering. Nevertheless, the performance of the Kmeans algorithm depends highly on initial cluster centers and converges to local minima. This paper proposes a hybrid evolutionary programming based clustering algorithm, called PSO-SA, by combining particle swarm optimization (PSO) and simulated annealing (SA). The basic idea is to search around the global solution by SA and to increase the information exchange among particles using a mutation operator to escape local optima. Three datasets, Iris, Wisconsin Breast Cancer, and Riplcy's Glass, have been considered to show the effectiveness of the proposed clustering algorithm in providing optimal clusters. The simulation results show that the PSO-SA clustering algorithm not only has a better response but also converges more quickly than the K-means, PSO, and SA algorithms.

  6. Qualidade de vida relacionada à saúde de filhos de profissionais da área de saúde

    Directory of Open Access Journals (Sweden)

    Silvia Maria Moussi Gamallo

    2012-12-01

    Full Text Available Neste estudo mensuramos a qualidade de vida relacionada à saúde (QVRS e a fadiga de filhos de profissionais da área da saúde, com idades entre 2 e 11 anos, e avaliamos os hábitos diários e o sono dessas crianças e dos respectivos pais. Foram incluídas no estudo crianças de uma escola pública. Dados demográficos e dados de hábitos diários foram colhidos. A QVRS, o sono e a fadiga foram mensurados por questionários. Participaram 249 pais - 63,5% referiram sono adequado e 47,4% acordavam cansados. A média da idade das crianças foi 5,6 anos - 62,2% assistiam televisão no quarto, 50% usavam computador (> 4 horas/dia e 27,8% faziam atividades físicas extracurriculares. O escore do sono foi de 45,8 ± 12,2. Os escores de QVRS foram mais elevados no aspecto físico e mais baixos no emocional. Detectamos que o sono de pior qualidade dos filhos e dos pais pode estar relacionado à pior QVRS dos filhos. Concluímos que os hábitos inadequados dos pais, bem como das crianças, estão relacionados a uma diminuição da QVRS dos filhos, especialmente no aspecto emocional.

  7. Hortas comunitárias como atividade promotora de saúde: uma experiência em Unidades Básicas de Saúde

    Directory of Open Access Journals (Sweden)

    Christiane Gasparini Araújo Costa

    2015-10-01

    Full Text Available ResumoA agricultura urbana e periurbana (AUP vem sendo praticada em diferentes espaços, contribuindo para a melhoria da saúde nas comunidades e ambientes mais saudáveis. Objetivando identificar significados e repercussões da prática da AUP em Unidades Básicas de Saúde (UBS, enquanto uma atividade de Promoção da Saúde (PS, e em que medida sua dimensão terapêutica a caracteriza como uma atividade alinhada às práticas integrativas e complementares, foi realizado um estudo transversal com abordagem qualitativa no município de Embu das Artes, SP. Da análise, emergiram as seguintes categorias: concepção de saúde, resultados na saúde, resgate de práticas e hábitos tradicionais e reorientação dos serviços de saúde. Identificou-se a estreita ligação entre a prática das hortas e as diretrizes e campos de ação da PS como: criação de ambientes saudáveis, reforço da ação comunitária, desenvolvimento de habilidades pessoais, estímulo à autonomia e empoderamento e demandas por reorientação dos serviços. As atividades de horta instituídas nas UBS se mostraram uma estratégia de implementação das práticas integrativas e complementares (PIC. Conclui-se que as atividades de cultivo nas hortas comunitárias mostram-se como práticas promotoras da saúde que integram elementos fundamentais das PIC.

  8. Diretrizes Curriculares na saúde e as mudanças nos modelos de saúde e de educação

    Directory of Open Access Journals (Sweden)

    Carlos Otávio Fiúza Moreira

    2015-12-01

    Full Text Available Artigo produzido a partir de pesquisa bibliográfica e de questões formuladas para uma conferência no módulo “Educação na Saúde II” do Mestrado Profissional da Rede Nordeste de Formação em Saúde da Família. O texto discute questões dos campos da saúde e da educação relacionadas à emergência de novos modelos de saúde e de formação; analisa também as Diretrizes Curriculares Nacionais (DCN de três cursos da área da saúde (Medicina, Enfermagem e Odontologia como expressão desses novos modelos para saúde e para a educação. Uma questão transversal ao artigo são as relações entre os campos da saúde e da educação. Para isto, lança‑se mão do conceito de campo, desenvolvido pelo sociólogo Pierre Bourdieu. Considera‑se, ainda, o desafio de transformar as DCN em currículos e programas, ferramentas ou dispositivos necessários para fazer a passagem do que está prescrito para os cenários de ensino e aprendizagem.

  9. Vigilância ambiental em saúde e sua implantação no Sistema Único de Saúde

    Directory of Open Access Journals (Sweden)

    Christovam Barcellos

    2006-02-01

    Full Text Available A incorporação da vigilância ambiental no campo das políticas públicas de saúde é uma demanda relativamente recente no Brasil. Um dos principais desafios da vigilância ambiental em saúde é a definição do seu objeto e a especificidade de suas ações. O conceito ampliado de exposição, tratado não como um atributo da pessoa, mas do conjunto de relações complexas entre a sociedade e o ambiente, é central para a definição de indicadores e para a orientação da prática de vigilância ambiental. Entre as dificuldades encontradas para sua efetivação no Sistema Único de Saúde estão a necessidade de reestruturação das ações de vigilância em saúde e a formação de equipes multidisciplinares, com capacidade de diálogo com outros setores, além da construção de sistemas de informação capazes de auxiliar a análise de situações de saúde e a tomada de decisões. Nesse sentido, foi realizada uma revisão do objeto e conceitos da vigilância ambiental em saúde, bem como identificados os desafios para a sua implantação no Sistema Único de Saúde.

  10. Dinamičke simulacije solarnih kombi-sustava sa sezonskim sorpcijskim spremnikom topline: Utjecaj konfiguracije kombi-sustava.

    OpenAIRE

    Hennaut, Samuel; Thomas, Sébastien; Davin, Elisabeth; SKRYLNYK, Alexandre; Frere, Marc; Andre, Philippe

    2012-01-01

    Ovaj članak je fokusiran na dimenzioniranje solarnog kombi-sustava sa sezonskim adsorpcijskim spremnikom topline sa ciljem autonomnog solarnog grijanja prostora. Dvije konfiguracije kombi-sustava su simulirane, uključujući jedan ili dva toplinska spremnika. Utjecaj sezonskog skladištenja energije na dimenzioniranje spremnika je također diskutirano. Analiza je vršena simulacijom u programu TRNSYS. Rezultati analize pokazuju da je performansa sustava sa dva spremnika bolja (2 do 4% sa sezonskim...

  11. Antropologia no campo da saúde global

    Directory of Open Access Journals (Sweden)

    João Biehl

    2011-06-01

    Full Text Available Neste artigo, eu exploro os limites de abordagens baseadas em balas mágicas para os problemas de saúde global e mostro como as iniciativas centradas nas pessoas desafiam as ortodoxias econômicas e dos direitos humanos e ampliam nossa percepção daquilo que é socialmente possível e desejável. Utilizo o meu estudo etnográfico de longo prazo sobre a resposta terapêutica brasileira ao HIV/AIDS e suas repercussões nos âmbitos de governo, mercados, sistemas de saúde e vida pessoal. Faço também o relato de um novo projeto comparativo sobre as consequências de grandes intervenções farmacêuticas em contextos com recursos limitados. Considerando tanto os processos mais amplos quanto as singularidades humanas, o artigo abre uma janela crítica para os valores e os resultados de intervenções farmacêuticas e humanitárias contemporâneas na vida real. Ao criticar as práticas institucionais de produção de evidência, também reconsidero as noções de responsabilidade e cuidado dentro da antropologia e da medicina.In this article, I explore the limits of magic-bullet approaches to global health problems and show how people-centered initiatives challenge economic and human rights orthodoxies and enlarge our sense of what is socially possible and desirable. I draw from my long-term ethnographic study of the Brazilian therapeutic response to HIV/AIDS and its repercussions through government, markets, health systems and personal lives. I also report on a new comparative project on the aftermath of large-scale pharmaceutical interventions in resource-poor settings. Attending to both larger processes and to human singularities, the article opens a critical window into the values and the real-life outcomes of contemporary pharmaceutical and humanitarian interventions. As I critique institutional evidence-making practices I also reconsider anthropology and medicine's notions of responsibility and care.

  12. 75 FR 52238 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2010-08-25

    ...; AD 2010-18-01] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A... new AD: 2010-18-01 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16414. Docket No... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE, and -100...

  13. 76 FR 55781 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2011-09-09

    ...-16786; AD 2011-18-04] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A... the following new AD: 2011-18-04 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16786... to Empresa Brasileira de Aeronautica S.A. (EMBRAER) airplanes as identified in paragraphs (c)(1)...

  14. Saúde bucal coletiva: caminhos da odontologia sanitária à bucalidade

    Directory of Open Access Journals (Sweden)

    Narvai Paulo Capel

    2006-01-01

    Full Text Available O ensaio aborda o surgimento das primeiras atividades odontológicas sob responsabilidade do poder público no Brasil e sua evolução no século XX, enfatizando a emergência do marco referencial denominado odontologia sanitária. Caracteriza, sumariamente, a odontologia social e preventiva e a odontologia de mercado, indicando as principais publicações que se ocuparam dessas correntes. As características essenciais da saúde bucal coletiva e da bucalidade são apresentadas, tecendo-se considerações sobre a articulação da saúde bucal coletiva com a saúde coletiva. Discutem-se as implicações do conceito de bucalidade para a organização da prática odontológica e a necessidade de reorientação do trabalho clínico nos serviços de saúde bucal, no âmbito do Sistema Único de Saúde brasileiro. Indicam-se os elementos essenciais de uma agenda para a saúde bucal coletiva, com base nas proposições apresentadas na 3ª Conferência Nacional de Saúde Bucal.

  15. Sa-Lrp from Sulfolobus acidocaldarius is a versatile, glutamine-responsive, and architectural transcriptional regulator.

    Science.gov (United States)

    Vassart, Amelia; Van Wolferen, Marleen; Orell, Alvaro; Hong, Ye; Peeters, Eveline; Albers, Sonja-Verena; Charlier, Daniel

    2013-02-01

    Sa-Lrp is a member of the leucine-responsive regulatory protein (Lrp)-like family of transcriptional regulators in Sulfolobus acidocaldarius. Previously, we demonstrated the binding of Sa-Lrp to the control region of its own gene in vitro. However, the function and cofactor of Sa-Lrp remained an enigma. In this work, we demonstrate that glutamine is the cofactor of Sa-Lrp by inducing the formation of octamers and increasing the DNA-binding affinity and sequence specificity. In vitro protein-DNA interaction assays indicate that Sa-Lrp binds to promoter regions of genes with a variety of functions including ammonia assimilation, transcriptional control, and UV-induced pili synthesis. DNA binding occurs with a specific affinity for AT-rich binding sites, and the protein induces DNA bending and wrapping upon binding, indicating an architectural role of the regulator. Furthermore, by analyzing an Sa-lrp deletion mutant, we demonstrate that the protein affects transcription of some of the genes of which the promoter region is targeted and that it is an important determinant of the cellular aggregation phenotype. Taking all these results into account, we conclude that Sa-Lrp is a glutamine-responsive global transcriptional regulator with an additional architectural role.

  16. Práticas de cuidado à saúde de mulheres camponesas

    Directory of Open Access Journals (Sweden)

    Iraí Maria de Campos Teixeira

    2014-12-01

    Full Text Available O presente artigo apresenta resultados de pesquisa acerca de práticas de cuidado à saúde de mulheres camponesas do Assentamento Monte Alegre VI – SP. A metodologia, qualitativa, constou de observação participante, entrevistas individuais e coletivas, tendo ocorrido 15 visitas no período de abril de 2010 a julho de 2011. Participaram doze moradoras, das quais, seis agentes comunitárias de saúde. As práticas de cuidado à saúde referem-se a: companheirismo, diálogo, escuta ativa, mobilizações sociais, assistência multiprofissional dos serviços de saúde, uso de plantas medicinais, crença religiosa como apoio social e dietas. Tais práticas somam-se e articulam-se. As participantes ensinam e aprendem sobre o cuidado à saúde nas relações entre elas, nas intergeracionais e nas com os profissionais de saúde, além de recorrerem a outras fontes de informação e outros processos formativos específicos, como do Programa Saúde da Família.

  17. Necessidades em saúde segundo percepções de pessoas com tuberculose pulmonar

    Directory of Open Access Journals (Sweden)

    Paula Hino

    Full Text Available O presente estudo teve como objetivo conhecer as percepções sobre necessidades em saúde de pessoas com tuberculose pulmonar. Trata-se de estudo qualitativo, desenvolvido no distrito administrativo Capão Redondo, São Paulo. Os dados foram coletados em janeiro de 2010 por meio de entrevista semidiretiva. Foram entrevistadas onze pessoas em tratamento contra tuberculose, com idade mínima de 18 anos e sem limites de cognição. O material empírico foi decodificado a partir de técnica de análise de discurso. As percepções sobre necessidades em saúde estão relacionadas às dificuldades enfrentadas no processo saúde-doença, e o reconhecimento das necessidades em saúde mostrou-se condicionado à vigência do agravo à saúde. As necessidades identificadas decorrem de alterações biológicas, do cotidiano e de insuficiências no processo de produção dos serviços de saúde. A qualidade da assistência às pessoas com tuberculose está, entre outros fatores, condicionada à identificação e ao atendimento de suas necessidades em saúde.

  18. Necessidades em saúde segundo percepções de pessoas com tuberculose pulmonar

    Directory of Open Access Journals (Sweden)

    Paula Hino

    2012-12-01

    Full Text Available O presente estudo teve como objetivo conhecer as percepções sobre necessidades em saúde de pessoas com tuberculose pulmonar. Trata-se de estudo qualitativo, desenvolvido no distrito administrativo Capão Redondo, São Paulo. Os dados foram coletados em janeiro de 2010 por meio de entrevista semidiretiva. Foram entrevistadas onze pessoas em tratamento contra tuberculose, com idade mínima de 18 anos e sem limites de cognição. O material empírico foi decodificado a partir de técnica de análise de discurso. As percepções sobre necessidades em saúde estão relacionadas às dificuldades enfrentadas no processo saúde-doença, e o reconhecimento das necessidades em saúde mostrou-se condicionado à vigência do agravo à saúde. As necessidades identificadas decorrem de alterações biológicas, do cotidiano e de insuficiências no processo de produção dos serviços de saúde. A qualidade da assistência às pessoas com tuberculose está, entre outros fatores, condicionada à identificação e ao atendimento de suas necessidades em saúde.

  19. Preliminary treatment of bovine mastitis caused by Staphylococcus aureus, with trx-SA1, recombinant endolysin of S. aureus bacteriophage IME-SA1.

    Science.gov (United States)

    Fan, Jindai; Zeng, Zhiliang; Mai, Kaijie; Yang, Yu; Feng, Jiaqi; Bai, Yang; Sun, Baoli; Xie, Qingmei; Tong, Yigang; Ma, Jingyun

    2016-08-15

    Methicillin-resistant Staphylococcus aureus (MRSA) has become a great threat to human and animal health and there is an urgent need to develop novel antibacterial agents to control this pathogen. The objective of this study was to obtain an active recombinant endolysin from the novel bacteriophage (IME-SA1), and conduct an efficacy trial of its effectiveness against bovine mastitis. We isolated a phage that was virulent and specific for S. aureus with an optimal multiplicity of infection of 0.01. Electron microscopy revealed that IME-SA1 was a member of the family Myoviridae, with an isometric head (98nm) and a long contractile tail (200nm). Experimental lysis experiments indicated the phage had an incubation period of 20min with a burst size of 80. When host bacteria were in early exponential growth stages, a multiplicity of infection of 0.01 resulted in a complete bacterial lysis after 9h. The endolysin gene (804bp) was cloned into the pET-32a bacterial expression vector and recombinant endolysin Trx-SA1 was successfully obtained with molecular size of about 47kDa. Preliminary results of therapeutic trials in cow udders showed that Trx-SA1 could effectively control mild clinical mastitis caused by S. aureus. The endolysin Trx-SA1 might be an alternative treatment strategy for infections caused by S. aureus, including MRSA.

  20. Complexidade em Saúde da Família e formação do futuro profissional de saúde

    Directory of Open Access Journals (Sweden)

    Rodrigo Otávio Moretti-Pires

    2009-09-01

    Full Text Available As características do Sistema Único de Saúde (SUS e da Estratégia de Saúde da Família (ESF os aproximam do pensamento complexo, termo que não se refere à adjetivação de fenômeno de aspectos múltiplos, e sim ao marco teórico e epistemológico. Indícios de inadequação da formação dos profissionais de saúde para a atuação em Saúde da Família levaram a proposta de levantar a formação desses profissionais para a abordagem ampliada de saúde implicada no SUS/ESF. Foram realizados grupos focais com acadêmicos de Enfermagem, Medicina e Odontologia da Universidade Federal do Amazonas, analisado sob a perspectiva hermenêutica dialética. Os dados apontaram para a formação reducionista/biomédica nas três profissões assim como o foco no trabalho individual, e não em equipe multiprofissional, quadro inadequado ao SUS/ESF, que preconiza atuação profissional focada na complexidade do entorno sócioeconômico e antropológico dos usuários do sistema.

  1. Condicionalidades em saúde do programa Bolsa Família – Brasil: uma análise a partir de profissionais da saúde

    Directory of Open Access Journals (Sweden)

    Alice Teles de Carvalho

    2014-12-01

    Full Text Available Este estudo apresenta a percepção de profissionais de equipes de Saúde da Família de municípios do Nordeste do Brasil acerca das mudanças na vida das famílias participantes do programa Bolsa Família, da relação destas com os serviços de saúde e do impacto na dinâmica de trabalho dos profissionais, a partir do acompanhamento das condicionalidades de saúde do programa Bolsa Família. As informações foram obtidas por meio de entrevistas semiestruturadas e encontros de grupo focal. Os profissionais acreditam que o programa ocasionou mudanças favoráveis na vida das famílias participantes, como a redução da pobreza, o aumento da frequência escolar das crianças e mudanças positivas na relação entre as famílias participantes e os serviços de saúde. No entanto, relataram dificuldades de caráter organizacional no acompanhamento das condicionalidades, sobretudo devido ao aumento da demanda de trabalho. É importante que as condicionalidades de saúde proporcionem oportunidades para a realização de ações que visem ao empoderamento e autonomia dos sujeitos quanto ao autocuidado e desenvolvimento da cidadania.

  2. Controle social do Sistema Único de Saúde: o que pensam os conselheiros municipais de saúde

    Directory of Open Access Journals (Sweden)

    Vera Dib Zambon

    2013-12-01

    Full Text Available Desafios estão presentes para a consolidação da participação da comunidade e este estudo objetiva analisar o controle social na perspectiva dos conselheiros municipais de saúde. Trata-se de estudo de abordagem qualitativa utilizando entrevistas semiestruturadas. Identificou-se que alguns conselheiros não reconhecem a participação social como diretriz do Sistema Único de Saúde. Apesar do reconhecimento dos conselhos como espaços deliberativos, identificam-se dificuldades como a centralização das decisões na gestão, a valorização do saber técnico e a não realização de conferências de saúde. Há limitações no efetivo exercício do papel de conselheiro, dificuldade de interlocução com as bases de representação e de acesso a informações. Aponta-se a necessidade de articulação dos conselheiros e capacitações. Conclui-se pela necessidade de valorização dos espaços colegiados instituídos no Pacto pela Saúde, para fortalecimento do controle social, com destaque à educação permanente em saúde.

  3. Estratégia saúde da família e saúde do trabalhador: um diálogo possível?

    Directory of Open Access Journals (Sweden)

    Francisco Antonio de Castro Lacaz

    Full Text Available Reflete-se sobre a omissão de práticas voltadas para a saúde dos trabalhadores no âmbito de atuação da Estratégia Saúde da Família (ESF e propõe-se a inclusão dessas práticas. Considera-se que a mudança do modelo de atenção médico-centrado exige uma nova abordagem que incorpore a análise de elementos da produção de bens, da circulação e do consumo. Fundamenta-se na teoria da determinação social do processo saúde-doença e nas categorias trabalho e reprodução social. Propõe-se que a incorporação da temática Saúde do Trabalhador (ST na ESF seja realizada pela operacionalização de: um instrumento que levante e analise variáveis e indicadores de reprodução social; um sistema de apoio matricial que integre os Centros de Referência em ST com as Unidades Básicas de Saúde; educação permanente das equipes da ESF em conteúdos de ST.

  4. Intervenções em saúde pública e seu impacto nas desigualdades sociais em saúde

    Directory of Open Access Journals (Sweden)

    José Leopoldo Ferreira Antunes

    2015-06-01

    Full Text Available Este artigo resume a avaliação de três programas de saúde pública em relação à sua eficácia e impacto sobre as desigualdades sociais na saúde. Foram examinadas a fluoração da água de abastecimento público no contexto brasileiro, a provisão de terapêutica antirretroviral para pacientes com Aids e a vacinação de idosos contra a gripe na cidade de São Paulo. As três intervenções foram consideradas efetivas, na medida em que propiciaram uma redução na carga de doença na população. No entanto, elas tiveram resultados conflitantes quanto ao impacto sobre as desigualdades em saúde. Concluiu-se, por fim, que os programas de saúde pública devem ser implementados com um alcance imediata e efetivamente universal, direcionando recursos adicionais aos grupos com mais necessidades de saúde. Essa estratégia reduziria, ao mesmo tempo, o nível geral de doença na população e as desigualdades na experiência de doenças entre os estratos sociais.

  5. Nouvelles approches en theorie du champ moyen dynamique: le cas du pouvoir thermoelectrique et celui de l'effet orbital d'un champ magnetique

    Science.gov (United States)

    Arsenault, Louis-Francois

    , cette approche donne une bonne representation de S lorsque le systeme devient coherent. Les calculs montrent aussi que la formule Kelvin est precise lorsque la fonction spectrale des electrons devient incoherente, soit a plus haute temperature. Dans la limite Kelvin, S est essentiellement l'entropie par particule, tel que propose il y a longtemps. Nos resultats demontrent ainsi que la vision purement entropique de S est la bonne dans le regime incoherent, alors que dans le regime coherent, l'approche a frequence infinie est meilleure. Nous avons utilise une methode a la fine pointe, soit le Monte-Carlo quantique en temps continu pour resoudre la DMFT. Pour permettre une exploration rapide du diagramme de phase, nous avons du developper une nouvelle version de la methode des perturbations iterees pour qu'elle soit applicable aussi a forte interaction au-dela de la valeur critique de la transition de Mott. Un autre sujet a aussi ete aborde. L'effet orbital du champ magnetique dans les systemes electroniques fortement correles est une question tres importante et peu developpee. Cela est d'autant plus essentiel depuis la decouverte des oscillations quantiques dans les supraconducteurs a haute temperature (haut- Tc). Par desir de developper une methode la moins biaisee possible, nous avons derive la DMFT lorsqu'un champ se couplant a l'operateur energie cinetique par la substitution de Peierls est present. Ce type d'approche est necessaire pour comprendre entre autres l'effet de la physique de Mott sur des phenomenes tels que les oscillations quantiques. Nous avons obtenu un resultat tres important en demontrant rigoureusement que la relation d'auto-coherence de la DMFT et le systeme intermediaire d'impurete quantique restent les memes. L'effet du champ peut etre contenu dans la fonction de Green locale, ce qui constitue la grande difference avec le cas habituel. Ceci permet de continuer a utiliser les solutionneurs d'impuretes standards, qui sont de plus en plus puissants

  6. em saúde e doença mental

    Directory of Open Access Journals (Sweden)

    Neuza Maria de Fátima Guareschi

    2008-01-01

    Full Text Available This article aims at discussing social vulnerability from an experiment carried out with users of the Day-Hospital Program. This program, proposed by Sistema Único de Saúde, is a strategy directed towards another social agency of madness, distinct from the model of the hospice culture, with health practices that may lead to social exclusion and stigma. This study has been structured from a weekly activity developed in a Day-Hospital of a public general hospital in Rio Grande do Sul, through participative observations’. The group was constituted as a speech space in which users could talk about daily practices, sharing different ways of thinking and feeling the experience of psychic distress. Aiming at debating upon how the condition of social vulnerability has been produced in carriers of psychic distress, we have considered discursive practices of mental health public policies, from the Psychiatric Reform, as well as the notion of performativity in the production of mental health/disease. The forms these subjects think of and recognize both themselves and the world become visible through certain identity marks that constitute them as mentally ill. Even being a program situated in the field of the Psychiatric Reform, the Day-Hospital is still crossed by meanings from both the hospital-centered psychiatric discourse about madness and the medicamentous therapeutic practice, which have inscribed ways of subjects living mental health/disease with strict possibilities of subjectifying themselves out of this logic.

  7. AUTOMATIZACIÓN DE OFICINAS S.A.

    Directory of Open Access Journals (Sweden)

    Luis Carlos Diaz Osorio

    1998-01-01

    Full Text Available El caso muestra la situación de Automatización de Oficinas S.A., una empresa de gran trayectoria nacional, orientada a la comercialización de muebles y equipos para oficina. A principios de la década pasada, comenzó a comercializar microcomputadoras y elementos de conectividad de redes, manejando grandes márgenes por ser monopolio, aprovechando los beneficios de importación que le otorgaba el ser exportador de muebles. En el momento en que se abren las importaciones, más de doscientas empresas entran a competir en el mercado de los microcomputadores, llegando incluso a manejar márgenes de hasta el 10%. Las ventas de la empresa han bajado a niveles alarmantes, incluso se cree que únicamente compran empresas allegadas a los directivos o personas que no conocen nada del tema de los computadores. La situación puntual es la toma de decisión de las estrategias para ser competitivos o decidir salir del mercado de los PC. La orientación que hemos decidido darle al caso es “fijación de precios”.

  8. Saúde bucal no Brasil Oral health in Brazil

    Directory of Open Access Journals (Sweden)

    Vitor Gomes Pinto

    1983-08-01

    Full Text Available Apresenta-se um retrato sobre a saúde bucal no Brasil, com ênfase em informações relativas à situação econômica e epidemiológica, prevenção da cárie dental, recursos humanos, montante de gastos financeiros e estrutura de prestação de serviços. O país mostra quadro típico de uma área em desenvolvimento, com elevada incidência de problemas, crescente oferta de cirurgiões-dentistas e difícil acesso aos serviços ofertados mormente face a barreiras de ordem econômica. Visando expandir cuidados odontológicos e reduzir a incidência dos principais problemas, propõe-se um programa de serviços básicos de âmbito nacional.The oral health situation in Brazil is described, with special emphasis on data relating to the economic and epidemiological situation, caries prevention, human resources, health expenditure and dental care structure. The country presents a picture typical of a developing area, with high disease rates, an increase in the offer of dentists and access to dental care hindered principally by economic barriers. A comprehensive program of basic services in odontology is proposed, with the objective of expanding dental care and reducing the incidence of more prevalent problems.

  9. SA BASED SOFTWARE DEPLOYMENT RELIABILITY ESTIMATION CONSIDERING COMPONENT DEPENDENCE

    Institute of Scientific and Technical Information of China (English)

    Su Xihong; Liu Hongwei; Wu Zhibo; Yang Xiaozong; Zuo Decheng

    2011-01-01

    Reliability is one of the most critical properties of software system.System deployment architecture is the allocation of system software components on host nodes.Software Architecture (SA)based software deployment models help to analyze reliability of different deployments.Though many approaches for architecture-based reliability estimation exist,little work has incorporated the influence of system deployment and hardware resources into reliability estimation.There are many factors influencing system deployment.By translating the multi-dimension factors into degree matrix of component dependence,we provide the definition of component dependence and propose a method of calculating system reliability of deployments.Additionally,the parameters that influence the optimal deployment may change during system execution.The existing software deployment architecture may be ill-suited for the given environment,and the system needs to be redeployed to improve reliability.An approximate algorithm,A*_D,to increase system reliability is presented.When the number of components and host nodes is relative large,experimental results show that this algorithm can obtain better deployment than stochastic and greedy algorithms.

  10. PRODUCTIVITY AND QUALITY: A STRATEGY FOR THE SA DEFENCE FORCE

    Directory of Open Access Journals (Sweden)

    R. Eberlein

    2012-02-01

    Full Text Available In recent times the SA Defence Force (SADF has been bombarded with a variety of methods and approaches to the improvement of productivity, financial savings and, most recently, for quality of work life or quality assurance. Various approaches have included the concepts of Total Quality Management (TQM, Quality Circles (and variants in the guise of Triads and others, Methodology, Unit Management Systems, Cost Control Systems, Deterministic Productivity Accounting and the Iike. There have been many benefits to be found in these various approaches, each of which concentrates on certain aspects of productivity. That there have been great achievements in productivity in the SADF is a matter of record, a record which is reflected in a National Award for Productivity, a smaller more efficient SADF, and a reputation for submitting more recommendations for improvements than other departments in the Public Service. At a more personal level though, the writer has gained the impression that no or very little attempt has been made to integrate selected aspects of these approaches into an overall "productivity” strategy acceptable to the SADF. That there is a need for such an overall strategy is clear from the sentiments expressed recently by the members of the SADF's Productivity Co-ordination Committee when attempting to indicate the way ahead to even greater productivity in the SADF (Meeting, January 1991. In this paper a strategy for the improvement of productivity and the quality of work life which is acceptable to the SADF is proposed.

  11. Qualidade em saúde: que trajetos de formação dos enfermeiros?

    OpenAIRE

    Pinho, Carla Amorim

    2012-01-01

    ENQUADRAMENTO: A avaliação da qualidade dos serviços de saúde, a crescente melhoria do desempenho dos profissionais, e a monitorização sistemática das atividades desenvolvidas pelas instituições de saúde, potenciam a qualidade dos cuidados prestados. A intervenção dos enfermeiros e dos restantes profissionais de saúde é imprescindível na promoção desta qualidade conforme defendem os diversos modelos da sua gestão. Para a generalidade destes, considera-se que a supervisão clí...

  12. A revista Saúde em Debate como fonte e objeto de estudo

    OpenAIRE

    Sophia,Daniela Carvalho

    2013-01-01

    A presente nota de pesquisa busca divulgar estudo sobre o Centro Brasileiro de Estudos da Saúde e o movimento de reforma sanitária desenvolvido no âmbito do Programa de História das Ciências e da Saúde Pública da Casa de Oswaldo Cruz. Atém-se à revista Saúde em Debate , periódico do Centro, devido à relevância que teve na área ao longo dos dez anos de publicação. A utilização da revista na pesquisa deu ...

  13. Sur la route du Boson des idées de Brout, Englert et Higgs à la naissance d'une nouvelle particule

    CERN Document Server

    Badaud, Frédérique; Madar, Romain; Orloff, Jean; Bernet, Lison

    2015-01-01

    Ce carnet décrit la formidable aventure technique et humaine qui a abouti à la découverte du boson de Higgs. Cette aventure, racontée par quatre physiciens qui travaillent depuis des années au sein de cette fourmilière de dix mille techniciens et chercheurs du monde entier basée au CERN de Genève, révèle une vaste coopération humaine et un voyage fantastique dans la pensée. L’ouvrage s’inscrit dans la volonté de vulgariser cette découverte qui n’est qu’une étape du programme scientifique de l’accélérateur de particules situé à cent mètres sous terre entre la Suisse et la France. Particularité : une mascotte présente presque sur toutes les doubles-pages interpelle et accompagne le lecteur dans sa lecture.

  14. Saúde do homem e masculinidades na Política Nacional de Atenção Integral à Saúde do Homem: uma revisão bibliográfica

    Directory of Open Access Journals (Sweden)

    Marco Antonio Separavich

    2013-06-01

    Full Text Available Este artigo, orientado pela teoria do gênero sobre masculinidades, revisa os textos que trataram do tema nos periódicos de Saúde Coletiva/Saúde Pública no período de 2005-2011. Os eixos temáticos encontrados coincidem com as prioridades conferidas pela Política Nacional de Atenção Integral à Saúde do Homem, criada pelo Ministério da Saúde em 2008. São eles: o acesso dos homens aos serviços de saúde, sexualidade, saúde reprodutiva, violência e os principais agravos à saúde masculina, contextualizados à luz dos determinantes sociais da saúde. Tais determinantes se baseiam em um tipo de masculinidade tradicional concebida como hegemônica, que apesar de comprometer a saúde masculina, não é o tipo único de masculinidade existente na sociedade. As diferentes masculinidades encontram-se imbricadas no processo saúde/doença vivido pelos homens. Elas devem ser consideradas na busca da adesão dos homens aos serviços de saúde.

  15. Saúde Masculina: representação e experiência de homens trabalhadores com o corpo, saúde e doença.

    Directory of Open Access Journals (Sweden)

    Marco Antonio Alves SEPARAVICH

    2015-10-01

    Full Text Available Este estudo analisou as experiências e representações de homens trabalhadores com o corpo, saúde, doença e cuidado, e os problemas principais de saúde por eles percebidos, quais sejam, a hipertensão arterial e as lombalgias crônicas. Analisou-se como explicam as suas causas; a forma como enfrentam e buscam a resolução ou mitigação desses problemas de saúde, as terapêuticas utilizadas, a interferência que elas acarretam em suas rotinas de vida e identidades. A revisão da literatura da Saúde Coletiva sobre a saúde do homem e masculinidades mostrou que as demandas masculinas na busca por tratamentos nos serviços públicos de saúde e a percepção de que são portadores de necessidades específicas de saúde são minoritárias. Constatou-se também que as abordagens socioantropológicas de como eles convivem e lidam com as enfermidades que os acometem também são raras. Justifica-se, portanto, o interesse e as razões que motivaram este trabalho. As demandas minoritárias masculinas aos serviços de saúde, concebidas a partir da masculinidade tradicional socialmente vigente, e os dados epidemiológicos das altas taxas de morbimortalidade masculina, embasaram a formulação da Política Nacional de Atenção Integral à Saúde do Homem (PNAISH, cujos objetivos buscam promover a melhora da saúde da população masculina na faixa etária dos 20 aos 59, facilitando o seu acesso aos serviços de atendimento integral à saúde na atenção primária. Campinas abriga projeto piloto de tal política. Analisou-se o processo de implementação da PNAISH em um dos centros de saúde da cidade elegido como piloto, cujos serviços estruturam-se na Estratégia Saúde da Família. Entrevistou-se 9 profissionais que nele atuam, especificamente na saúde do adulto, considerando o conhecimento que têm de tal política, as atividades que realizam para o seu atendimento, e os obstáculos observados que dificultam a sua implementação. Para o

  16. Concepções de saúde de mulheres cuidadoras-leigas : estratégias à sua promoção da saúde

    OpenAIRE

    2007-01-01

    A situação das mulheres cuidadoras-leigas, acompanhantes de crianças hospitalizadas, representa nesse estudo, a sua visão em relação à saúde, a qualidade da atenção dispensada a elas pelos profissionais e as políticas públicas de saúde instituídas em um ambiente hospitalar. Trata-se de uma pesquisa qualitativa do tipo descritivo-exploratório e intervencionista desenvolvida em um hospital-escola na cidade de Porto Alegre/RS, que objetivou conhecer as concepções de saúde de mulheres cuidadoras-...

  17. A saúde mental no contexto da Estratégia Saúde da Família no Brasil

    OpenAIRE

    2015-01-01

    São discutidas as concepções sobre saúde mental e loucura e os modos de funcionamento das equipes de Estratégia Saúde da Família (ESF) associadas a essas concepções em duas unidades da rede básica de saúde das cidades de Natal –capital no nordeste brasileiro- e Porto Alegre –capital do extremo sul do país. O referencial teórico-metodológico da análise institucional foi utilizado para tratamento das informações levantadas através da realização de 40 entrevistas com os profissionais da unidade ...

  18. Caracterização das atividades de enfermagem em saúde coletiva desenvolvidas na regional norte de saúde do Distrito Federal

    Directory of Open Access Journals (Sweden)

    Helena Eri Shimizu

    Full Text Available O estudo teve como objetivo identificar e analisar as ações desenvolvidas pela equipe de enfermagem em saúde coletiva na Regional Norte de Saúde do Distrito Federal. Para a coleta de dados aplicou-se um questionário com a descrição das diversas atividades cotidianas da assistência a 29 enfermeiras, 91 auxiliares de enfermagem e 42 agentes de saúde. Para a melhor compreensão de como as atividades são desenvolvidas realizou-se grupos focais com cada uma das categorias profissionais. Os resultados mostram que todos elementos da equipe empregam grandes esforços para organizar, controlar e atender a demanda espontânea e ainda executar as atividades de auxilio às ações médicas, consequentemente priorizam o atendimento individual em detrimento do coletivo.

  19. Pesquisa em saúde, política de saúde e eqüidade na América Latina

    Directory of Open Access Journals (Sweden)

    Alberto Pellegrini Filho

    2004-06-01

    Full Text Available O autor analisa as relações entre pesquisa de saúde, políticas de saúde e eqüidade na América Latina. Descreve novas tendências no modo de produção do conhecimento, que permitem maior integração entre as necessidades sociais e a pesquisa, facilitando o vínculo entre esta e o processo de definição de políticas. Analisa as manifestações das novas tendências na América Latina e finaliza com a descrição de algumas iniciativas promovidas pela OPAS no sentido de aproveitar as oportunidades abertas pelas novas tendências para a melhoria das condições de saúde na região. Busca defender a tese de que a informação e o conhecimento são bens públicos essenciais e que as iniqüidades de acesso a esses bens são importantes determinantes das iniqüidades em saúde. Para que as políticas de saúde e as políticas de pesquisa em saúde se integrem e se consolidem como políticas públicas voltadas a atender ao interesse público e à promoção da eqüidade, é necessário o fortalecimento do processo democrático de definição das mesmas, multiplicando os atores envolvidos, os espaços e oportunidades de interação entre eles e instrumentando sua participação com o acesso eqüitativo a informações e conhecimentos científicos pertinentes que permitam a defesa fundamentada de seus interesses.

  20. O complexo industrial da saúde e a necessidade de um enfoque dinâmico na economia da saúde

    Directory of Open Access Journals (Sweden)

    Carlos Augusto Grabois Gadelha

    2003-01-01

    Full Text Available O artigo desenvolve um enfoque analítico voltado para o estudo do complexo industrial da saúde, englobando o conjunto das atividades produtivas e suas relações de interdependência, segundo uma perspectiva de economia política e da inovação. A lógica empresarial capitalista penetra em todos os segmentos produtivos, envolvendo tanto as indústrias que já operavam tradicionalmente nessas bases quanto segmentos que possuíam formas de organização em que era possível verificar a convivência de lógicas empresariais com outras que dela se afastavam, como a produção de vacinas e produtos biológicos, fitoderivados e a prestação de serviços de saúde. O artigo analisa a interação entre o sistema de saúde e o sistema econômico-industrial, mostrando como tem havido uma dicotomia na relação entre ambos, que se exprime na deterioração do potencial de inovação do país e numa crescente e preocupante vulnerabilidade externa da política de saúde. Sugere-se que o enfoque neoclássico tradicional da economia da saúde é insuficiente para tratar do complexo industrial da saúde, dada a intensidade do processo de mudança estrutural, e a necessidade de um enfoque teórico alternativo que incorpore a dinâmica de transformação econômica e institucional, de acumulação e de inovação.

  1. Does Salicylic Acid (SA) Improve Tolerance to Salt Stress in Plants? A Study of SA Effects On Tomato Plant Growth, Water Dynamics, Photosynthesis, and Biochemical Parameters.

    Science.gov (United States)

    Mimouni, Hajer; Wasti, Salma; Manaa, Arafet; Gharbi, Emna; Chalh, Abdellah; Vandoorne, Bertrand; Lutts, Stanley; Ben Ahmed, Hela

    2016-03-01

    Environmental stresses such as salinity directly impact crop growth, and by extension, world food supply and societal prosperity. It is estimated that over 800 million hectares of land throughout the world are salt-affected. In arid and semi-arid regions, salt concentration can be close to that in the seawater. Hence, there are intensive efforts to improve plant tolerance to salinity and other environmental stressors. Salicylic acid (SA) is an important signal molecule for modulating plant responses to stress. In the present study, we examined, on multiple plant growth related endpoints, whether SA applied through the rooting medium could mitigate the adverse effects of salinity on tomato (Solanum lycopersicum) cv. Marmande. The latter is a hitherto understudied tomato plant from the above perspective; it is a classic variety that produces the large ribbed tomatoes in the Mediterranean and consumed worldwide. We found salt stress negatively affected the growth of cv. Marmande tomato plants. However, the SA-treated plants had greater shoot and root dry mass, leaf area compared to untreated plants when exposed to salt stress. Application of SA restores photosynthetic rates and photosynthetic pigment levels under salt (NaCl) exposure. Leaf water, osmotic potential, stomatal conductance transpiration rate, and biochemical parameters were also ameliorated in SA-treated plants under saline stress conditions. Overall, these data illustrate that SA increases cv. Marmande tomato growth by improving photosynthesis, regulation and balance of osmotic potential, induction of compatible osmolyte metabolism, and alleviating membrane damage. We suggest salicylic acid might be considered as a potential growth regulator to improve tomato plant salinity stress resistance, in the current era of global climate change.

  2. SA1 binds directly to DNA through its unique AT-hook to promote sister chromatid cohesion at telomeres.

    Science.gov (United States)

    Bisht, Kamlesh K; Daniloski, Zharko; Smith, Susan

    2013-08-01

    Sister chromatid cohesion relies on cohesin, a complex comprising a tri-partite ring and a peripheral subunit Scc3, which is found as two related isoforms SA1 and SA2 in vertebrates. There is a division of labor between the vertebrate cohesin complexes; SA1-cohesin is required at telomeres and SA2-cohesin at centromeres. Depletion of SA1 has dramatic consequences for telomere function and genome integrity, but the mechanism by which SA1-cohesin mediates cohesion at telomeres is not well understood. Here we dissect the individual contribution of SA1 and the ring subunits to telomere cohesion and show that telomeres rely heavily on SA1 and to a lesser extent on the ring for cohesion. Using chromatin immunoprecipitation we show that SA1 is highly enriched at telomeres, is decreased at mitosis when cohesion is resolved, and is increased when cohesion persists. Overexpression of SA1 alone was sufficient to induce cohesion at telomeres, independent of the cohesin ring and dependent on its unique (not found in SA2) N-terminal domain, which we show binds to telomeric DNA through an AT-hook motif. We suggest that a specialized cohesion mechanism may be required to accommodate the high level of DNA replication-associated repair at telomeres.

  3. BiodanÃa e SaÃde Percebida: um Olhar BiocÃntrico sobre a SaÃde

    OpenAIRE

    Kelen Gomes Ribeiro

    2008-01-01

    Diante da constataÃÃo de uma grande quantidade de abordagens de desenvolvimento humano e de terapias existentes e praticadas no Brasil, atendendo a uma considerÃvel parcela da demanda social relativa aos cuidados com a saÃde dos indivÃduos, consideramos relevante estudar uma abordagem que se coloca como novidade no campo da SaÃde: o Sistema BiodanÃa. A escolha por esse Sistema ocorreu tambÃm devido à nossa afinidade com o mesmo e ao fato de termos realizado pesquisa de iniciaÃÃo cientÃfica so...

  4. Double Band CDMA/AMPS Down Frequeney Converter SA9500%双频段CDMA/AMPS下变频器SA9500

    Institute of Scientific and Technical Information of China (English)

    张颖光; 李斌涛

    2000-01-01

    双频段CDMA/AMPS下变频器集成电路SA9500集成了用于双频段、三模式CDMA/AMPS蜂窝移动通信电话手机所必需的所有前端接收混频器,可工作于高频段1900MHz PCS CDMA和低频段800MHz CDMA蜂窝移动通信系统,或模拟模式的FM AMPS/TACS中.本文介绍了SA9500的原理、特点与典型应用.

  5. Condições de saúde bucal de industriários participantes de Programa de Saúde Bucal na Empresa

    OpenAIRE

    Luísa Silva Lima; Maristela Santos Araújo; Paloma Perez Castro; Maria Cristina Teixeira Cangussu

    2015-01-01

    Resumo Objetivo: verificar as condições de saúde bucal de trabalhadores de cinco indústrias da região metropolitana de Salvador, Bahia, que participavam do Programa de Saúde Bucal na Empresa (PSBE) entre os anos 2003 a 2008. Métodos: estudo transversal retrospectivo, com dados secundários do banco de dados do SESI/DR-BA. Participaram todos os funcionários que realizaram pelo menos dois exames odontológicos no período, totalizando 1.277 trabalhadores. Foram investigados dados sociodemográficos...

  6. Políticas de saúde e blocos econômicos

    OpenAIRE

    André Medici; Bernardo Barros Weaver

    2007-01-01

    O Artigo "Políticas de saúde e blocos econômicos" trata da integração de sistemas de saúde dentro de blocos econômicos. Entretanto, a obra não é restrito aos temas de saúde. Tópicos como proteção ao imigrante intra-regional, e extra-regional também são abordados. Dentro do tópico de proteção ao trabalhador, vêm os temas de pensão: Modelos de aposentadoria para o trabalhador imigrante na Europa e nos EUA. O direito do cidadão de um bloco econômico de ir e vir, garantido não só o acesso à saúde...

  7. O sistema social da saúde: conceito, limites e possibilidades

    Directory of Open Access Journals (Sweden)

    Sandra Regina Martini Vial

    2014-06-01

    Full Text Available Discutem-se as possibilidades de definir o sistema da saúde como um sistema social, diferenciado funcionalmente, a partir da ótica da Teoria dos Sistemas Sociais, utilizando os pressupostos gerais da Teoria e a estrutura apresentada por Niklas Luhmann sobre o sistema médico. Apresentam-se alguns “desassossegos” provocados pela Teoria; as possíveis relações entre o sistema da saúde e o que Luhmann chamou de sistema médico e como esse sistema, atualmente, pode ser considerado sistema da saúde; e, por fim, a nossa concepção do sistema da saúde na atualidade.

  8. A construção de um modelo de saúde complexo e transdisciplinar

    Directory of Open Access Journals (Sweden)

    Regina Stella Spagnuolo

    2005-02-01

    Full Text Available A saúde como um estado dinâmico coerente e construtivo do ser vivo é o fundamento da proposta deste texto. Nessa ótica, uma visão sistêmica e integrativa do ser humano a ser cuidado na prática diária da saúde está sendo proposta com base nos conceitos de pesquisadores e educadores das últimas décadas. Conceitos de caos, complexidade, transdisciplinaridade e auto-organização são introduzidos e fazem mais sentido como temas orientadores dos procedimentos sugeridos. Maneiras de promover a saúde assim compreendida são discutidas em algumas situações práticas, incluindo o atual programa oficial da Estratégia da Saúde da Família.

  9. Kuu plaat : Lauri Saatpalu ja Katrin Mandel "Sa oled hea". Plaadid kauplusest Lasering

    Index Scriptorium Estoniae

    2005-01-01

    Heliplaatidest: Lauri Saatpalu ja Katrin Mandel "Sa oled hea", Goldfrapp "Supernature", Ultima Thule "Ingel ja suli", Sigur Ros "Takk...", Franz Ferdinand "You Could Have It So Much Better", Ans.Andur "Tuled peale"

  10. SA-MAC:Self-Stabilizing Adaptive MAC Protocol for Wireless Sensor Networks

    Institute of Scientific and Technical Information of China (English)

    波澄; 韩君泽; 李向阳; 王昱; 肖波

    2014-01-01

    A common method of prolonging the lifetime of wireless sensor networks is to use low power duty cycling protocol. Existing protocols consist of two categories: sender-initiated and receiver-initiated. In this paper, we present SA-MAC, a self-stabilizing adaptive MAC protocol for wireless sensor networks. SA-MAC dynamically adjusts the transmission time-slot, waking up time-slot, and packet detection pattern according to current network working condition, such as packet length and wake-up patterns of neighboring nodes. In the long run, every sensor node will find its own transmission phase so that the network will enter a stable stage when the network load and qualities are static. We conduct extensive experiments to evaluate the energy consumption, packet reception rate of SA-MAC in real sensor networking systems. Our results indicate that SA-MAC outperforms other existing protocols.

  11. Effect of salicylic acid (SA) on delaying fruit senescence of Huang Kum pear

    Institute of Scientific and Technical Information of China (English)

    ZHANG Yuxing; DU Guoqiang; WANG Guoying; ZHANG Jianghong; Hassan Imran

    2007-01-01

    This experiment was undertaken to explore the effect of salicylic acid (SA) at different concentrations on regulating fruit senescence ofHuang Kum pear.Through dipping fruits and fruit discs for a series of hours in SA solution,enzyme activities and physiological characteristics of Huang Kum pear were determined.The results revealed that SA enhanced the activity of superoxide dismutase (SOD) and peroxidase (POD) enzymes at 0.02 mmol/L and at 0.002 mmol/L with the treatment of dipping fruit discs for 4 h and 12 h,respectively.The malondialdehyde (MDA) contents were reduced at 0.002 mmol/L for 12 h,and water loss ratio was decreased at 0.5 mmol/L after 48 h of treatment.It was concluded that SA at lower concentrations could delay the senescence of Huang Kum pear fruit.

  12. Data of evolutionary structure change: 1A4SA-2ONNF [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A4SA-2ONNF 1A4S 2ONN A F AQLVDSMPSASTGSVVVTDDLNYWGGRRIKSKDGATTEP...KVMEMSAK-TVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQREIMPQFLEEVVKRTKAIVVG...ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEA...HHHHH ------ EEE EEEEEE HHHHHHHH EEEE HHHHHHHHHH EEE GGG EEE GGG EEEEEEEEE -- ... 2ONN F 2ONNF

  13. 马兰士 SA-13S2 SACD/CD播放机

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    SA-13S2内部的规划十分整齐,所使用的激光读取模组是新开发的SACDM-10.有厚达2mm的钢板作为机箱底座.再加上新开发的SACDM-10激光读取机构。光碟的读出精度有很大的提升,同时还减轻噪音辐射。SA-13S2采用了马兰士公司独家开发的HDAM模组,同样配备了马兰士SACD播放机SA-7S1采用的著名的第二代HDAM(High Definition Amplifier Module)SA2放大模组。

  14. GERDAU S.A.: a empresa brasileira mais internacionalizada

    Directory of Open Access Journals (Sweden)

    EVA STAL

    2007-07-01

    Full Text Available Muitas empresas dos países em desenvolvimento não se consideram aptas a explorar outrosmercados devido à distância tecnológica entre as empresas globais e os seus padrões locais. Oartigo mostra que existe espaço para a inovação empresarial oriunda de países emdesenvolvimento, e ela é um dos principais fatores responsáveis pelo sucesso de suasempresas na conquista do mercado mundial. Descreve o processo de expansão internacionalda Gerdau S.A., que começou com exportações e evoluiu para a aquisição de empresassiderúrgicas na América Latina, América do Norte e Europa, num total de 32 usinas em 10países, sendo 21 no exterior, que empregam mais de 32 mil funcionários. Hoje, a empresapossui valor de mercado estimado em 10 bilhões de dólares e 111.000 acionistas. Analisa-sesua estratégia de internacionalização à luz das teorias econômicas, comportamentais eestratégicas e verifica-se que a trajetória internacional pode ser explicada por aspectoscaracterísticos de cada uma dessas teorias. Um traço importante na cultura da empresa é atransferência de seu modelo de negócios, estrutura, valores e tecnologia para as empresasadquiridas, sem deixar de considerar as necessárias adaptações às culturas locais.

  15. Planos privados de assistência à saúde: cobertura populacional no Brasil

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Pinto

    Full Text Available Foram utilizados o Cadastro de Beneficiários da Agência Nacional de Saúde Suplementar (ANS e a Pesquisa Nacional por Amostra de Domicílios (PNAD/IBGE para descrever o perfil da cobertura dos serviços por planos privados de saúde. Apesar da regulação pela ANS, não se deve perder de vista que o acesso, a utilização e a cobertura populacional em planos de saúde precisam ser periodicamente monitorados, principalmente na região Sudeste, que concentra 70% da população coberta por planos de saúde. Também são necessários estudos mais detalhados sobre as capitais brasileiras, que constituem grandes centros de concentração de clientela; e investigações para os subgrupos etários que mais utilizam os serviços de saúde: crianças menores de 5 anos, mulheres em idade fértil e idosos. Os resultados do estudo indicam que, no Sistema de Saúde Brasileiro, os planos privados de assistência à saúde se configuram como mais um fator de geração de desigualdades sociais no acesso e na utilização de serviços de saúde, pois cobrem apenas uma parcela específica da população brasileira: pessoas de maior renda familiar, de cor branca, com maior nível de escolaridade, inseridas em determinados ramos de atividade do mercado de trabalho, moradores das capitais/regiões metropolitanas.

  16. Saúde internacional: alguns aspectos conceituais contemporâneos

    Directory of Open Access Journals (Sweden)

    Villa Tereza Cristina Scatena

    2001-01-01

    Full Text Available Este ensaio consiste em uma reflexão teórica acerca de algumas abordagens contemporâneas de Saúde Internacional, que suscitam o apontamento de questões que merecem ser refletidas e discutidas, permitindo subsidiar a compreensão no campo da Saúde Internacional em seus aspectos conceituais e operacionais, no processo de integração econômico-social das regiões de fronteira.

  17. 出口企业应关注SA8000标准认证

    Institute of Scientific and Technical Information of China (English)

    李志军

    2004-01-01

    @@ 一、SA8000标准的宗旨与主要内容 SA8000标准(Social Accountability 8000)是根据国际劳工组织(ILO)公约、联合国儿童权利公约及世界人权宣言制定的,其宗旨是为了保护劳工基本权益.

  18. Saúde e qualidade de vida de jornalistas: estudo de revisão

    Directory of Open Access Journals (Sweden)

    Regina Zanella Penteado

    2016-06-01

    Full Text Available Objetivo: Realizar revisão sistemática da literatura voltada para a saúde e a qualidade de vida de jornalistas, relacionadas ao trabalho. Métodos: Foram realizadas buscas nas seguintes bases: LILACS, SciELO, Doaj, MEDLINE, Science Direct, Wiley Online Library, Springer Link e Clase. Foram priorizados artigos publicados em periódicos nacionais e internacionais, nos idiomas em português, inglês e espanhol, no período entre 2005 e 2015. O processo de seleção seguiu etapas e critérios pré-definidos do estudo, bem como a aplicação de Testes de Relevância. Resultados: A seleção resultou em oito publicações para revisão. Os aspectos e/ou questões do processo saúde-doença-cuidado de jornalistas, que têm sido enfatizados nas investigações, integram as categorias: saúde vocal/expressividade (três: 37,5%; saúde mental (quatro: 50% e saúde alimentar/nutricional (um: 12,5%; e eles vêm sendo abordados de maneira isolada. Faltam estudos pautados por uma concepção ampliada e abrangente de saúde e qualidade de vida. Conclusão: O estudo mostra a necessidade de pesquisas e investimentos na formação de uma cultura de promoção da saúde e qualidade de vida dos jornalistas, o que pode ocorrer na interdisciplinaridade das áreas de Saúde, Comunicação e Educação, com apoio das entidades de classe da categoria e da mídia.

  19. Análisis factorial confirmatorio del Cuestionario SA-45 en una muestra mexicana

    OpenAIRE

    2012-01-01

    El objetivo de la presente investigación consistió en examinar la estructura factorial, la fiabilidad y los datos normativos del Cuestionario SA-45 (Symptom Assessment-45) en una muestra de estudiantes universi-tarios mexicanos. Como se predijo, los análisis factoriales confirmatorios indicaron que el modelo de nueve factores proporcionaba el mejor ajuste del SA-45. Así mismo, los datos demostraron buenos niveles de fiabilidad (consistencia interna) del cuestionario. Los datos normativos most...

  20. Simultaneous Estimation of Geophysical Parameters with Microwave Radiometer Data based on Accelerated Simulated Annealing: SA

    Directory of Open Access Journals (Sweden)

    Kohei Arai

    2012-07-01

    Full Text Available Method for geophysical parameter estimations with microwave radiometer data based on Simulated Annealing: SA is proposed. Geophysical parameters which are estimated with microwave radiometer data are closely related each other. Therefore simultaneous estimation makes constraints in accordance with the relations. On the other hand, SA requires huge computer resources for convergence. In order to accelerate convergence process, oscillated decreasing function is proposed for cool down function. Experimental results show that remarkable improvements are observed for geophysical parameter estimations.

  1. The Sahel-Doukkala Information Network (SaDIN) – A regional online geoinformation system

    OpenAIRE

    2003-01-01

    A critical necessity to achieve international standards in public health and sustainable development is to monitor the quality of the limited groundwater resources. To provide a basis for any sort of environmental investigations, the SaDIN project creates a knowledge pool in the centre of the Chouaïb Doukkali University, El Jadida (Morocco), in collaboration with the Data Centre of the GeoForschungsZentrum Potsdam (Germany). SaDIN comprises tools for data acquisition, sample collection and mu...

  2. Éthique des médias sociaux et economie de la participation: Vers une nouvelle approche editoriale? Une étude comparative

    Directory of Open Access Journals (Sweden)

    Laurent Fonnet

    2009-01-01

    Full Text Available Dans leur consommation des contenus numériques, les utilisateurs ne sont plus passifs. Ils prennent directement part à la conversation médiatique, qui n’est plus l’apanage des seuls professionnels. Ils deviennent ainsi une force à part entière, productive et critique, surtout à l’égard des professionnels de l’information, lesquels voient leur rôle transformé par l’émergence des médias sociaux. Un processus de co-création peut alors s’instaurer dans la fabrication du contenu. Illustré par la comparaison de trois sites français, Agoravox, Rue89 et LePost.fr, le phénomène encore émergent est ici analysé, à partir de la littérature et sous divers angles, notamment éthique. Dans cette étude exploratoire, les auteurs analysent d’une part les transformations du métier de journaliste: quelle est sa place en effet lorsque les médias deviennent relationnels? Peut-il être encore celui qui concoure à la circulation des idées? D’autre part, ils étudient, puis limitent, les implications éditoriales et éthiques de ce soi-disant journalisme “revenu aux sources”. Ils constatent notamment l’homogénéisation des approches au niveau international; “l’exception française” identifiée ne pourrait donc être que l’illustration d’une phase de transition, avant qu’un paradigme plus proche de celui étudié aux États-Unis ou dans les États nordiques ne s’impose.

  3. La nouvelle Afrique du Sud à la plage ! Usages et fréquentation de trois plages de la péninsule du Cap

    Directory of Open Access Journals (Sweden)

    Hélène Frogneux

    2010-09-01

    Full Text Available Le Cap est souvent considéré comme étant la plus européenne des villes sud-africaines. Sa situation littorale a contribué à en faire à la fois un port majeur et une destination balnéaire prisée, tant par les Sud-Africains que par les visiteurs étrangers. Comme tous les espaces publics, les plages tombaient, sous l’apartheid, sous le coup des lois de ségrégations. Elles sont aujourd’hui théoriquement ouvertes à tous. Mais le décalage entre déségrégation institutionnelle et déségrégation dans les faits est important. Les plages capetoniennes donnent donc un aperçu des grandes tendances à l’œuvre en Afrique du Sud à l’aube de la Coupe du Monde 2010.According to all, Cape Town is the most European of South-African cities. Due to its coastal situation Cape Town is both a major port and an appreciated seaside destination, both by the South-Africans and by the foreign tourists. As was every public space, beaches were segregated under apartheid. Nowadays they are theoretically open to everyone, without distinction of race. But there is a gap between institutional desegregation and the desegregation de facto. Capetonian beaches reflect the mutations and the changes going on at the dawn of the 2010 World Cup.

  4. Servir la Couronne: Les faux-pas du comte de Baños, vice-roi de la Nouvelle-Espagne (1660-1664

    Directory of Open Access Journals (Sweden)

    Ragon, Pierre

    2010-06-01

    Full Text Available Not available.

    A los pocos días de su llegada, el conde de Baños se enfrentó con los habitantes de su Virreinato: le culparon de ser arrogante, despectivo y de llevarse el dinero del rey. Tal concierto de quejas y denuncias en contra de un personaje tan eminente era algo bastante excepcional aunque, sí, no lo era su conducta ¿Cómo explicarlo? Entre la necesaria mano dura que exigiría un contexto difícil y el temperamento peculiar del mismo virrey, aquí se explora una tercera hipótesis, haciendo hincapié en el estatuto peculiar de la familia aristocrática a la que pertenecía y su trayectoria propia. [fr] Peu de temps après son arrivée, le comte de Baños vit se dégrader ses relations avec les habitants de la vice-royauté qu’il administrait: on l’accusa d’être arrogant, méprisant et de voler l’argent du roi. Une telle série d’attaques contre un personnage aussi haut placé était assez exceptionnelle même si ses écarts de conduite n’avaient rien d’inhabituel. Comment expliquer ce paradoxe? On a jusque-là évoqué les difficultés du moment qui exigeaient que le gouvernant se montrât ferme ainsi que le tempérament du vice-roi. Ici, une troisième hypothèse est explorée à partir de la prise en compte du caractère particulier de son statut au sein de l’aristocratie espagnole et de la trajectoire de sa famille.

  5. Kakaibang Halimuyak: Iba't Ibang Imahe ng Pangangapital sa Balintawak

    Directory of Open Access Journals (Sweden)

    Mariah Amour C. Miranda

    2015-06-01

    Full Text Available Ginagalugad ng sanaysay na ito ang isang pangunahing lugar na nadaraanan mula Norte patungong Maynila—ang Balintawak. Nagsisilbing manibela ng pagsusuri ang kontemporaneong pananaw sa lunan bilang pugad ng mga anyong may magkakasalungat na kahulugan. Binibigyang-pansin ng sanaysay ang iba't ibang imahe ng pagbebenta na matatagpuan sa Balintawak: ang billboard ng kumpanyang Bench na siyang pinakamalaki, ang mismong palengke, at ang mga lakong paninda sa tabing-kalsada. Sa pamamagitan nito, maipapakita ng sanaysay kung paano madadalumat ang Balintawak bilang isang panlipunang texto na sumasalamin sa mga magkakaibang pangangapital sa naturang lunan. This essay explores the space of Balintawak—a focal point of urban travel from northern Luzon to Manila. Using the contemporary view on space as a site of structures with contradictory meanings, the study seeks to understand how various images of market activities in Balintawak create meaningful representations. These images include the gigantic billboard of Bench, the central market itself, and flea markets in the area. The essay shows how Balintawak as a social text serves as a trading center of different forms of capital.

  6. Teatro do oprimido em saúde mental: participação social com arte

    Directory of Open Access Journals (Sweden)

    Érika Sales dos Santos

    2016-09-01

    Full Text Available Relato de experiência de intervenção do projeto Teatro do oprimido na saúde mental em um Centro de Atenção Psicossocial (CAPS de Fortaleza, Ceará, Brasil, no qual descrevemos como esta ferramenta é capaz de contribuir para o fortalecimento da participação social. O projeto foi elaborado por um grupo de residentes e preceptores da Residência Integrada em Saúde, com ênfase em Saúde Mental Coletiva, da Escola de Saúde Pública do Ceará. Utilizamos a pesquisa qualitativa. Em face do difícil contexto de efetivação da política de saúde mental no município, percebemos que a arte pode contribuir para a construção de uma atenção em saúde efetiva, emancipatória e apta a acolher as diversidades. Na nossa ótica, o teatro do oprimido é uma ferramenta importante para fortalecer a participação social e para reinventá-la, problematizando estigmas e impulsionando a garantia de direitos.

  7. A finitude humana e a saúde pública Human finitude and public health

    Directory of Open Access Journals (Sweden)

    Sergio Rego

    2006-08-01

    Full Text Available A morte é uma questão implícita na prática e na formação dos profissionais da saúde. Há, todavia, uma tendência dos profissionais de saúde de restringir sua discussão aos aspectos meramente técnicos, seja na assistência à saúde, seja nas ações de saúde pública. Este artigo analisa a importância da adoção do cuidado de qualidade no fim de vida como norteador das práticas assistenciais e a necessidade de que o campo da Saúde Pública tome esses cuidados como objeto de reflexão e de pesquisas. Por fim, aponta-se para aspectos relevantes para a formação de profissionais de saúde para que sejam respeitadores das diferenças e comprometidos com o diálogo.Death is an implicit subject in both health practice and health professionals' training. There is a tendency by health professionals to reduce this analysis merely to technical aspects. This paper analyzes the importance of adopting quality care at the end of life as a guide for public health care. We highlight relevant aspects for training health professionals to respect moral differences and to be prepared to discuss their own points of view.

  8. A proteomic study of rice cultivar TNG67 and its high aroma mutant SA0420.

    Science.gov (United States)

    Lin, Da-Gin; Chou, Szu-Yi; Wang, Arthur Z; Wang, Yi-Wen; Kuo, Shu-Ming; Lai, Chien-Chen; Chen, Liang-Jwu; Wang, Chang-Sheng

    2014-01-01

    Fragrance is a very important economic trait for rice cultivars. To identify the aroma genes in rice, we performed a proteomics analysis of aroma-related proteins between Tainung 67 (TNG67) and its high aroma mutant SA0420. Seventeen of the differentially identified proteins were close related with the aroma phenotype of SA0420. Among them, 9 were found in leaves and 8 were found in grains. One protein (L3) was identified as the chloroplastic glyceraldehyde-3-phosphate dehydrogenase B (OsGAPDHB) which was less abundant in SA0420 than TNG67. Sequence analysis demonstrated that this protein in SA0420 carries a P425S mutation in the C-terminal extension domain, which might hinder the formation of holoenzyme, thereby changing the profile of aroma compounds. The protein profile of OsGAPDHB showed only a weak correlation to its transcription profile. This result indicated that the reduction of OsGAPDHB in SA0420 is regulated by post-translational processes and can only be analyzed by proteomics approach. Transgenic lines suppressing OsGAPDHB through RNAi harbored more fragrance than TNG67 but less than SA0420. With betaine-aldehyde dehydrogenase as the only fragrance gene identified in rice to date, OsGAPDHB may serve as the second protein known to contribute to the aroma phenotype.

  9. Da medicina do trabalho à saúde do trabalhador From occupational medicine to workers' health

    Directory of Open Access Journals (Sweden)

    René Mendes

    1991-10-01

    Full Text Available Ensaio de revisão sobre a evolução dos conceitos e práticas da medicina do trabalho à saúde do trabalhador, passando pela saúde ocupacional. Busca-se responder às seguintes questões: quais as características básicas da medicina do trabalho (na sua origem e na sua evolução; como e por que evoluiu a medicina do trabalho para a saúde ocupacional; por que o modelo da saúde ocupacional se mostrou insuficiente; em que contexto surge a saúde do trabalhador; quais as principais características da saúde do trabalhador.The evolution of the concepts and practice of occupational medicine, occupational health and workers' health is tentatively reviewed. An attemp is made to answer the following questions: what were the major characteristics of occupational medicine throughout its evolution? How and why did occupational medicine evolve into occupational health? Why has the "occupational health model" become inadequate? Writhin what context did workers' health arise? What are the principal characteristics of workers' health?

  10. A inserção da vigilância em saúde ambiental no sistema único de saúde

    Directory of Open Access Journals (Sweden)

    Edenilo Baltazar Barreira Filho

    2012-03-01

    Full Text Available A inserção das atividades de vigilância ambiental no SUS apresenta algumas características que se diferenciam das práticas de vigilância epidemiológica. Isto ocorre principalmente em decorrência de que muitos dados sobre a exposição aos fatores ambientais são obtidos fora do setor saúde e a adoção de ações que busquem controlar e/ou prevenir exigem, na grande maioria dos casos, uma compreensãoe articulação intra e intersetorial, pois o setor saúde não é capaz de, sozinho, dar respostas as questões de saúde ambiental.Nos últimos anos vem consolidando-se cada vez mais o campo da saúdeambiental, que compreende a área da saúde pública, afeita ao conhecimento científico, à formulação de políticas públicas e às correspondentes intervenções (ações relacionadas à interação entre a saúde humana e os fatores do meio ambiente natural e antrópico que a determinam, condicionam e influenciam, com vistas a melhorar a qualidade de vida do ser humano sob o ponto de vista dasustentabilidade(1.Conforme entendimento acordado no I Seminário da Política Nacional de Saúde Ambiental, realizado em outubro de 2005, e consolidado na primeira Conferência Nacional de Saúde Ambiental, realizada em dezembro de 2009, compreende-se como uma área de práticas intersetoriais e transdisciplinares voltadas aos reflexos, na saúde humana, das relações ecogeossociais do homem com o ambiente(1.Nesse sentido, o Ministério da Saúde vem implementando em todo o território nacional um Sistema de Vigilância em Saúde Ambiental (SINVISA, buscando o aprimoramento deste “modelo” de atuação e estabelecendo competências nas três esferas de gestão, com o objetivo de consolidar a prática da Saúde Ambiental dentro do SUS.A Instrução Normativa nº 1, de 7 de março de 2005, cria o SINVISA, estabelece a área de atuação, as competências para as três esferas de Gestão do SUS e define a Vigilância em Saúde Ambiental como sendo

  11. Possibilidades do WHOQOL-bref para a promoção da saúde na estratégia saúde da família

    Directory of Open Access Journals (Sweden)

    Anna Maria Chiesa

    2011-12-01

    Full Text Available A ampliação das ações de promoção da saúde na Estratégia Saúde da Família pode contribuir para a construção da integralidade, mas, ainda persistem lacunas de tecnologias para instrumentalizar os profissionais a analisarem os potenciais de saúde da população. O objetivo deste estudo é sintetizar as contribuições do WHOQOL-bref para instrumentalizar ações de promoção da saúde na Estratégia Saúde da Família. Foi realizada uma metassíntese qualitativa a partir de pesquisas realizadas pelo grupo Modelos tecnoassistenciais e a promoção da saúde com o uso do WHOQOL-bref e sua interface com a promoção da saúde. As sínteses das cinco pesquisas mostraram que existem relações conceituais entre os domínios do WHOQOL-bref e a promoção da saúde, legitimando este como um instrumento para a promoção da saúde. A utilização do WHOQOL-bref pode facilitar o vinculo e o cuidado longitudinal na Estratégia Saúde da Família.

  12. Produção e citação em Saúde Coletiva: um olhar a partir dos periódicos Cadernos de Saúde Pública e Revista de Saúde Pública Output and citation in Public Health: a perspective based on the journals Cadernos de Saúde Pública and Revista de Saúde Pública

    Directory of Open Access Journals (Sweden)

    Leandro Carvalho

    2007-12-01

    Full Text Available O presente trabalho é um estudo bibliométrico comparativo entre as duas principais revistas científicas da área da Saúde Coletiva publicadas no Brasil: Cadernos de Saúde Pública (CSP e Revista de Saúde Pública (RSP. Foram analisados 24 fascículos de cada periódico, publicados entre 1996 e 2003, construindo uma amostra de 819 artigos (496 de CSP e 323 de RSP. Os seguintes elementos dos artigos foram identificados e analisados: área temática do artigo e padrão de citações de publicações (artigos em periódicos, livros e/ou capítulos de livro, teses/dissertações, documentos de Internet, "literatura cinzenta" e outros tipos de publicações. Os dados encontrados mostram que a maioria dos artigos publicados é da subárea "epidemiologia". O padrão de citação identificado nas revistas foi de citações a artigos em periódico em maior número, seguidas das citações a livros e/ou capítulos de livro. Artigos na subárea "ciências sociais em saúde" publicados em CSP apresentam características distintas, com maior número de citações a livros e capítulos. Os autores argumentam que as informações são relevantes na caracterização da produção da área, com desdobramentos importantes no plano da avaliação acadêmico-científica da Saúde Coletiva no país.This is a comparative bibliometric study of the two main scientific journals in the Public Health field in Brazil: Cadernos de Saúde Pública (CSP and Revista de Saúde Pública (RSP. Twenty-four issues of each periodical were analyzed, published from 1996 to 2003, comprising a sample of 819 articles (496 from CSP and 323 from RSP. The following elements in the articles were identified and analyzed: thematic area of the article and citation pattern of publications (articles in periodicals, books and/or book chapters, theses/dissertations, Internet documents, "gray" literature, and other types of publications. The resulting data showed that the majority of the

  13. Challenges of SA 8000 standard implantation: social responsibility at PETROBRAS LUBNOR; Os desafios da implantacao da Norma SA 8000: responsabilidade social na PETROBRAS LUBNOR

    Energy Technology Data Exchange (ETDEWEB)

    Abreu, Monica Cavalcanti Sa de [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Fac. de Economia, Administracao, Atuaria e Contabilidade. Dept. de Administracao de Empresas; Leal Neto, Antenor Gomes de Barros [PETROBRAS S.A., Fortaleza, CE (Brazil). Lubrificantes e Derivados de Petroleo do Nordeste (LUBNOR)

    2004-07-01

    This paper presents the developing steps during the establishment of Social Accountability SA 8000 standards in LUBNOR - a PETROBRAS refining plant at Ceara. The SA 8000 standards have been incorporated to Quality, Environmental, Health and Safety Integrated Management System in accordance with ISO 9001, ISO 14001 and OHSAS 18001. In order to implement the social accountability, the company established a work group task with a mission of communicating, maintaining and promoting some actions with all employees of the Refinery. The biggest challenge of implementing this standard is concerned with the compromise of the supply chain (consisting of suppliers and sub suppliers of products and services), the supervision of the labor task and the adequacy of the management system with the embodying of SA 8000 requisites. New demands were generated, for example: the election of the employee's representative; the celebration of a term of compromise with suppliers; the development of a follow up plan to figure out the supplier's performance; and, the monitoring of extra time worked. The establishment of SA 8000 is a way to stand out the effort at LUBNOR in order to improve the working environment conditions and to consolidate an administration committed with sustainable development and human being improvement. (author)

  14. Significados e sentidos das práticas de saúde: a ontologia fundamental e a reconstrução do cuidado em saúde

    Directory of Open Access Journals (Sweden)

    Tatiana de Vasconcellos Anéas

    2011-09-01

    Full Text Available O cuidado em saúde tem sido um tema abordado atualmente por autores da Saúde Coletiva. Essas práticas e estudos refletem dois modos aparentemente antagônicos de se conceber o cuidado, ora baseado na instrumentalidade, com ênfase nos procedimentos e nas intervenções técnicas, ora com foco na relação de encontro entre profissionais e usuários dos serviços de saúde. A partir de uma leitura crítica desse conjunto de estudos, procura-se não opor os dois grupos identificados, mas articulá-los em sua complementaridade por meio da ontologia fundamental de Martin Heidegger. Em Ser e Tempo, Heidegger desconstrói a ontologia tradicional para reconstruir uma nova ontologia que busque os fundamentos da existência humana. Um retorno aos fundamentos mostra-se essencial para uma reconstrução das práticas de saúde e do cuidado.

  15. Significados e sentidos das práticas de saúde: a ontologia fundamental e a reconstrução do cuidado em saúde

    Directory of Open Access Journals (Sweden)

    Tatiana de Vasconcellos Anéas

    Full Text Available O cuidado em saúde tem sido um tema abordado atualmente por autores da Saúde Coletiva. Essas práticas e estudos refletem dois modos aparentemente antagônicos de se conceber o cuidado, ora baseado na instrumentalidade, com ênfase nos procedimentos e nas intervenções técnicas, ora com foco na relação de encontro entre profissionais e usuários dos serviços de saúde. A partir de uma leitura crítica desse conjunto de estudos, procura-se não opor os dois grupos identificados, mas articulá-los em sua complementaridade por meio da ontologia fundamental de Martin Heidegger. Em Ser e Tempo, Heidegger desconstrói a ontologia tradicional para reconstruir uma nova ontologia que busque os fundamentos da existência humana. Um retorno aos fundamentos mostra-se essencial para uma reconstrução das práticas de saúde e do cuidado.

  16. Tumor imaging with 2 sigma-receptor ligands, F-18-FE-SA5845 and C-11-SA4503 : A feasibility study

    NARCIS (Netherlands)

    van Waarde, A; Buursma, AR; Hospers, GAP; Kawamura, K; Kobayashi, T; Ishii, K; Oda, K; Ishiwata, K; Vaalburg, W; Elsinga, PH

    2004-01-01

    Our objective was to study 2 radioligands for visualization of sigma-receptors with PET. Methods: Two radioligands--sigma(1)-selective C-11-1-(3,4-dimethoxyphenethyl)-4-(3-phenylpropyl)piperazine (C-11-SA4503) and nonsubtype-selective 1-(4-2'-F-18-fluoroethoxy-3-methoxyphenethyl)-4-(3-(4-fluoropheny

  17. Acupuntura e promoção de saúde: possibilidades no serviço público de saúde

    Directory of Open Access Journals (Sweden)

    Maria Elisa Rizzi Cintra

    2010-03-01

    Full Text Available O presente estudo objetivou analisar as possíveis contribuições da Acupuntura aplicada nos serviços públicos de saúde do município de São Paulo para a Promoção da Saúde. Foi utilizada a abordagem qualitativa de pesquisa, com uso de entrevistas em profundidade. Os resultados apontam que a Acupuntura praticada nos serviços públicos permite um trânsito interdisciplinar integrando a percepção do indivíduo sobre si mesmo e seu contexto, possibilitando mudanças nas causas primárias das doenças. Assim, o contato com a Acupuntura praticada nos serviços de saúde da rede municipal de São Paulo mostra-se passível de contribuir para o desenvolvimento de ações de Promoção de Saúde.

  18. Acupuntura e promoção de saúde: possibilidades no serviço público de saúde

    Directory of Open Access Journals (Sweden)

    Maria Elisa Rizzi Cintra

    Full Text Available O presente estudo objetivou analisar as possíveis contribuições da Acupuntura aplicada nos serviços públicos de saúde do município de São Paulo para a Promoção da Saúde. Foi utilizada a abordagem qualitativa de pesquisa, com uso de entrevistas em profundidade. Os resultados apontam que a Acupuntura praticada nos serviços públicos permite um trânsito interdisciplinar integrando a percepção do indivíduo sobre si mesmo e seu contexto, possibilitando mudanças nas causas primárias das doenças. Assim, o contato com a Acupuntura praticada nos serviços de saúde da rede municipal de São Paulo mostra-se passível de contribuir para o desenvolvimento de ações de Promoção de Saúde.

  19. A agência nacional de saúde suplementar - ANS: onze anos de regulação dos planos de saúde

    Directory of Open Access Journals (Sweden)

    Rachel Torres Salvatori

    2012-09-01

    Full Text Available Trata-se de um trabalho com objetivo de apresentar os principais resultados alcançados pela regulação dos planos de saúde exercida pela Agência Nacional de Saúde Suplementar, autarquia instituída para promover o equilíbrio das relações entre operadoras e consumidores, tornando o mercado de planos de saúde mais efi ciente. Como avanços mais significativos oriundos da regulação do setor podem ser citados: as barreiras à entrada e à saída das operadoras no mercado, a ampliação das coberturas assistenciais contratuais, o monitoramento e o controle dos reajustes, a indução a práticas de promoção da saúde e à qualifi cação do setor, e a possibilidade da portabilidade de carências. Como desafios a serem enfrentados, podem ser apontados: o monitoramento da qualidade da assistência prestada, a renúncia fiscal, a existência dos cartões de desconto, a operação de empresas como operadoras de planos de saúde sem o registro na ANS e a adoção de alguns mecanismos nocivos de regulação assistencial pelas operadoras de planos de saúde. ----- The National Agency of Supplementary Health – ANS: eleven years in regulating health insurance plans ----- ABSTRACT ----- This study aims to present the main results achieved in the regulation of health insurance plans through the National Agency of Supplementary Health, an agency set up to promote a balance in the relationship between health insurance plans and their consumers, making the health insurance market more efficient. As examples of the important progress achieved in regulating the sector, the authors emphasize: greater control of the infl ow and outfl ow of service operators in the market; the widening of contractual coverage; monitoring and control of readjustments; encouragement of health promotion practices and increased training in the sector; grace period flexibility. Examples of regulatory gaps however, include: problems monitoring the quality of the care provided

  20. Homens e saúde na pauta da Saúde Coletiva Men and health as targets of the Public Health

    Directory of Open Access Journals (Sweden)

    Lília Blima Schraiber

    2005-03-01

    Full Text Available Apresenta-se a temática "homens e saúde" como questão contemporânea da Saúde Coletiva e produto da interface entre as ciências humanas e a saúde: o caráter social do adoecimento; a perspectiva de gênero como forma particular da relação saúde-sociedade; e a promoção da saúde como conceituação positiva Elabora-se a temática em torno de três eixos de aproximação, sob a perspectiva dos exercícios das masculinidades: saúde sexual e reprodutiva; violência e gênero e morbi-mortalidade em homens. São apontadas as contribuições que estes eixos produzem como esforço empírico para realizar a categoria gênero, ao tempo em que revelam novas problemáticas para a área de saúde: a paternidade, o exercício interativo da sexualidade, a violência interpessoal no âmbito da vida privada, a hiper-masculinidade na violência entre homens, o cuidado de si e o cuidar em saúde para os homens. Estas contribuições permitirão não apenas inserir as masculinidades como questão de saúde, mas renovar as formas de tratamento de homens e mulheres no campo da saúde.It shows the thematic "men and health" as a contemporary matter of the Public Health and interface product among human sciences and health: the social view of illness; the gender perspective as a particular form of the relation health-society and the health promotion while positive means of health. It elaborates the thematic around three approach axises, conformed in the relation between men and health from the perspective of exercises of the masculinity: sexual and reproductive health; violence and gender, and morbid-mortality in men. The contributions that these axises produce are mentioned as empiric effort to accomplish the category gender, the time in which they reveal health new problems to the health's area: the paternity, the interactive exercise of the sexuality, the interpersonal violence in life closet scope, the hipper-masculinity in the violence among men, the

  1. Marimuthu Munien V BMW Financial Services (SA (PTY LTD Unreported

    Directory of Open Access Journals (Sweden)

    C van Heerden

    2009-12-01

    Full Text Available Section 129(1(a read with section 130(1 and 130(3 of the National Credit Act 34 of 2005 (the NCA provides that, as a required procedure before debt enforcement, a credit provider must draw the default to the consumer's notice in writing and propose that the consumer refer the credit agreement to a debt counsellor, alternative dispute resolution agent, consumer court or ombud with jurisdiction, with the intent that the parties resolve any dispute under the agreement or develop and agree on a plan to bring the payments under the agreement up to date. Even though section 129(1(a is silent as to the method by which the default should be brought to the consumer's notice, section 130(1(a provides clarity by requiring the section 129(1(a notice to be delivered. It appears that a credit provider who fails to comply with the provisions of section 129(1(a prior to debt enforcement by means of litigation will be in a procedural predicament as the credit provider will not possess a complete cause of action thus, for instance, rendering the summons excipiable. The crucial question thus appears to be whether or not in a given situation one may say that there was proper compliance with section 129(1(a as this directly affects the existence or absence of a complete and proper cause of action. A number of factors has to be considered in order to address this question, the most important being if the section 129(1(a notice was duly 'delivered'. In this regard two questions are especially relevant:a When exactly can it be said that a section 129(1(a notice was 'delivered' for purposes of the NCA?b Is it necessary for such notice to be received by the consumer in order to constitute proper compliance with the delivery requirement pertaining to section 129(1(a?The above questions were decided on in a recent judgment, Marimuthu Munien v BMW Financial Services (SA (Pty Ltd Case no 16103/08 (KZD (unreported. This article will analyse section 129(1(a of the NCA by inter

  2. Institutos de pesquisa em saúde Health research institutes

    Directory of Open Access Journals (Sweden)

    Erney Plessmann Camargo

    2004-06-01

    Full Text Available Ao fim do século 19, em seguida aos avanços na assepsia cirúrgica e no esclarecimento do papel de microorganismos como causadores de moléstias infecciosas, foram criados em escala mundial "institutos de pesquisa com os objetivos de conduzir pesquisa sobre as causas, prevenção e tratamento de homens e animais e de desenvolver produtos preventivos e curativos como vacinas e antitoxinas". Para atingir esses objetivos os institutos recrutaram os melhores cientistas disponíveis em todos os lugares. Este foi um período fulgurante para a pesquisa sublinhado por inúmeras descobertas sobre as doenças infecciosas. Passada essa fase, os institutos entraram em depressão e até mesmo insolvência. Muitos se recuperaram, alguns não. Muitos ainda sofrem de uma "crise de identidade". Neste ensaio analisamos o destino dos institutos de pesquisa em saúde no Brasil, as causas de seu sucesso e eventuais fracassos e as medidas possíveis de ajudá-los a contornar suas presentes dificuldades.By the end of the 19th century, after the advances in surgical asepsis and the understanding of the role of microorganisms in the etiology of many infectious diseases, research institutes in the public health area were created worldwide with the objectives of undertaking "scientific research into the causes, prevention and treatment of disease in man and animals and to prepare and supply protective and curative materials such as vaccines and antitoxins". To pursue these objectives the institutes hired the best scientists from everywhere. This was an exhilarating period for research in which discoveries proliferated. After that, institutes got into depression and even insolvency. Most recovered, many not. Many are still suffering from an "identity crisis". In this paper we analyze the fate of the health research institutes in Brazil, the causes of their success and eventual failures and the possible ways to get out of their current difficulties.

  3. Concepção de enfermeiros de uma rede pública de saúde sobre Educação para a Saúde

    Directory of Open Access Journals (Sweden)

    Gisele Coscrato

    2013-06-01

    Full Text Available Estudo qualitativo que objetivou conhecer as concepções de 12 enfermeiros assistenciais, que compõem a rede pública de saúde de um município do interior paulista, sobre Educação para a Saúde, e propor ação educativa. Utilizou-se da metodologia da pesquisa-ação. A coleta dos dados ocorreu no segundo semestre de 2009, nas unidades públicas de saúde desse município. Foram usadas as técnicas de observação participante e entrevistas individuais. A análise e interpretação dos dados foi feita por categorização, fundamentada na teoria de Paulo Freire. Como resultados, revelou-se o reducionismo da Educação para a Saúde na abordagem pedagógica que envolvia a transmissão de conhecimentos, contemplando uma tendência biologicista da formação acadêmica. Porém, nos círculos de discussão, presumiu-se o despertar de uma consciência política relacionada à temática e à promoção da saúde. Concluindo, apreendeu-se a necessidade de mudanças na formação, e de viabilizar novos modos de produção de ciência, na busca pela transformação social.

  4. Saúde Mental na Atenção Básica: Sentidos Atribuídos pelos Agentes Comunitários de Saúde

    Directory of Open Access Journals (Sweden)

    Raul Franklin Sarabando de Moura

    Full Text Available Em consideração a normas recentes do Ministério da Saúde, que regulamentam as relações entre a Saúde Mental e a Atenção Básica, esta pesquisa tem por objetivo estudar os sentidos atribuídos pelo ACS à Saúde Mental e suas implicações na prática cotidiana, além de suas percepções sobre as ações do Programa de Residência Multiprofissional em Atenção à Saúde (PRMAS. Trata-se de um estudo qualitativo, segundo o referencial da Hermenêutica de Profundidade,feito através de observação participante e entrevistas semidirigidas. Os resultados alcançados apontam a centralização dos cuidados em Saúde Mental nos CAPS, especialmente através de medicações. Em relação ao PRMAS, percebe-se o papel de matriciamento exercido pela residência, por meio da escuta e acompanhamento do ACS, que encontra situações de sofrimento psíquico em seu cotidiano mas se sente despreparado para lidar com elas. A residência fortalece a integralidade do cuidado, conforme qualifica a atuação do ACS e o orienta em casos difíceis, bem como pode ser um articulador do trabalho, através das iniciativas de aproximação entre os serviços que tem promovido.

  5. Suporte social, promoção de saúde e saúde bucal na população idosa no Brasil

    Directory of Open Access Journals (Sweden)

    Silvânia Suely Caribé de Araújo

    2006-06-01

    Full Text Available O crescente envelhecimento da população mundial, inclusive no Brasil, ressalta a importância de medidas para se lidar com esta situação. No Brasil, a maioria dos idosos é do sexo feminino; vive em domicílios multigeracionais; é referência econômica nos mesmos; possui baixo nível socioeconômico; portadora de, pelo menos, uma doença crônica; independente para realização das atividades da vida diária; não possui dentes, e busca atenção em saúde no SUS. Os idosos brasileiros expostos a situações de vulnerabilidade social estão sujeitos à interferência direta dos determinantes sociais no processo saúde-doença. O Suporte Social inclui políticas e redes de apoio social, que atuam como agente de integração do idoso na sociedade, minimizando os riscos de exclusão social e, conseqüentemente, de danos à sua saúde por meio de medidas de Promoção de Saúde. Este artigo aborda o Suporte Social e alguns de seus aspectos, tais como: tipo e local de residência, transporte e suporte financeiro; em idosos brasileiros e sua relação com a Promoção de Saúde.

  6. Mulheres encarceradas em São Paulo: saúde mental e religiosidade

    Directory of Open Access Journals (Sweden)

    Paulo Augusto Costivelli de Moraes

    2006-01-01

    Full Text Available OBJETIVO: A religião tem um importante papel na vida de indivíduos encarcerados. A saúde mental e a possibilidade de reabilitação parecem ser favorecidas através da religião. Entretanto poucos estudos no Brasil abordaram a saúde mental em população carcerária feminina e a relacionaram com a religiosidade. O objetivo deste estudo é verificar o perfil de saúde mental e a relação entre religião, religiosidade e saúde mental numa amostra de mulheres encarceradas em São Paulo. MÉTODOS: Foram entrevistadas 358 mulheres, detentas da Penitenciária Feminina da Capital (São Paulo-SP. Foi aplicado um questionário amplo que abrangeu dados sociodemográficos e culturais (incluindo a religiosidade, assim como itens sobre saúde mental e perfil criminal. A avaliação psicopatológica foi feita com o General Health Questionnaire (GHQ-12. Análises estatísticas comparando as variáveis com o GHQ-12 foram realizadas. Foi utilizada também a análise de regressão logística multivariada para respostas dicotômicas para as variáveis que possivelmente interagiram com a saúde mental. RESULTADOS: A idade média da amostra foi 30,7 anos ± 8,5. A prevalência de possível caso psiquiátrico foi 26,6%. CONCLUSÕES: Uma maior religiosidade pessoal associou-se a menor freqüência de possível transtorno mental. Não foram encontradas associações entre tipo de crime e saúde mental.

  7. Paism: um marco na abordagem da saúde reprodutiva no Brasil

    Directory of Open Access Journals (Sweden)

    Maria José Martins Duarte Osis

    Full Text Available O Programa de Assistência Integral à Saúde Mulher (PAISM foi lançado pelo Ministério da Saúde em 1983, sendo anunciado como uma nova e diferenciada abordagem da saúde da mulher. Paradoxalmente, o PAISM constitui-se também na primeira vez em que o Estado brasileiro propôs explicitamente, e implantou, embora de modo parcial, um programa que contemplava a regulação da fecundidade. Isso suscitou suspeitas acerca de possíveis intenções ocultas de controle da natalidade. Porém, analisando brevemente a história desse Programa e seu significado social, conclui-se que o PAISM foi pioneiro, inclusive no cenário mundial, ao propor o atendimento à saúde reprodutiva das mulheres, no âmbito da atenção integral à saúde, e não mais a utilização de ações isoladas em planejamento familiar. Por isso mesmo, os movimentos de mulheres, de imediato, passaram a lutar por sua implementação. Seu conteúdo inclui plenamente a definição de saúde reprodutiva adotada pela Organização Mundial da Saúde em 1988, ampliada e consolidada no Cairo em 1994 e em Beijing em 1995. Conseqüentemente, a adoção do PAISM representou, sem dúvida, um passo significativo em direção ao reconhecimento dos direitos reprodutivos das mulheres, mesmo antes que essa expressão ganhasse os diversos foros internacionais de luta.

  8. Planejamento, gestão e ações à saúde do homem na estratégia de saúde da família

    Directory of Open Access Journals (Sweden)

    Leonardo Peixoto Pereira

    2014-12-01

    Full Text Available Objetivo: Analisar a situação do planejamento, da gestão e das ações de saúde diante da perspectiva de implantação da Política de Atenção à Saúde do Homem na Estratégia de Saúde da Família no município de Jequié. Métodos: Tratou-se de um estudo qualitativo. Entrevistaram-se gestores municipais dos serviços de saúde, profissionais de saúde da Estratégia de Saúde da Família e homens com 25 a 59 anos residentes nas áreas adscritas das unidades de saúde estudadas; realizou-se análise documental do Plano de Saúde e Relatórios de Gestão na Secretaria Municipal de Saúde e análise de conteúdo, modalidade temática. Resultados: Não há atividades assistenciais; de prevenção e promoção à saúde masculina desenvolvidas e os processos de implantação da atenção à saúde do homem encontram-se incipientes. Conclusão: É preciso ampliar o diálogo e reorganizar as estratégias de planejamento e gestão para compreender as reais necessidades masculina e articular com os atores envolvidos a implantação das ações de atenção à saúde do homem.

  9. Toplum Ruh Sağlığı Merkezlerinde Hemşirenin Rolü

    OpenAIRE

    İçel, Sema; Özkan, Birgül; Aydoğan, Arzu

    2016-01-01

     Toplum ruh sağlığı merkezleri, ağır ruhsal bozukluğu olan hastalara, toplum temelli ruh sağlığı modeli çerçevesinde bireysel işlevi iyileştirmeye dönük etkin tedaviler sunulması, psikososyal destek hizmetlerinin verilmesi, takip ve tedavilerinin yaşadıkları ortamda, birinci basamak sağlık hizmetlerine entegre biçimde sunulabilmesi için gerekli hizmetlerin yürütüldüğü merkezlerdir.Bir ülkede ruh sağlığı hizmetlerinin etkinliğini sağlayabilmek için, bu ülke bireylerinin ruh sağlığı yönünden ko...

  10. Percepção de gerentes sobre a assistência à saúde coletiva

    Directory of Open Access Journals (Sweden)

    Helena Eri Shimizu

    2002-02-01

    Full Text Available Este estudo tem como objetivo conhecer a percepção de gestores e gerentes dos serviços de saúde sobre a assistência à saúde coletiva no contexto do Sistema Único de Saúde (SUS no Distrito Federal (DF. Trata-se de uma pesquisa qualitativa realizada por meio de entrevistas semi-estruturadas com gestores e gerentes da Regional Norte de Saúde do Distrito Federal. Conclui-se que a implantação dos princípios do SUS ainda é um desafio a ser enfrentado, tanto pela comunidade como pelos profissionais de saúde, que precisam unir esforços para encontrar estratégias que redirecionem a assistência à saúde coletiva.

  11. Prefeitos eleitos, descentralização na saúde e os compromissos com o SUS

    Directory of Open Access Journals (Sweden)

    Lenaura de Vasconcelos Costa Lobato

    Full Text Available O artigo analisa a municipalização na saúde por meio das proposições para a política de saúde de prefeitos eleitos no ano de 2012. Realizou-se análise documental das plataformas de governo dos então candidatos e de documentos oficiais da política e da gestão municipais de saúde - Relatórios das Conferências Municipais de Saúde e Planos Municipais de Saúde - de 24 municípios brasileiros nas cinco regiões do País. Os resultados indicam que os programas das candidaturas, em geral, incorporam a defesa do direito à saúde, embora principalmente através da ampliação da oferta de serviços médicos.

  12. An??lise das percep????es de professores e profissionais de sa??de sobre pr??ticas educativas em sa??de: subs??dios para a estrat??gia integrada de preven????o da dengue.

    OpenAIRE

    Assis, Sheila Soares de

    2012-01-01

    A dengue integra o conjunto de doen??as negligenciadas, constituindo-se como um grave problema de sa??de p??blica em todo o mundo, inclusive no Brasil. A abordagem dos aspectos relacionados ao processo sa??de-doen??a ?? uma responsabilidade partilhada entre os servi??os de sa??de e os de educa????o. No ensino formal, os temas relacionados ?? sa??de devem ser tratados de forma transversal. Entretanto, historicamente a responsabilidade da abordagem deste tema tem reca??do sobre os componentes c...

  13. Políticas de saúde um contexto de saberes para o cuidado na estratégia de saúde da família

    OpenAIRE

    Eulina Patrícia Oliveira Ramos Pires; Maria Andréa Kertész de Souza

    2011-01-01

    Estudo de relato de experiência, das ações cuidativas vivenciadas por enfermeiras na Estratégia de Saúde da Família, cujo objetivo é contribuir no enlace de conhecimentos para o ser-saber-fazer profissional no cuidado à saúde da família. Embasado nas políticas de saúde e na contextualização do atendimento proximal à população como princípio integrador do Sistema Único de Saúde.

  14. O debate sobre educação em saúde no âmbito do Conselho Municipal de Saúde de Vitória, ES, Brasil

    Directory of Open Access Journals (Sweden)

    Welington Serra Lazarini

    2014-12-01

    Full Text Available Analisou-se a relação entre educação em saúde e a política de participação e controle social em saúde da Secretaria Municipal de Saúde de Vitória-ES, Brasil, entre 2005 e 2012. Realizou-se análise documental nos planos municipais de saúde, relatórios de gestão e em 139 atas do Conselho Municipal de Saúde. Evidenciou-se que a gestão orientou sua política pela participação, mas restringiu-se ao Conselho Municipal de Saúde. A educação em saúde foi tratada pontualmente durante as reuniões. Quando debatida, foi como modelo tradicional, configurando-se em estratégia para vigilância. A Educação Popular em Saúde foi mencionada no segundo governo, mas sem a redefinição das práticas. Sinaliza-se a necessidade de reconhecer as diferentes formas de participação social em Vitória e ampliar o debate acerca do modelo dialógico da educação em saúde.

  15. Natural Science and Technology Terminology in the Sesotho sa Leboa Monolingual Dictionary

    Directory of Open Access Journals (Sweden)

    W.M. Mojapelo

    2011-10-01

    Full Text Available

    Abstract: The main purpose of this article is to make a comparative analysis of the structural and the lexical differences between coinage and transliteration, as methods for the acquisition of foreign natural sci-ence and technology lexical items, which are meant for inclusion in the Sesotho sa Leboa comprehensive monolingual dictionary, Pukuntšutlhaloši ya Sesotho sa Leboa. With the exception of the multilingual glossaries ('dictionaries' as they are called, which are compiled by the National Language Service of the Department of Arts and Culture, the Sesotho sa Leboa National Lexicography Unit does not at present have any monolin-gual dictionary specializing in specific subjects like natural science and technology. As a start, the Lexicogra-phy Unit decided to include this specialized terminology in the second edition of its comprehensive monolin-gual dictionary. The main purpose for lemmatizing the natural science and technology terminology is to give these lexical items comprehensive definitions in Sesotho sa Leboa, instead of 'a one word translation defini-tion' as is the case in the bilingual and multilingual dictionaries.

    Keywords: TRANSLITERATION, COINAGE, COINED LEXICAL ITEM, LOAN WORD, ADOPTIVE, FOREIGN WORD, LEXICOGRAPHY, SOTHOIZED WORD, INDIGENOUS WORD, NATURAL SCIENCE, TECHNOLOGY, COMPOUND WORD, AMBIGUITY

    Opsomming: Natuurwetenskaplike en tegnologiese terminologie in die Sesotho sa Leboa eentalige woordeboek. Die hoofdoel van hierdie artikel is om 'n ver-gelykende ontleding te maak van die strukturele en die leksikale verskille tussen nuutskepping en transliterasie as metodes vir die verwerwing van vreemde natuurwetenskaplike en tegnologiese leksikale items wat bedoel is vir insluiting in die Sesotho sa Leboa omvattende eentalige woorde-boek Pukuntšutlhaloši ya Sesotho sa Leboa. Met die uitsondering van die meertalige woordelyste ("woordeboeke" soos hulle genoem word wat deur die Nasionale Taaldiens van die

  16. Quatro tensões na saúde pública

    Directory of Open Access Journals (Sweden)

    Nicolas Lechopier

    2015-04-01

    Full Text Available Este artigo examina a interação da ética, da antropologia social e da epistemologia na saúde pública. Na primeira seção do artigo, introduzimos ao amplo espectro de abordagens existentes que consideram a saúde pública como um campo político, como uma ciência e como um projeto antropológico global que levanta inúmeras questões éticas. Na segunda seção, propomos uma apresentação mais detalhada das principais questões levantadas pela saúde pública através de uma rede de quatro tensões dialéticas fundamentais. A primeira tensão concerne principalmente às dubiedades das definições de saúde e às finalidades propostas para esse campo. A segunda tensão concerne à legitimidade dos meios utilizados para chegar aos objetivos da saúde pública. A terceira tensão diz respeito ao regime de evidência e ao referencial das abordagens empregadas na saúde pública. A quarta tensão se origina nas relações de poder construídas no interior dessas práticas da saúde pública. Sugerimos que essas quatro tensões, nas quais a polarização apresenta uma variedade de formatos, relacionam-se entre si. Isso conduz à conclusão de que na saúde pública, as considerações éticas, antropológicas e epistemológicas precisam andar juntas. Para entender criticamente as questões da saúde pública, precisamos, portanto, levar em conta as íntimas interações entre as ciências, os valores e as práticas.

  17. A segunda crítica social da Saúde de Ivan Illich

    Directory of Open Access Journals (Sweden)

    Roberto Passos Nogueira

    2003-02-01

    Full Text Available Na Nêmesis da Medicina, Ivan Illich expôs os elementos essenciais da sua primeira crítica da saúde, afirmando que a ampla industrialização da saúde e medicalização da vida na sociedade moderna faz aparecer diversas formas de iatrogênese ou danos à saúde, como resultado da perda da capacidade de ação autônoma das pessoas perante a enfermidade, a dor e o envelhecimento. Na segunda crítica social da saúde, Illich trata do surgimento de uma nova iatrogênese social, a iatrogênese do corpo, que resulta de uma espécie de obsessão com a saúde corporal e com sua produção através de atividades físicas, dietas etc. em aparente condição de autonomia. Trata-se de um consumismo do corpo saudável, que responde menos à ação dos médicos e mais às informações difundidas pelos meios de comunicação e pelos agentes terapêuticos não-oficiais.

  18. Para uma análise existencial da saúde

    Directory of Open Access Journals (Sweden)

    Roberto Passos Nogueira

    2006-12-01

    Full Text Available A ontologia fundamental de Heidegger de Ser e Tempo tem servido de fonte de inspiração para investigadores que realizam seus trabalhos nas áreas de saúde mental e saúde coletiva, a despeito das dificuldades de interpretação dessa obra. O entendimento equivocado por Binswanger, na tentativa de transpô-la para a psicanálise, serve de exemplo e é brevemente exposto com base na análise detalhada feita por Loparic. Neste artigo, parte-se do pressuposto de que a linguagem antimetafísica de Heidegger pode ajudar a fechar o que denomina de fenda ontológica entre saúde mental e saúde do corpo. Na primeira parte, recapitulam-se alguns equívocos que podem ser cometidos na interpretação da ontologia heideggeriana e delineiam-se os critérios de não-objetivação e não-determinismo. Na segunda, o autor aporta sua contribuição pessoal, ao explicitar sua própria interpretação da analítica existencial da saúde, articulada em torno de termos, tais como: padecimento, socorro e reatamento.

  19. Necessidades em saúde: questões importantes para o trabalho da enfermagem

    Directory of Open Access Journals (Sweden)

    Edir Nei Teixeira Mandu

    1999-03-01

    Full Text Available A construção de novos parâmetros e práticas em saúde e enfermagem, no sentido do efetivo exercício de direitos sociais, é um desafio posto na atualidade. Este trabalho é uma contribuição ao enfrentamento desse desafio. Olhando para o saber da enfermagem, reflete-se sobre um dado modo de interpretação das necessidades em saúde. A partir de uma discussão acerca das necessidades humanas e de sua relação com o trabalho em saúde, submete-se à crítica a interpretação das necessidades humanas/em saúde presente na teoria de Wanda de Aguiar Horta. Destaca-se na análise a importância da autonomia/autovalorização humana e a interpretação de necessidades a partir da consideração aos sujeitos que recebem-fazem saúde e ao contexto social.

  20. Sampling and sensitivity analyses tools (SaSAT for computational modelling

    Directory of Open Access Journals (Sweden)

    Wilson David P

    2008-02-01

    Full Text Available Abstract SaSAT (Sampling and Sensitivity Analysis Tools is a user-friendly software package for applying uncertainty and sensitivity analyses to mathematical and computational models of arbitrary complexity and context. The toolbox is built in Matlab®, a numerical mathematical software package, and utilises algorithms contained in the Matlab® Statistics Toolbox. However, Matlab® is not required to use SaSAT as the software package is provided as an executable file with all the necessary supplementary files. The SaSAT package is also designed to work seamlessly with Microsoft Excel but no functionality is forfeited if that software is not available. A comprehensive suite of tools is provided to enable the following tasks to be easily performed: efficient and equitable sampling of parameter space by various methodologies; calculation of correlation coefficients; regression analysis; factor prioritisation; and graphical output of results, including response surfaces, tornado plots, and scatterplots. Use of SaSAT is exemplified by application to a simple epidemic model. To our knowledge, a number of the methods available in SaSAT for performing sensitivity analyses have not previously been used in epidemiological modelling and their usefulness in this context is demonstrated.

  1. Refletindo sobre valores éticos da Saúde Global

    Directory of Open Access Journals (Sweden)

    Paulo Antonio de Carvalho Fortes

    2015-06-01

    Full Text Available Desde as últimas décadas do século passado vem sendo construído o campo da saúde global, enfocando questões de saúde supraterritoriais, que extrapolam as fronteiras nacionais, assim como seus determinantes e suas possíveis soluções. Este ensaio objetiva refletir sobre os valores éticos envolvidos na saúde global: justiça social, equidade e solidariedade. Procedeu-se à revisão de artigos científicos e documentos de agências multilaterais. Identificou-se a defesa da saúde global como um bem universal público, analisando os valores da justiça e da equidade com enfoque na alocação e distribuição de recursos, com tendência a priorizar os mais desfavorecidos. São apresentados conceitos de solidariedade, buscando compreender se há a responsabilidade moral de ser solidário com pessoas de outros países, o que justificaria a cooperação internacional na saúde.

  2. Sampling and sensitivity analyses tools (SaSAT) for computational modelling.

    Science.gov (United States)

    Hoare, Alexander; Regan, David G; Wilson, David P

    2008-02-27

    SaSAT (Sampling and Sensitivity Analysis Tools) is a user-friendly software package for applying uncertainty and sensitivity analyses to mathematical and computational models of arbitrary complexity and context. The toolbox is built in Matlab, a numerical mathematical software package, and utilises algorithms contained in the Matlab Statistics Toolbox. However, Matlab is not required to use SaSAT as the software package is provided as an executable file with all the necessary supplementary files. The SaSAT package is also designed to work seamlessly with Microsoft Excel but no functionality is forfeited if that software is not available. A comprehensive suite of tools is provided to enable the following tasks to be easily performed: efficient and equitable sampling of parameter space by various methodologies; calculation of correlation coefficients; regression analysis; factor prioritisation; and graphical output of results, including response surfaces, tornado plots, and scatterplots. Use of SaSAT is exemplified by application to a simple epidemic model. To our knowledge, a number of the methods available in SaSAT for performing sensitivity analyses have not previously been used in epidemiological modelling and their usefulness in this context is demonstrated.

  3. A diversidade cultural presente nos vídeos em saúde

    Directory of Open Access Journals (Sweden)

    Alice Ferry de Moraes

    2008-12-01

    Full Text Available Os vídeos, cada vez mais, são utilizados como suportes informacionais nas ações de intervenção social na área da saúde. Conhecer os elementos culturais existentes nos vídeos em saúde foi o objetivo deste trabalho, pois eles são facilitadores da transferência da informação. Estudos sobre o uso da informação em saúde no país, a força das imagens no processo cognitivo dos indivíduos e a necessidade de contextualização das informações repassadas serviram de base para a análise dos vídeos finalistas da III Mostra de Vídeos em Saúde, promovida pela Fundação Oswaldo Cruz (Fiocruz e realizada no Rio de Janeiro, em 1998. Com base na observação de alguns dados das fichas técnicas desses vídeos, foi possível identificar o meio cultural no qual eles foram produzidos. A diversidade cultural presente nas ações comunicacionais em todos os âmbitos, inclusive na promoção da saúde e na prevenção de doenças, é um elemento essencial para o progresso social.

  4. 保险企业,你了解SA8000吗?

    Institute of Scientific and Technical Information of China (English)

    吴慧

    2006-01-01

    SA8000是企业社会责任标准(Social Accoutability 8000)的简称。SA8000是继ISI9000、ISO14000之后出现的又一个涉及体系的重要的国际性认证标准。SA8000认证就是依据该标准的要求审查、评价组织是否与保护人类权益的基本标准相符。尽管SA8000标准不是ISO标准。但由于它得到代表全球广泛利益的公司和组织的支持,加上公众和消费者对全球社会责任的压力,SA8000认证得到高度的认可。

  5. Uma experiência em comunicação e saúde

    Directory of Open Access Journals (Sweden)

    Marina Ruiz de Matos

    2009-12-01

    Full Text Available Este trabalho refere-se à experiência desenvolvida no município de Guarulhos, sob o patrocínio do Ministério da Saúde, com o objetivo de envolver radiocomunicadores no processo educativo em saúde. Organizaram-se oficinas de trabalho com a participação de funcionários dos serviços municipais de saúde e de radialistas das rádios comunitárias das mesmas áreas de abrangência, para reflexão, discussão e elaboração de ações conjuntas sobre temas de saúde. Desenvolveu-se metodologia que articulou, além de textos acadêmicos, outros tipos de linguagem como pintura, música, radionovela, poesia etc., na abordagem dos assuntos. A avaliação final constou de um questionário preenchido pelos participantes e a análise das respostas indicou tratar-se de uma metodologia compatível com os objetivos de alcançar envolvimento e desenvolver parcerias entre comunicadores, serviços de saúde e comunidade.

  6. Intervenções Psicossociais para Promoção da Saúde do Homem em Unidade de Saúde da Família

    Directory of Open Access Journals (Sweden)

    Luiz Gustavo Silva Souza

    Full Text Available Este relato de experiência profissional busca contribuir a responder a questão: Como promover a saúde do homem na Atenção Primária à Saúde? São descritas duas estratégias implantadas em uma Unidade de Saúde da Família de Vitória, ES, as "Ações de Sábado" e o "Grupo de Homens". Cada "Ação de Sábado" é realizada trimestralmente, em um sábado pela manhã, com duração de quatro horas, contando com atividades recreativas e de educação em saúde (discussões sobre doenças sexualmente transmissíveis, por exemplo. O "Grupo de Homens" é realizado semanalmente, com duração de 1h15min, com exposições dialogadas (sobre problemas com o álcool, por exemplo e com oficinas terapêuticas. No período de setembro de 2011 a julho de 2013, as intervenções envolveram cerca de 230 homens de classe popular. Os conceitos de clínica ampliada e atitude psicoterapêutica são utilizados para promover a expressão dos usuários e a corresponsabilização com o processo saúde-doença. Dentre os resultados, destacam-se: o aumento da presença masculina na USF, a melhoria do cuidado dirigido a condições crônicas (especialmente hipertensão, diabetes e problemas com o álcool/alcoolismo e o fortalecimento de comportamentos de redução de danos. Conclui-se que as intervenções são proveitosas para abordar desafios relativos à Saúde do Homem.

  7. Representações sociais da educação em saúde pelos profissionais da equipe de saúde da família

    Directory of Open Access Journals (Sweden)

    Maria Flávia Carvalho Gazzinelli

    Full Text Available Este estudo discute a forma como os profissionais da equipe de saúde da família pensam e representam a educação em saúde e a prática educativa que realizam. Os sujeitos da pesquisa (n=248 - médico, enfermeiro, auxiliar de enfermagem e agente comunitário de saúde de 20 unidades básicas de saúde de Belo Horizonte - foram entrevistados mediante a utilização da técnica de evocação livre e da teoria das representações sociais. Solicitou-se aos sujeitos que verbalizassem cinco palavras que lhes ocorressem imediatamente em relação à educação em saúde, classificando-as em positiva ou negativa. Utilizou-se o software Evoc e calculou-se a frequência simples de ocorrência, a média ponderada de ocorrência em função da ordem de evocação e a média das ordens ponderadas do conjunto dos termos evocados. Construiu-se o quadro de quatro casas composto do núcleo central, elementos de contraste e periféricos da representação. Médicos e enfermeiros compartilham conteúdos representacionais entre si, expressando representações sociais similares, ao apresentarem nos possíveis núcleos centrais 'capacitação' e 'prevenção'. Auxiliares de enfermagem e agentes comunitários de saúde se assemelham por meio dos possíveis elementos centrais 'educação' e 'prevenção'. O foco recai na transmissão de orientações com o objetivo de persuadir os indivíduos à adoção de modos de vida saudáveis.

  8. Desafios e possibilidades no exercício da preceptoria do Pró-PET-Saúde

    Directory of Open Access Journals (Sweden)

    Patrícia Acioli de Barros Lima

    2015-12-01

    Full Text Available O Sistema Único de Saúde (SUS e as Diretrizes Nacionais de Educação (DCNs direcionam o cuidado e a formação em saúde. Para fazer essa integração, o Ministério da Educação e o Ministério da Saúde criaram o Programa Nacional de Reorientação da Formação Profissional em Saúde (Pró-Saúde e o Programa de Educação pelo Trabalho para Saúde (PET/Saúde, que necessitam de preceptores aptos a gerir suas práticas. O objetivo deste trabalho foi analisar os desafios e as possibilidades no exercício da preceptoria do Pró-PET-Saúde. Os sujeitos foram trinta preceptores do Pró-PET-Saúde/Ufal. O instrumento utilizado para a coleta dos dados foi a entrevista semiestruturada, e esses foram analisados por meio da análise de conteúdo. Os resultados indicam que as possibilidades seriam: o trabalho interprofissional, reavaliar as práticas e a contribuição com a formação. Entre os desafios, estão: o despreparo pedagógico, trabalho interprofissional e a deficiência na infraestrutura.

  9. Educação para a saúde a grupo de obesos

    Directory of Open Access Journals (Sweden)

    Glaci de Oliveira Pinto Vargas

    1983-03-01

    Full Text Available Este trabalho foi realizado por enfermeiras que atuam a nível ambulatorial, num Programa de Adulto, no Serviço de Saúde Pública, de um hospital geral de Porto Alegre, RS. É uma contribuição original de uma pesquisa descritivo analítica, com grupos de clientes obesos, atendidos através de cursos de educação para a saúde. Pretende-se avaliar quatro aspectos sem ordem de prioridade: a interesse da clientela pela educação da saúde, em grupo; b impressão, em relação aso conteúdos desenvolvidos; c redução do peso; d mudança de algum hábito de vida.

  10. A construção coletiva da Biblioteca Virtual em Saúde

    Directory of Open Access Journals (Sweden)

    Abel Laerte Packer

    2005-08-01

    Full Text Available Retoma-se a origem da Biblioteca Virtual em Saúde (BVS como produto da evolução do programa de cooperação técnica em informação científica em saúde na América Latina e no Caribe. Analisa-se sua conformação tecnológica como produto da reestruturação da comunicação científica promovida pela internet, destacando o aprimoramento conceitual e operacional do modelo de gestão coletiva de informação e conhecimento no espaço virtual e os desafios de promover o acesso e uso democráticos da informação e do conhecimento atualizado nos processos que envolvem a saúde coletiva e individual.

  11. Saber e fazer: a tecitura da rede em saúde

    Directory of Open Access Journals (Sweden)

    Bellini, Maria Isabel Barros

    2004-01-01

    Full Text Available A emergência das Novas Tecnologias da Informação e Comunicação (NTIC impõe respostas dos profissionais da saúde que contemplem as transformações substanciais vividas pela sociedade. Esse contexto é abordado, aqui, como um dos cenários das necessidades humanas. A pesquisa “Rede de Recursos Humanos da SES em Nível de Especialização, Mestrado e Doutorado”, coordenada pelo Serviço Social na ESP, tem como objetivo anunciar alguns aspectos dessa realidade em redes virtuais. Para tanto, resgata alguns aspectos da história da saúde no Brasil, encadeando a evolução das tecnologias do conhecimento. Ao final, salienta as perspectivas vislumbradas até o momento, com esta estratégia de ação e reflexão sobre a saúde

  12. Bacharel em Saúde Coletiva: um Elo que faltava na Rede

    Directory of Open Access Journals (Sweden)

    Antônio José Costa CARDOSO

    2013-11-01

    Full Text Available O desafio deste último texto é, sem outras referências, fazer “emergir” um (incerto Discurso do Sujeito Coletivo – aqui referido ao conjunto de autores que assina esse número especial da Tempus Actas em Saúde Coletiva, a partir de um diálogo que se pretende articulador das ideias dos diversos autores que trataram da criação dos bacharelados, mercado de trabalho e carreira, identidade e regulamentação da profissão, campos de prática e estágio em Saúde Coletiva, tomando o texto-base Graduação em Saúde Coletiva: conquistas e passos para além do sanitarismo, de Jairnilson Silva Paim e Isabela Cardoso Pinto, como ponto de partida.

  13. Financiamento do Sistema Único de Saúde nos governos FHC, Lula e Dilma

    Directory of Open Access Journals (Sweden)

    Adilson Soares

    Full Text Available O artigo discute questões relativas ao financiamento e à alocação de recursos no SUS, no contexto de dois projetos políticos distintos. O estudo analisa os gastos com saúde no Brasil, no período de 1995 a 2012, comparados aos gastos internacionais, ao PIB e a Receita Corrente Bruta. Na análise, buscou-se comparar os compromissos assumidos com o SUS nas gestões dos presidentes FHC, Lula e Dilma. Observou-se que, com relação ao comportamento dos gastos com saúde, no âmbito federal, os governos do Partido dos Trabalhadores não diferiram dos governos do Partido da Social Democracia Brasileira. O perfil dos gastos com saúde não deu conta de atender ao sonho da reforma sanitária dos anos 1980.

  14. Implicit Volatility versus Statistical Volatility: an Exercise Using Options and Telemar S.A. Stock

    Directory of Open Access Journals (Sweden)

    Marcelo Savino Portugal

    2004-06-01

    Full Text Available The main goal this article was to find the best way of making forecast about future volatility using implicit or statistic forecast. The work is based on Telemar S.A. shares data from 21/09/1998 to 21/10/2002 and Telemar S.A. shares data from 2/10/2000 to 21/10/2002. The implicit volatility was obtained using back-out procedure from the Black-Scholes model. The statistics forecasts were obtained using weighted moving average models, GARCH, EGARCH and FIGARCH models. The Wald statistic shows that EGARCH and FIGARCH models are efficient and are not biased forecasts for Telemar S.A. absolute variation between t and t + 1. The volatility evaluation during the maturity time of an option, rejects the hypothesis that implicit volatility is the best forecast to future volatility and the Wald statistic show that FIGARCH model is an efficient and not biased forecast.

  15. O papel do enfermeiro de saúde publica: projeções no ensino

    Directory of Open Access Journals (Sweden)

    Bertha Cruz Enders

    1995-09-01

    Full Text Available Analisa-se o papel do enfermeiro em saúde pública no contexto do ensino, como ponto de partida para uma avaliação da prática. Objetivou-se 1 Identificar o papel do enfermeiro em saúde pública projetado nos conteúdos programáticos das disciplinas de saúde pública do Curso de Enfermagem na Universidade Federal do Rio Grande do Norte desde sua implantação em 1974 até 1990 e, 2 Avaliar as concepções projetadas no ensino frente a realidade das práticas dos egressos. Conceptualizações da teoria de papeis nortearam o entendimento do termo "papel" e do processo de internalização do conceito. Utilizou-se uma abordagem qualitativa com triangulação na coleta de dados. Dados foram obtidos em duas fontes: nos conteúdos programáticos do Curso e nas opiniões dos enfermeiros egressos do Curso. Técnicas de análise documental foram aplicadas a 70 programas de disciplinas de Saúde Pública e uma amostra aleatória estratificada de 60 enfermeiros foi entrevistada utilizando um questionário específico. Os dados foram analisados à luz da teoria de papeis para a identificação do conceito. Em seguida, se analisou o conceito com base nas políticas de saúde vigentes da época em estudo. Os resultados demonstram que o papel do enfermeiro em saúde pública projetado nos conteúdos focaliza funções múltiplas, assistenciais educativas e administrativas dentro de uma visão preventiva. O objetivo da enfermagem em saúde pública tem sido a prevenção, dentro de uma prática de assistência primária e mais recentemente, dentro de uma perspectiva de mudança e de transformação das questões sociais e das políticas de saúde. Focaliza o enfermeiro planejador, competente nas técnicas epidemiológicas. A percepção dos egressos é também preventiva e focaliza o papel educador e conscientizador do enfermeiro, embora pouco avanço se observa com relação às questões sociais da população. Existe uma incompatibilidade entre os

  16. O fazer da enfermeira no sistema local de saúde: individual ou coletivo?

    Directory of Open Access Journals (Sweden)

    Marluce Maria Araújo Assis

    1996-09-01

    Full Text Available Este ensaio consiste em uma reflexão teórica acerca do fazer da enfermeira no Sistema Local de Saúde (SILOS, permitindo compreender (ainda que provisoriamente se o espaço que vem sendo ocupado pela mesma, na "porta de entrada" dos serviços de saúde, tem possibilitado uma construção ideológica de sua ação social, enquanto sujeito coletivo ou individual. Assim, procuramos nos pautar teoricamente no pensamento de Testa (1995 e apontamos o SILOS, enquanto um espaço social de transformação do Sistema de Saúde. Discutimos também, as relações vivenciadas no cotidiano da organização institucional, tentando entender o processo de produção de sujeitos sociais, focalizando a enfermeira nesta construção.

  17. Electro-generation of TGA by Ni-mSA-mCS bipolar membrane

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Ni-mSA-mCS bipolar membrane (BM) was prepared by sodium alginate (SA) and chitosan (CS), which were modified by Ca2+and glutaraldehyde as linking reagents, respectively. mSA-mCS membrane was characterized by FTIR, SEM, TG and used as a separator in the electrolysis cell to produce thioglycolic acid (TGA). The experiment results show that TGA was prepared effectively by electro-reduction of dithiodiglycolic acid (DTDGA) with the mixture of TGA and DTDGA in the cathodic chamber. The current efficiency was up to 66.7% at the room temperature (25 ℃) during the current density of 10 mA/cm2. Compared with the traditional metal reduction method, the electro-reduction technology saves the zinc powder and eliminates the pollution to environment.

  18. Psicologia da saúde : articulações entre vida e política

    OpenAIRE

    Bernardes,Anita Guazzelli

    2016-01-01

    O objetivo deste artigo é pensar a Psicologia da Saúde a partir de articulações entre vida e política. O foco da discussão está em um exercício que permita considerar vida e política para problematizar a relação entre Psicologia e Saúde, efetuando uma certa torção no pensamento. O campo de análise ampara-se na Psicologia Social, mais especificamente no pós-estruturalismo, em um diálogo com a Filosofia. Pensar com a vida na Psicologia da Saúde é considerar uma orientação, uma figura de pensame...

  19. Atlas mundial da saúde Atlas mondial de la santé

    OpenAIRE

    Ligia Vizeu Barrozo

    2009-01-01

    O Atlas é de autoria de Zoé Vaillant, mestre de conferências da Universidade Paris-Ouest-Nanterre-La Défense e membro do laboratório Espaço, Saúde e Territórios e de Gérard Salem, professor de geografia da saúde da Universidade Paris-Ouest-Nanterre-La Défense e coordenador do laboratório Espaço, Saúde e Territórios. Cécile Marin, responsável pela cartografia do Atlas, é geógrafa-cartógrafa, formada pela Universidade d’Orléans.O Atlas mondial de la santé faz parte da série Collection Atlas/Mon...

  20. Atlas mundial da saúde Atlas mondial de la santé

    Directory of Open Access Journals (Sweden)

    Ligia Vizeu Barrozo

    2009-06-01

    Full Text Available O Atlas é de autoria de Zoé Vaillant, mestre de conferências da Universidade Paris-Ouest-Nanterre-La Défense e membro do laboratório Espaço, Saúde e Territórios e de Gérard Salem, professor de geografia da saúde da Universidade Paris-Ouest-Nanterre-La Défense e coordenador do laboratório Espaço, Saúde e Territórios. Cécile Marin, responsável pela cartografia do Atlas, é geógrafa-cartógrafa, formada pela Universidade d’Orléans.O Atlas mondial de la santé faz parte da série Collection Atlas/Mon...

  1. Proceso de internacionalización de las empresas Compañía Licorera de Nicaragua, S.A. y Kraft Foods Nicaragua, S.A

    Directory of Open Access Journals (Sweden)

    Aurora Margarita Saravia

    2006-08-01

    Full Text Available AUNQUE NICARAGUA ES UN PAÍS SUBDESARROLLADO Y POBRE, fundamenta sus expectativas de crecimiento y desarrollo en la exportación, especialmente desde la firma de diferentes Tratados de Libre Comercio. Sin embargo, son pocas las empresas nacionales que han logrado competir con éxito en los mercados internacionales. Entre ellas, se encuentran la Compañía Licorera de Nicaragua, S.A. y Kraft Foods de Nicaragua, S.A. El éxito del proceso de internacionalización depende de muchos factores, incluyendo la decisión de aventurarse en el extranjero. El punto clave está en aprovechar las ventajas competitivas de cada empresa y enfocarlas para obtener productos y servicios de calidad que son los pilares del éxito. El éxito internacional de estas tres empresas se analiza en este trabajo para dar a conocer su experiencia

  2. Atenção Primária à Saúde: elementos de continuidade e mudanças na saúde do Distrito Federal

    Directory of Open Access Journals (Sweden)

    Helder Kiyoshi Kashiwakura

    Full Text Available RESUMO A Atenção Primária à Saúde (APS ocupa lugar de destaque na agenda governamental. Os objetos do estudo são o sistema de saúde do Distrito Federal e as iniciativas para reorganização da APS, com objetivo de analisar o comportamento dos gastos em busca de elementos de continuidade e mudanças nessa política, no período de 2005 a 2014. Adotou-se a pesquisa documental com foco em dados do Sistema de Informações sobre Orçamentos Públicos. Partindo do neoinstitucionalismo histórico, os resultados apontam contradição entre o discurso em defesa da APS e a manutenção das elevadas despesas com assistência hospitalar, testemunhando a característica de path dependence.

  3. Justiça social e equidade em saúde: uma abordagem centrada nos funcionamentos

    Directory of Open Access Journals (Sweden)

    Carlos Dimas Ribeiro

    2015-12-01

    Full Text Available Trata-se de um ensaio de natureza teórica que objetiva defender uma concepção de justiça social voltada aos funcionamentos dos indivíduos, articulando a discussão da justiça com o debate sobre equidade em saúde. Na introdução, são discutidas as circunstâncias da justiça, abordando a questão da escassez dos recursos no campo da saúde. No primeiro item, analisa-se a noção da equidade em saúde, apresentando os principais enfoques abordados, em particular o conceito de equidade em saúde proposto por Margaret Whitehead, amplamente utilizado na saúde coletiva. No segundo item, apresenta-se, brevemente, a Abordagem das Capacitações desenvolvida por Amartya Sen e Martha Nussbaum, que recuperam a noção aristotélica de funcionamento. Ao final, critica-se essa abordagem e defende-se a Perspectiva dos Funcionamentos (PF, proposta por Maria Clara Dias, aplicada ao campo da saúde. Dessa forma, os concernidos da justiça são sistemas funcionais e o que se quer igualar para propósitos de justiça é a integridade funcional dos seres vivos. São apresentadas algumas vantagens dessa perspectiva, considerada aquela que melhor preenche os requisitos de uma concepção de justiça extensiva a todos no Brasil.

  4. Velhice, incapacidade e cuidado na saúde pública

    Directory of Open Access Journals (Sweden)

    Karla Cristina Giacomin

    2015-12-01

    Full Text Available Resumo O envelhecimento populacional modifica profundamente o escopo de atuação da saúde coletiva, altera o perfil de morbimortalidade e aumenta a demanda por cuidados crônicos. Na população idosa, a incapacidade serve como indicador de saúde e balizador de ações e políticas. Esta pesquisa de abordagem qualitativa, fundamentada na antropologia interpretativa e na perspectiva êmica, tem por objetivo compreender a forma de pensar e agir dos idosos diante da “velhice com incapacidade” e suas relações com a saúde pública. Foram realizadas entrevistas individuais no domicílio, com roteiro semiestruturado, junto a 57 idosos residentes na cidade, inclusive participantes da coorte de Bambuí. A metodologia de Signos, Significados e Ações orientou a coleta e a análise dos dados, possibilitando a investigação antropológica das representações e comportamentos concretos associados à incapacidade na velhice na cultura local. Emergiram da análise duas categorias acerca das relações entre velhice, incapacidade e cuidado na saúde pública: experiências de cuidado na velhice com incapacidade; o medo da falta de cuidados. Os resultados revelam que a saúde pública precisa rever seus conceitos sobre incapacidade na velhice e incorporar a dimensão funcional da saúde e o cuidado à velhice com incapacidade na agenda.

  5. Promoção de Saúde e a Funcionalidade Humana

    Directory of Open Access Journals (Sweden)

    Ana Cristhina de Oliveira Brasil

    2013-03-01

    Full Text Available Para a elaboração de políticas públicas de saúde no Brasil, dois aspectos devem ser levados em consideração, a saber, a transição demográfica e a transição epidemiológica. Cada vez mais, observa-se um aumento no número de pessoas idosas convivendo com inúmeras incapacidades e, ainda, um perfil epidemiológico. A Pesquisa Nacional por Amostra de Domicílios (PNAD 1998-2003 indica uma distribuição de doenças crônicas que, consequentemente, tem gerado um número expressivo de incapacidades. Essas pessoas com incapacidades necessitam dos serviços de saúde, e os utilizam quando conseguem ter acesso a eles. Contudo, os modelos vigentes de atenção à saúde do idoso ou à saúde das pessoas com deficiência são de alto custo e, em alguns aspectos, não se apresentam eficientes, demandando estratégias de prevenção e equipamentos de saúde destinados à manutenção ou recuperação da saúde de uma população mais envelhecida. Desse modo, a agenda de política pública do Brasil deveria priorizar a manutenção da funcionalidade dos idosos, com monitoramento das condições de saúde, ações preventivas específicas de saúde e educação, e cuidados buscando uma atenção multidimensional e integral, não necessariamente centrada na doença(1.A necessidade de se elaborar políticas e estratégias, em especial de promoção de saúde, com um olhar descentralizado da doença se justifica porque os problemas de saúde advêm não somente de doenças, mas de qualquer outra condição ou circunstância de saúde, tais como agravos, gravidez, envelhecimento, estresse, predisposição genética – todas classificadas pela CID-10, contudo, sem poder mensurar as mudanças de estado relativas à condição de saúde, e muito menos classificar para descrever o contexto em que esses problemas acontecem, o que dificulta e compromete o planejamento e a resolubilidade das ações e dos serviços em saúde, diferentemente dos dados por

  6. Caminhada e gastos com saúde em adultos usuários do sistema público de saúde brasileiro: estudo transversal retrospectivo

    Directory of Open Access Journals (Sweden)

    Bruna Camilo Turi

    2015-11-01

    Full Text Available A inatividade física é um dos maiores desafios à saúde pública devido à sua associação com doenças crônicas e ao impacto econômico sobre o sistema público de saúde. Entretanto, a prática de caminhada pode auxiliar a amenizar esses problemas. Objetivo Verificar se existem associações entre prática de caminhada no lazer, presença de fatores de risco e gastos relacionados ao uso de serviços de saúde em usuários do sistema público de saúde brasileiro. Metodologia A amostra foi composta por 963 adultos. A prática de caminhada foi avaliada a partir de questionário de Baecke. Gasto com tratamento/ano foi avaliado pela demanda por serviços registrados nos prontuários clínicos. Resultados Prática de caminhada como atividade física de lazer foi referida por 64,4% dos participantes. Os grupos de maior prática de caminhada apresentaram menores valores para idade, IMC, CC e gastos com medicamentos. Indivíduos inseridos na categoria de maior envolvimento apresentaram 41% menos chances de estarem inserido no grupo de maior gasto total (OR=0.59; IC95% 0.39-0.89. Conclusão Verificou-se que a prática de caminhada como atividade física de lazer foi a mais frequente para a maioria dos usuários do SUS, a qual foi associada a menores gastos com medicamentos e no total.

  7. A promoção da saúde no ensino profissional: desafios na Saúde e a necessidade de alcançar outros setores

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Lobato Tavares

    2016-06-01

    Full Text Available Resumo O artigo discute a natureza dinâmica e complexa da promoção da saúde, o que requer formação profissional que facilite formular e colocar em prática seus princípios teóricos e metodológicos mediante contínua reflexão sobre as contradições dos contextos e a necessidade de enfrentamento dos desafios e expectativas das comunidades nos territórios. Considera também outro desafio que se coloca no trabalho em saúde, que é a mediação/ação intersetorial para implementação do seu conceito ampliado. Assim, demanda uma formação baseada em competências, o que significa um conjunto de atitudes e saberes para viabilizar a capacidade de agir em determinada situação. Apresenta duas experiências de ensino desenvolvidas no Brasil que tem contribuído na formação profissional em saúde, na perspectiva da promoção: a do Programa de Pós-graduação stricto sensu, em Promoção de Saúde da Universidade de Franca e a do Programa de Pós-graduação lato sensu da ENSP/Fiocruz. Em ambas, o uso de metodologias problematizadoras instrumentalizam a construção de capacidades, possibilitando que a teoria se aproxime da prática e proporcione uma formação crítica e reflexiva com rigor científico e relevância temática.

  8. O olhar das representações indigenas sobre a sua saúde e a interface com o subsistema de saúde indigena

    Directory of Open Access Journals (Sweden)

    Maria Elvira TOLEDO

    2013-12-01

    Full Text Available O movimento indígena acreano tem uma trajetória de mais de 20 anos, atuando em debates locais, regionais e nacionais sobre a política de saúde indígena; em mobilizações políticas para reivindicar direitos; participando das instâncias de controle social na saúde e atuando também na gestão de projetos com financiamento não governamental ou em parceira com o governo federal, através da administração terceirizada dos Distritos Sanitários Especiais Indígena (DSEIs. Apesar disso, na primeira década da implantação do Subsistema de Saúde Indígena, muitos obstáculos tiveram que ser enfrentados pelas associações indígenas para se apropriar dos meandros da política de participação e controle social e esforços foram investidos para melhorar sua participação neste setor.

  9. [SciELO Public Health: the performance of Cadernos de Saúde Pública and Revista de Saúde Pública].

    Science.gov (United States)

    Barata, Rita Barradas

    2007-12-01

    The aim of this paper was to analyze two Brazilian scientific journals included in the SciELO Library of Public Health, using a group of bibliometric indicators and scrutinizing the articles most viewed. Cadernos de Saúde Pública was accessed 3,743.59 times per month, with an average of 30.31 citations per article. The 50 articles most viewed (6.72 to 524.5 views) were mostly published in Portuguese (92%). 42% were theoretical essays, 20% surveys, and 16% descriptive studies. 42% used argumentative techniques, 34% quantitative techniques, 18% qualitative techniques, and 6% mathematical modeling. The most common themes were: health and work (50%), epidemiology (22%), and environmental health (8%). Revista de Saúde Pública was accessed 1,590.97 times per month, with an average of 26.27 citations per article. The 50 articles most viewed (7.33 and 56.50 views) were all published in Portuguese: 46% were surveys, 14% databases analysis, and 12% systematic reviews. Quantitative techniques were adopted in 66% of such articles, while mathematical modeling was the same as observed in Cadernos de Saúde Pública, as were qualitative techniques. The most common themes were health services organization (22%), nutrition (22%), health and work (18%), epidemiology (12%), and environmental health (12%).

  10. Ações de saúde mental na Estratégia Saúde da Família: Expectativas de familiares

    Directory of Open Access Journals (Sweden)

    Marcio Wagner Camatta

    2016-06-01

    Full Text Available RESUMO Objetivo: Compreender as expectativas de familiares de usuários com transtorno mental da Estratégia Saúde da Família (ESF, em relação às ações de saúde mental. Métodos: Trata-se de uma pesquisa qualitativa, com utilização do referencial da Sociologia fenomenológica. Foram realizadas entrevistas semiestruturadas com 12 familiares de duas unidades de ESF de Porto Alegre, Rio Grande do Sul, em 2010. Utilizou-se a análise compreensiva para a interpretação das categorias concretas: ter apoio da equipe da ESF; e ter atenção da equipe da ESF. Resultados: Em essência, os familiares têm por expectativas ter um relacionamento social genuíno com a equipe da ESF para compartilharem suas vivências, servindo de suporte para superarem angústias, ansiedades e sentimentos de impotência frente às adversidades de conviver com uma pessoa com transtorno mental. Conclusão: A relação intersubjetiva é um aspecto relevante para o cuidado em saúde mental na ESF, necessitando de maiores investimentos da equipe.

  11. A Motivação dos Profissionais de Saúde das Unidades Básicas de Saúde

    Directory of Open Access Journals (Sweden)

    Antônio Alves Filho

    Full Text Available Relata-se pesquisa que objetivou estudar a motivação para o trabalho dos profissionais de saúde vinculados às Unidades Básicas de Saúde do município de Natal. Compreendeu-se a motivação como um processo e aplicou-se a Teoria das Expectativas que a considera como um fenômeno processual e envolve cinco componentes: resultados do trabalho, expectativa, valên-cia, instrumentalidade e força motivacional. Entendeu-se também a motivação como um fenômeno relacionado com o contexto de trabalho e adotou-se a perspectiva psicossociológica. Aplicou-se o Inventário da Motivação e Significado do Trabalho, identificando-se os fatores que mais contribuem, bem como os que enfraquecem a força motivacional dos profissionais de saúde. Conclui-se que a maioria dos profissionais apresentou força motivacional moderada e em queda, por vivenciarem e perceberem um contexto deteriorado com condições de trabalho desfavoráveis.

  12. Ambiente, saúde e trabalho: temas geradores para ensino em saúde e segurança do trabalho no Acre, Brasil

    Directory of Open Access Journals (Sweden)

    Josina Maria Pontes Ribeiro

    Full Text Available O artigo apresenta ambiente, saúde e trabalho como temas geradores necessários à construção de uma tecnologia social para educação profissional, considerando a ergologia como perspectiva de análise, e, o diálogo, como estratégia de ensino em Saúde e Segurança no Trabalho para Agentes de Combate a Endemias em Rio Branco, Acre, Brasil. A definição dos temas geradores é resultado do diálogo entre pesquisadores de diferentes áreas, trabalhadores que atuam ou atuaram no combate às endemias, bem como de discentes e docentes do Curso Técnico em Segurança do Trabalho no Instituto Federal do Acre (IFAC, mediante exercício de atividades de ensino, pesquisa e extensão. As pesquisas histórica e documental permitiram que se estabelecessem os nexos entre os projetos de desenvolvimento que impactaram significativamente o ambiente e as relações de trabalho na saúde daí resultantes.

  13. Risk Management and Nuclear Insurance Program within Societatea Nationala Nuclearelectrica S.A

    Energy Technology Data Exchange (ETDEWEB)

    Havris, Alexandru [Societatea Nationala Nuclearelectrica S.A, 65 Polona Street, code 010494, sector 1, Bucharest (Romania)

    2008-07-01

    This paper shall present the Risk Management and associated nuclear insurance program developed within Societatea Nationala 'Nuclearelectrica' S.A, owner and operator of Units 1 and 2 Cernavoda NPP, the Nuclear Fuel Plant and in charge with commissioning of Units 3 and 4. From the risk management perspective, the main aspects that energy industry has to face due to global economic changes within a dynamic business environment are highlighted. In order to mitigate the operational and investment associated risks, Societatea Nationala 'Nuclearelectrica' S.A. successfully developed, implemented and maintained a coherent insurance program both on local and international insurance market. (authors)

  14. Saúde mental como tema transversal no curriculo de enfermagem

    OpenAIRE

    Ana Ruth Macêdo Monteiro

    2003-01-01

    Busca-se com este estudo averiguar a possibilidade do conteúdo de saúde mental ser transversal nas disciplinas dos cursos de graduação em enfermagem, descrevendo a experiência desenvolvida em uma universidade pública e conhecendo a percepção dos acadêmicos sobre essa prática. Participaram da pesquisa 27 alunos. Foi utilizado o questionário. No que diz respeito à inserção da saúde mental em outras disciplinas, 18,5 % considerou ótima, 70,5% boa e 11% como regular. Quanto a sua aplicabilidade 7...

  15. FARM-CHEMICALS S.A. PLANTA FORMULADORA Y PRODUCTORA DE AGROQUÍMICOS

    Directory of Open Access Journals (Sweden)

    Gabriel Arturo García Gómez

    2002-01-01

    Full Text Available En esta tesis se analiza el sector en el cual se encuentra la empresa Farm-Chemicals S.A. planta Formuladora y Productora de Agroquímicos genéricos, evaluando su potencial de mercado y se presenta un modelo financiero desde cuatro escenarios, con lo que obtenemos posibles panoramas futuros para la Compañía. La información ha sido preparada cuidadosamente, después de estudiar el mercado potencial existente, la situación competitiva de Farm-Chemicals S.A. y las expectativas futuras dentro del sector en que se desenvuelve.

  16. Desenvolvimento de um ambiente virtual de ensino em histologia para estudantes da saúde

    OpenAIRE

    2013-01-01

    As tecnologias da informação e da comunicação (TICs) têm sido amplamente utilizadas no ensino da saúde. As plataformas usadas para o desenvolvimento do ambiente virtual de ensino (AVE) geralmente apresentam uma linguagem de informática complexa. O objetivo deste trabalho foi desenvolver um AVE em Histologia voltado para estudantes da área da saúde, disponibilizado na internet com o uso de uma plataforma de uso gratuito e livre. O material elaborado utilizou diferentes TICs, como: animações, v...

  17. Caso de estudio. Automatización de Oficinas S.A.

    OpenAIRE

    2006-01-01

    En este caso se presentan las siguientes situaciones : La empresa cuenta con una buena posición e imagen en el negocio de los muebles. Un mercado altamente competitivo. Automatización de Oficinas S.A. posee un producto con altos estándares de calidad. La empresa han presentado una disminución en los márgenes rentabilidad manejados. DESCRIPCION : El caso muestra la situación de la empresa Automatización de Oficinas S.A., una empresa de gran trayectoria nacional, orientada a la comercialización...

  18. A reforma da sa??de de Clinton: li????es para o Brasil?

    OpenAIRE

    Marques, Marilia Bernardes; Possas, Cristina de Albuquerque

    1994-01-01

    O presente artigo analisa a proposta para a reforma do sistema de sa??de, apresentada pelo Presidente Clinton ao Congresso dos Estados Unidos, no ver??o de 1993. Ap??s considerar os aspectos essenciais da paradoxal situa????o da sa??de americana e que culminaram na conscientiza????o pela sociedade da necessidade inadi??vel da reforma, as autoras apresentam e analisam os seis princ??pios norteadores da proposta Clinton, destacando as principais implica????es para a experi??ncia da reforma sani...

  19. Representações sociais de gestantes sobre saúde bucal

    OpenAIRE

    2003-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências da Saúde. Programa de Pós-Graduação em Odontologia. Partindo do pressuposto de que é necessário melhor entender para melhor agir, este estudo investigou os saberes de gestantes sobre saúde bucal, tendo como objetivo a compreensão das representações sociais (RS) que influenciam suas práticas, à luz da Teoria das Representações Sociais, proposta por Moscovici, em 1961. Os sujeitos desta pesquisa qualitativa f...

  20. Sinteza i karakterizacija elektrolitičkog kupatila za pozlatu na bazi kompleksa zlata sa merkaptotriazolom

    OpenAIRE

    Dimitrijević, Silvana B.

    2013-01-01

    Elektrolit na bazi kompleksa zlata sa merkaptotriazolom sintetizovan je u širokoj oblasti pH vrednosti od kisele do alkalne (pH=2-12). Nakon sinteze elektrolita urađena je detaljna karakterizacija kompleksa u tečnom i čvrstom stanju u celom opsegu stabilnosti kompleksa. Fizičko-hemijska karakterizacija elektrolita urađena je najpre primenom Ultraljubičaste- Vidljive (UV-vis) spektroskopije i Atomske Emisione Spektrometrije sa indukovano spregnutom plazmom (AAS- ICP). UV-vis ...

  1. Grupos de pesquisa em história da saúde

    OpenAIRE

    Zytkuewisz,Gabriela Venier

    2011-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências da Saúde. Programa de Pós-Graduação em Enfermagem Trata-se de um estudo qualitativo, exploratório, descritivo documental que objetiva conhecer os grupos de pesquisa que possuem a linha de pesquisa história da saúde quanto à produção e difusão do conhecimento produzido perante a comunidade acadêmica e científica. A coleta de dados foi realizada no período de dezembro de 2010 a setembro de 2011. Os dados fora...

  2. Educação em saúde e cidadania: revisão integrativa

    Directory of Open Access Journals (Sweden)

    Viviane Ferraz Ferreira

    Full Text Available Este artigo apresenta os resultados de uma revisão integrativa de literatura sobre educação em saúde e cidadania, que buscou conhecer e analisar as diferentes contribuições científicas disponíveis. A educação em saúde reflete uma estratégia que almeja um cidadão coautor do processo de construção do cuidado à sua saúde. Utilizouse para a coleta de dados a base Lilacs (Literatura LatinoAmericana do Caribe em Ciências da Saúde no período de 2000 a 2011, totalizando 79 produções. Após a aplicação dos critérios de inclusão e exclusão, a amostra final incluiu dez publicações. A pesquisa trouxe a prevalência de estudos da natureza artigo, apresentando mais de três autores, com predominância de docentes e produção do tipo revisão teórica. As categorias que emergiram do estudo foram: educação em saúde - historicidade e bases conceituais; e educação popular como geradora de cidadania. As evidências mostraram o processo histórico das políticas de saúde e o surgimento dos movimentos sociais voltados para as necessidades da população. Destacaram também que a educação permanente em saúde proporciona a construção de novos saberes, mediante a junção de conhecimentos científicos e de saberes populares. Manifestaramse na literatura contribuições relevantes sobre a educação em saúde, por ser uma prática emancipadora do sujeito, atuando como espaço gerador de cidadania.

  3. A integralidade das ações em saúde e a intersetorialidade municipal

    Directory of Open Access Journals (Sweden)

    Liane Teresinha Schuh Pauli

    2013-12-01

    Full Text Available Com a inclusão dos contextos biopsicosocial, econômico e cultural nos conceitos do processo saúde/doença aumentaram as exigências de atuação no âmbito municipal, levando à necessidade de novos contornos no planejamento e na política. Sob a justificativa de avançar no cumprimento das normas legislativas e direcionar esforços intersetoriais capazes de garantir a integralidade das ações em saúde, objetivamos com esta investigação analisar a percepção relativa ao conceito de saúde/doença nos vários níveis da gestão pública e o relacionamento do setor de trabalho com a área da saúde, verificando a viabilidade da intersetorialidade e a percepção sobre a importância desta como estratégia para a promoção da integralidade das ações em saúde. A pesquisa realizou-se em duas etapas, com a utilização do método qualitativo de análise em ambas, por meio de entrevista individual gravada no local de trabalho (Técnica do Discurso do Sujeito Coletivo, o que possibilitou a análise dos depoimentos verbais através das ideias centrais e suas correspondentes expressões-chave. Constituíram-se como sujeitos da pesquisa todos os elementos envolvidos na gestão municipal da cidade de Vera Cruz,RS, mais dois assessores diretos de cada um destes. Observou-se que existe a concepção do conceito de saúde ampliado e positivo, há o reconhecimento da responsabilidade dos vários setores sobre o processo saúde/doença da população e a intenção do trabalho intersetorial. Concluiu-se que, com mudanças político-organizacionais, capacitação de recursos humanos e planejamento, pode-se alcançar melhoria nas ações de promoção da integralidade das ações em saúde.

  4. PREPARATION OF SA-Fe CATION EXCHANGE MEMBRANE AND IT'S APPLICATION IN ELECTRODIALYSIS FOR TREATING WASTEWATER

    Institute of Scientific and Technical Information of China (English)

    GENG Yamin; CHEN Zhen; ZHENG Xi; HUANG Xuehong; CHEN Riyao

    2006-01-01

    An insoluble SA-Fe membrane was prepared by being linked soluble sodium alginate with FeCl3. SEM was used to observe its surface structure. IR spectrum indicated that Fe3+ was linked with -COOH and -OH in SA membrane. As a cationic exchanging membrane in electrodialysis the membrane was applied in treating inorganic wastewater with high concentration of inorganic ammonia and azote. The results of experiment showed that it was well-selective to ammonia and azote. The percentage of the removal of ammonia and azote in wastewater was up to 80%.

  5. Fisioterapia e Saúde Funcional em Primeira Edição

    OpenAIRE

    Kátia Virginia Viana Cardoso

    2012-01-01

    É com grande satisfação que apresentamos à comunidade científica a primeira edição da Revista Eletrônica “Fisioterapia e Saúde Funcional”, um periódico eletrônico sob a forma de um projeto de extensão do Curso de Fisioterapia da Universidade Federal do Ceará – UFC, que objetiva divulgar estudos e resultados de pesquisas nas diversas áreas da Fisioterapia como também da Saúde Funcional, divulgando pesquisas de profissionais de nível superior, professores, pesquisadores e estudantes ligados às ...

  6. Saúde dos imigrantes: multidimensionalidade, desigualdades e acessibilidade em Portugal

    Directory of Open Access Journals (Sweden)

    Beatriz Padilla

    Full Text Available Este artigo descreve os aspectos multidimensionais da saúde das populações imigrantes e os seus descendentes, tomando como exemplo o caso português. Por um lado, coloca-se ênfase na importância da acessibilidade e das diferentes barreiras que a condicionam e por outro lado, salientam-se as intervenções do estado e da sociedade civil em prol da saúde dos imigrantes, num contexto actual marcado pela crise internacional.

  7. O livro Programa de saúde : um caso de censura durante a ditadura militar brasileira

    OpenAIRE

    Reimao,Sandra

    2013-01-01

    Estão liberados para consulta alguns documentos produzidos por órgãos do governo durante a ditadura militar brasileira, entre eles, pareceres de censura sobre televisão, rádio, teatro, filmes, músicas, publicidades e impressos. Entre os cerca de quinhentos pareceres relativos a livros está o indicativo de veto a Programa de saúde: projetos e temas de higiene e saúde , obra didática que propunha ações para que os alunos buscassem conh...

  8. Promoção da Saúde na Escola: história e perspectivas

    Directory of Open Access Journals (Sweden)

    Andréa Monteiro de Castro Graciano

    2015-03-01

    Full Text Available Introdução: A promoção da saúde nas escolas envolve a educação em saúde, a criação de entornos saudáveis e a provisão de serviços de saúde. Este estudo objetivou realizar uma revisão crítica da literatura sobre a promoção da saúde nas escolas. Metodologia: Os critérios prévios de inclusão foram: artigos que relacionavam saúde escolar e promoção da saúde, sem limite temporal de publicação. Foram realizadas buscas eletrônicas nas principais bases de dados, entre janeiro e março de 2014. Foram utilizadas as seguintes palavras-chave e conjunto de palavras: promoção da saúde, saúde escolar, health promotion e school health [termo MeSH e termo palavra]. Também foram pesquisados estudos que preencheram os critérios de inclusão originados da lista de referências dos artigos selecionados. Revisão de literatura / Discussão: A saúde escolar avançou em sintonia com o conhecimento técnico-científico e com o desenvolvimento sócio-político, superando, de forma gradativa, o paradigma biomédico para a concepção da iniciativa das Escolas Promotoras de Saúde. No Brasil, foi instituído um novo programa para a saúde do escolar denominado Programa Saúde na Escola (PSE. O PSE se identifica como uma estratégia para a integração e articulação permanente entre as políticas e ações de educação e saúde. Considerações finais: Uma escola promotora de saúde caracteriza-se como uma escola que busca um estilo de vida, aprendizagem e trabalho que favoreça o desenvolvimento da saúde.

  9. Saúde Bucal no Âmbito Escolar e Familiar: da Autonomia à Transformação Social

    Directory of Open Access Journals (Sweden)

    Larissa Moreira de Souza

    Full Text Available RESUMO A promoção de saúde requer um trabalho com abordagens preventivas, educacionais, curativas e de controle da saúde pelo próprio indivíduo, sendo a motivação e a transformação social por meio da conscientização as únicas propostas viáveis para a diminuição das doenças bucais. O objetivo deste programa foi promover a saúde de forma ampla, atingindo vários atores sociais, e trabalhar a autonomia e a modificação de hábitos essenciais para alterações no fenômeno saúde-doença. Foi desenvolvido na rede pública de ensino do município de Patos (PB, com a participação de três eixos – a família, os educadores e as crianças –, tendo como ações as práticas de promoção e educação em saúde, análise do nível de conhecimento em saúde bucal, realização de tratamento restaurador atraumático, além de cursos de capacitação em saúde bucal para educadores e agentes comunitários de saúde. O projeto teve aceitação por todos os eixos assistidos e alcançou como resultado a melhoria nos níveis de saúde bucal e a criação de agentes multiplicadores de saúde, contribuindo para o desenvolvimento da autonomia e integralidade em saúde.

  10. Atenção à saúde mental na Estratégia Saúde da Família: recursos não reconhecidos

    Directory of Open Access Journals (Sweden)

    Mariana de Oliveira Pasqualin Ribeiro

    2013-12-01

    Full Text Available Um dos pilares da política de Atenção Básica, a Estratégia Saúde da Família, realiza assistência descentralizada nos territórios adscritos, atendendo diferentes demandas, incluindo a saúde mental. Esta pesquisa teve como objetivo produzir sentidos com profissionais da Saúde da Família sobre seus recursos para o cuidado em saúde mental. Para tanto, foram realizados grupos focais com profissionais da saúde da família de um município do interior do estado de São Paulo. A análise do material foi realizada por procedimentos qualitativos de análise temática, com base nas contribuições do movimento construcionista social. Essa análise permitiu dar visibilidade a importantes recursos técnicos e relacionais da equipe para o cuidado em saúde mental, mas que pareciam pouco legitimados em seu cotidiano. Discutimos a necessidade de criação de espaços de reflexão onde os trabalhadores de saúde possam ressignificar suas ações, o que pode contribuir para a qualificação do atendimento em saúde mental na Atenção Básica.

  11. Letramento funcional em saúde: reflexões e conceitos sobre seu impacto na interação entre usuários, profissionais e sistema de saúde

    Directory of Open Access Journals (Sweden)

    Maria da Penha Baião Passamai

    2012-06-01

    Full Text Available Letramento funcional em saúde (LFS é o grau pelo qual os indivíduos têm a capacidade para obter, processar e entender informações básicas e serviços necessários para a tomada de decisões adequadas em saúde. O tema preocupa pesquisadores/profissionais da saúde/formuladores de políticas públicas. Sua natureza interdisciplinar, relacional e interacional indica que o LFS sofre a influência dos sistemas de saúde/educacional, mídia, família, ambiente de trabalho/comunidade/decisão política. Analisam-se conceitos de LFS versus interação usuários-profissionais-sistema de saúde, norteando-se pelas questões: Em que consiste o LFS? Em que medida interfere na comunicação entre usuários, profissionais e sistema de saúde? Quais são suas consequências na saúde pública? Medidas para elevação do LFS devem melhorar as competências individuais e serviços de saúde humanizados, aperfeiçoando suas comunicações, escritas/orais, satisfazendo as necessidades/habilidades dos usuários.

  12. Orientação sobre saúde bucal em um Centro de Saúde Dental health education in a public health centre

    Directory of Open Access Journals (Sweden)

    Roberto Augusto Castellanos

    1977-06-01

    Full Text Available Foi realizado estudo com o fim de verificar qual a orientação sobre saúde bucal dada aos clientes que pela primeira vez compareceram a um centro de saúde. Durante o período de 2 semanas foram observados 25 clientes; o método utilizado foi o da "observação participante''. Os dados necessários para o "diagnóstico educativo" foram colhidos com o auxílio de uma ficha. Da análise destes dados concluiu-se não haver uma adequada orientação com relação à saúde bucal, por parte do pessoal responsável. Sugere-se como "tratamento educativo" revisão das normas em relação à saúde da boca e desenvolvimento de um programa educativo, incidental e planejado, integrado às diferentes atividades realizadas pelo Centro. Propõe-se um conteúdo programático responsabilizando o dentista pelo adestramento do pessoal, execução e avaliação do programa. Ressalta-se a importância do centro de saúde para o desenvolvimento de programas integrados, preventivos, curativos e educativos.This paper deals with a study made with the purpose of observing dental health, education of patients coming for the first time to a Health Center. The study was carried out during two weeks and 25 patients were observed through "Participant Observation". Data for the "Educational Diagnosis" was collected in a card specially designed for it. Results showed that dental health orientation was not given by the staff to patients. An educational programme about dental health is suggested to be integrated with the activities of the various services, being the Dentist responsible for the staff programme coordination and evaluation. Finally the importance of the health center for the development of preventive, curative and educational integrated programmes is emphasized.

  13. La vente des biens nationaux à la fin du XVIIIe siècle, nouvelle donne pour la ville The sale of national assets at the end of the 18th century – a gift to the city

    Directory of Open Access Journals (Sweden)

    François Antoine

    2009-05-01

    Full Text Available À la fin de l’Ancien Régime, les villes des Pays-Bas gardaient les traits de villes médiévales sans ordre et faites d’entrelacs de rues et de ruelles. Le caractère corporatif de la production limitait la présence de grands ensembles industriels et les couvents et leurs jardins occupaient une grande partie de la superficie intra et extra muros des cités. Par ailleurs, l’Église était propriétaire d’un important parc immobilier de petites demeures adossées à des églises jusqu’aux importants refuges d’abbayes dominant dans les campagnes de vastes espaces fonciers. Durant la deuxième moitié du xviiie, les autorités habsbourgeoises menèrent une politique tendant à moderniser les villes en faisant, en autres, tomber les enceintes et en donnant une nouvelle affectation aux couvents contemplatifs supprimés. La Révolution française bouleversa ces ensembles urbains en libérant d’un coup une masse très importante de biens immobiliers qui appartenait à l’Église et en modifiant radicalement les modes de production par la suppression des corporations de métiers. La bourgeoisie principalement négociante réussi habilement tirer tous les profits de cette nouvelle donne. Cet effet d’aubaine contribua grandement à faire passer nos régions dans un nouveau stade de leur démarrage industriel.At the end of the Ancien Régime, the towns of the Netherlands retained the characteristics of medieval towns, without any order and consisting of warrens of streets and alleys. The corporative nature of production limited the presence of major industrial complexes and the monasteries and convents, together with their gardens, covered a large part of the urban areas both within and outside city walls. In addition, the church had important property holdings, ranging from small residential properties attached to churches to major abbey residences dominating vast countryside estates. During the second half of the 18th century, the

  14. Reflexões sobre a saúde bucal no Brasil

    Directory of Open Access Journals (Sweden)

    Anya Pimentel Gomes Fernandes Vieira Meyer

    2013-12-01

    Full Text Available No último século, numerosos avanços em pesquisas e tecnologias biomédicas na área odontológica foram responsáveis por melhorias na saúde e no bem-estar das populações(1. Entretanto, apesar das grandes realizações no âmbito da saúde bucal, muitos problemas ainda permanecem, como a cárie dental, a mais comum das doenças bucais. A prevalência da cárie dentária apresentou uma tendência de declínio nas três últimas décadas do século XX e no início do século XXI, especialmente nos países desenvolvidos, contudo, ainda é considerada uma importante questão de saúde pública mundial, afetando de 60% a 90% das crianças em idade escolar, além da vasta maioria dos adultos(2-4. No levantamento epidemiológico SB Brasil 2010(5, foram observadas melhoras na condição bucal dos brasileiros, porém, ainda é alta a prevalência de cárie. Entre os adolescentes de 15 a 19 anos, por exemplo, a média de dentes afetados foi de 4,25 mais que o dobro do número médio encontrado aos 12 anos. Entre os idosos de 65a 74 anos, o número de dentes cariados, perdidos e obturados (CPO praticamente não se alterou, ficando em 27,5 em 2010, enquanto, em 2003, a média era de 27,8. Em termos internacionais, de acordo com o Ministério da Saúde brasileiro(5,um estudo realizado pela Organização Mundial da Saúde (OMS em 2004 indicou que, nos dados de 188 países, o valor médio do CPO aos 12 anos foi de 1,6, sendonas Américas a média de 2,8, enquanto na Europa ficou em 1,6. Na América do Sul,somente a Venezuela apresentou média de CPO aos 12 anos semelhante à brasileira(2,1. Nos demais países, as médias apresentaram-se mais altas, como na Argentina(3,4, Bolívia (4,7, Colômbia (2,3, Paraguai (2,8 e Peru (3,7. Os achados epidemiológicos de 2010 sobre a saúde bucal no Brasil(5mostraram que o país entrou para o grupo daqueles com baixa prevalência de carie aos 12 anos. Embora os resultados nesse quesito tenham sido animadores, a

  15. Saúde e imigrantes: as representações e as práticas sobre a saúde e a doença na Comunidade Cabo-Verdiana em Lisboa

    OpenAIRE

    Bárbara, Bäckström

    2009-01-01

    Trata-se da versão publicada da Tese de Doutoramento em Saúde Internacional apresentada ao Instituto de Higiene e Medicina Tropical da Universidade Nova de Lisboa em 2006, sob orientação da Prof. Graça Carapinheiro Este trabalho de investigação constitui uma aproximação sociológica no âmbito da saúde internacional e no contexto da sociologia da saúde, em particular da saúde dos migrantes, relativamente às suas representações e práticas de saúde e de doença. O objecto de investigação centra...

  16. La nouvelle alimentation pulsée de 60MW à 0.5Hz pour le Synchrotron à protons du CERN un système totalement statique avec stockage d’énergie par condensateurs

    CERN Document Server

    Burnet, Jean-Paul

    2010-01-01

    Le Synchrotron à proton (PS) du CERN est un accélérateur de particules mis en service en 1959. Aujourd’hui, il est plus que jamais un élément essentiel de la chaine des accélérateurs du CERN. Il reçoit les protons d’un pré-accélérateur à une énergie de 1.4GeV et il les accélère jusqu’à 25GeV. Les cycles d’accélération durent 1.2 ou 2.4 secondes et s’enchainent les uns à la suite des autres, 5000 heures par an. Cent un aimants sont répartis sur les six cents mètres de circonférence de la machine et créent un champ magnétique qui permet de conserver les protons sur la trajectoire circulaire de la machine. Ils sont tous connectés en série et alimentés par un seul convertisseur de puissance. En réalité, ce convertisseur est un système de puissance complexe comprenant un groupe tournant de 90MVA. Ce groupe est en service depuis 1968 et après plus de 200 millions de cycles, montre des signes de fatigue. Une nouvelle alimentation prendra bientôt la relève. La solution reten...

  17. Évolution et manifestation de la nouvelle esthétique de l’image et de la poétique de la parole dans l’avant-garde russe, exprimée dans les livres d’artistes futuristes

    Directory of Open Access Journals (Sweden)

    Elina Knorpp

    2011-07-01

    Full Text Available Bien que le futurisme russe, à ses débuts, fût influencé par les futuristes italiens, il évolua d’une manière autonome. Dans le domaine de la littérature, on trouve un grand nombre de groupements futuristes divers, tandis que dans les arts visuels, le soi disant Cubo-futurisme voyait le jour. Le Cubo-futurisme liait des tendances cubistes et futuristes afin de faire advenir une forme singulièrement russe. Les livres futuristes, publiés dans les années 1910, nous montrent la naissance d’une nouvelle esthétique du texte et de l’image ainsi que la rupture avec les anciennes normes littéraires et artistiques. Ceci s’exprime à travers des illustrations, la création d’une nouvelle langue et l’entrelacs de l’image et de la parole. Cet article analyse les commencements du futurisme en Russie à partir de plusieurs livres russes pris comme exemples de cette esthétique nouvelle.Although the Russian Futurist movement was initially influenced by the Italian Futurists, it developed in an independent way. In literature, there had been a number of different futurist groups, whereas in the visual arts, the so-called Cubo-Futurism was established, linking the cubist and futurist tendencies in a singularly Russian form. Futurist books, published in the1910s, show the birth of a new aesthetics of text and image and the break with older literary and artistic norms. This was expressed through illustrations, new language and the affiliation of image and word. This article examines the beginnings of Futurism in Russia and considers a few Futurist books as examples of this new aesthetic.

  18. 77 FR 57039 - Special Conditions: Embraer S.A., Model EMB-550 Airplane; Electronic Flight Control System...

    Science.gov (United States)

    2012-09-17

    ... Federal Aviation Administration 14 CFR Part 25 Special Conditions: Embraer S.A., Model EMB-550 Airplane... conditions for the Embraer S.A. Model EMB-550 airplane. This airplane will have a novel or unusual design..., data, or views. The most helpful comments reference a specific portion of the special...

  19. Draft Genome Sequence of Enterobacter sp. Sa187, an Endophytic Bacterium Isolated from the Desert Plant Indigofera argentea

    Science.gov (United States)

    Lafi, Feras F.; Alam, Intikhab; Geurts, Rene; Bisseling, Ton; Bajic, Vladimir B.

    2017-01-01

    ABSTRACT Enterobacter sp. Sa187 is a plant endophytic bacterium, isolated from root nodules of the desert plant Indigofera argentea, collected from the Jizan region of Saudi Arabia. Here, we report the genome sequence of Sa187, highlighting several genes involved in plant growth–promoting activity and environmental adaption. PMID:28209831

  20. G-LoSA: An efficient computational tool for local structure-centric biological studies and drug design.

    Science.gov (United States)

    Lee, Hui Sun; Im, Wonpil

    2016-04-01

    Molecular recognition by protein mostly occurs in a local region on the protein surface. Thus, an efficient computational method for accurate characterization of protein local structural conservation is necessary to better understand biology and drug design. We present a novel local structure alignment tool, G-LoSA. G-LoSA aligns protein local structures in a sequence order independent way and provides a GA-score, a chemical feature-based and size-independent structure similarity score. Our benchmark validation shows the robust performance of G-LoSA to the local structures of diverse sizes and characteristics, demonstrating its universal applicability to local structure-centric comparative biology studies. In particular, G-LoSA is highly effective in detecting conserved local regions on the entire surface of a given protein. In addition, the applications of G-LoSA to identifying template ligands and predicting ligand and protein binding sites illustrate its strong potential for computer-aided drug design. We hope that G-LoSA can be a useful computational method for exploring interesting biological problems through large-scale comparison of protein local structures and facilitating drug discovery research and development. G-LoSA is freely available to academic users at http://im.compbio.ku.edu/GLoSA/.

  1. Compiling the functional data-parallel language SaC for Microgrids of Self-Adaptive Virtual Processors

    NARCIS (Netherlands)

    Grelck, C.; Herhut, S.; Jesshope, C.; Joslin, C.; Lankamp, M.; Scholz, S.-B.; Shafarenko, A.

    2009-01-01

    We present preliminary results from compiling the high-level, functional and data-parallel programming language SaC into a novel multi-core design: Microgrids of Self-Adaptive Virtual Processors (SVPs). The side-effect free nature of SaC in conjunction with its data-parallel foundation make it an id

  2. Draft Genome Sequence of Enterobacter sp. Sa187, an Endophytic Bacterium Isolated from the Desert Plant Indigofera argentea

    KAUST Repository

    Lafi, Feras Fawzi

    2017-02-17

    Enterobacter sp. Sa187 is a plant endophytic bacterium, isolated from root nodules of the desert plant Indigofera argentea, collected from the Jizan region of Saudi Arabia. Here, we report the genome sequence of Sa187, highlighting several genes involved in plant growth–promoting activity and environmental adaption.

  3. The Novel Transcriptional Regulator SA1804 Is Involved in Mediating the Invasion and Cytotoxicity of Staphylococcus aureus

    Directory of Open Access Journals (Sweden)

    JUNSHU eYANG

    2015-03-01

    Full Text Available The two-component regulatory system, SaeRS, controls expression of important virulence factors, including toxins and invasins, which contribute to the pathogenicity of Staphylococcus aureus. Previously, we conducted a transcriptomics study for identification of SaeRS regulon and found that inactivation of SaeRS dramatically enhances the transcription of a novel transcriptional regulator (SA1804. This led us to question whether SA1804 is involved in bacterial pathogenicity by regulating the expression of virulence factors. To address this question, we created sa1804, saeRS, and sa1804/saeRS double deletion mutants in a USA300 community-acquired MRSA strain, 923, and determined their impact on the pathogenicity. The deletion of sa1804 dramatically increased the cytotoxicity and enhanced the capacity of bacteria to invade into the epithelial cells (A549, whereas the deletion of saeRS eliminated the cytotoxicity and abolished the bacterial ability to invade into the epithelial cells. Moreover, the double deletions of sa1804 and saeRS appeared a similar phenotype with the saeRS null mutation. Furthermore, we determined the regulatory mechanism of SA1804 using qPCR and gel-shift approaches. Our data indicate that the novel virulence repressor SA1804 is dependent on the regulation of SaeRS. This study sheds light on the regulatory mechanism of virulence factors and allows for us further elucidate the molecular pathogenesis of S. aureus.

  4. A Criação da Secretaria Especial de Saúde Indígena

    Directory of Open Access Journals (Sweden)

    Luciana Benevides Ferreira

    2013-12-01

    Full Text Available O Subsistema de Atenção à Saúde Indígena foi criado em 1999 proporcionando aumento da cobertura das ações de saúde para os povos aldeados, mas a dificuldade de gestão e a insatisfação dos usuários levaram o governo brasileiro a transferir a responsabilidade sobre as ações de saúde indígena da Fundação Nacional de Saúde para o Ministério da Saúde. Esse processo foi marcado por uma ampla participação de representantes da população indígena, pelo diálogo intercultural e por várias rodadas de negociação no governo, culminando na criação, em 2010, da Secretaria Especial de Saúde Indígena. O objetivo deste artigo é descrever esse processo. O conhecimento do contexto e o acompanhamento de mudanças ocorridas na Política Nacional de Atenção à Saúde dos Povos Indígenas foram proporcionados pela participação em eventos relacionados ao tema e pela realização de entrevistas com presidentes dos Conselhos Distritais de Saúde Indígena.

  5. 75 FR 9816 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2010-03-04

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A. (EMBRAER... adding the following new AD: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket No. FAA-...

  6. 76 FR 26959 - Airworthiness Directives; Embraer-Embraer-Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model...

    Science.gov (United States)

    2011-05-10

    ...--Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-500 Airplanes AGENCY: Federal Aviation... holidays. For service information identified in this proposed AD, contact EMBRAER Empresa Brasileira de... docket. Relevant Service Information Embraer--Empresa Brasileira de Aeronautica S.A. has issued...

  7. 75 FR 19193 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2010-04-14

    ...-063-AD; Amendment 39-16257; AD 2010-08-02] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2010-08-02 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16257... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE, -100 SU, -200...

  8. 75 FR 42585 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2010-07-22

    ...-186-AD; Amendment 39-16359; AD 2010-14-14] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... new AD: 2010-14-14 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16359. Docket No...)(2) of this AD, certificated in any category. (1) Empresa Brasileira de Aeronautica S.A....

  9. 76 FR 437 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135BJ Airplanes

    Science.gov (United States)

    2011-01-05

    ...-118-AD; Amendment 39-16554; AD 2011-01-01] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2011-01-01 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16554..., Amendment 39-15578. Applicability (c) This AD applies to all Empresa Brasileira de Aeronautica S.A....

  10. 75 FR 7929 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 190-100 LR...

    Science.gov (United States)

    2010-02-23

    ...-16201; AD 2010-04-08] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A... 2. The FAA amends Sec. 39.13 by adding the following new AD: 2010-04-08 Empresa Brasileira de... ADs (b) None. Applicability (c) This AD applies to Empresa Brasileira de Aeronautica S.A....

  11. 75 FR 68684 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-500 Airplanes

    Science.gov (United States)

    2010-11-09

    ...; AD 2010-23-16] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A... identified in this AD, contact EMBRAER Empresa Brasileira de Aeron[aacute]utica S.A., Phenom Maintenance... [Amended] 0 2. The FAA amends Sec. 39.13 by adding the following new AD: 2010-23-16 Empresa Brasileira...

  12. 75 FR 13689 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135ER...

    Science.gov (United States)

    2010-03-23

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A. (EMBRAER... 35904, June 25, 2008) and adding the following new AD: Empresa Brasileira de Aeronautica S.A....

  13. 75 FR 9811 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes

    Science.gov (United States)

    2010-03-04

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A. (EMBRAER...: Empresa Brasileira De Aeronautica S.A. (EMBRAER): Docket No. FAA- 2010-0176; Directorate Identifier...

  14. 75 FR 27403 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135 and -145...

    Science.gov (United States)

    2010-05-17

    ...-041-AD; Amendment 39-16290; AD 2010-10-11] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2010-10-11 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16290... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135BJ, -135ER, -135KE, -135KL, -135LR,...

  15. 75 FR 13684 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135BJ Airplanes

    Science.gov (United States)

    2010-03-23

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira.... For service information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A... 35908, June 25, 2008) and adding the following new AD: Empresa Brasileira de Aeronautica S.A....

  16. 76 FR 37244 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-120, -120ER...

    Science.gov (United States)

    2011-06-27

    ...-215-AD; Amendment 39-16659; AD 2011-08-09] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2011-08-09 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16659... all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-120, -120ER, -120FC, -120QC, and...

  17. 75 FR 63048 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-500 Airplanes

    Science.gov (United States)

    2010-10-14

    ...-039-AD; Amendment 39-16475; AD 2010-21-15] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2010-21-15 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16475... Empresa Brasileira de Aeron utica S.A. (EMBRAER) Service Bulletin 500-57-0001, dated April 28, 2010....

  18. 76 FR 52220 - Airworthiness Directives; Embraer-Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-500...

    Science.gov (United States)

    2011-08-22

    ...-072-AD; Amendment 39-16779; AD 2011-17-15] RIN 2120-AA64 Airworthiness Directives; Embraer--Empresa... Empresa Brasileira de Aeron utica S.A., Phenom Maintenance Support, Av. Brig. Farina Lima, 2170, Sao Jose...--Empresa Brasileira de Aeronautica S.A.: Amendment 39-16779; Docket No. FAA-2011-0088;...

  19. 75 FR 47184 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135ER...

    Science.gov (United States)

    2010-08-05

    ...-116-AD; Amendment 39-16377; AD 2010-16-01] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... new AD: 2010-16-01 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16377. Docket No... 39-15577. Applicability (c) This AD applies to Empresa Brasileira de Aeronautica S.A. (EMBRAER)...

  20. 75 FR 63422 - Airworthiness Directives; Embraer-Empresa Brasileira de Aeronautica S.A. Model EMB-500 Airplanes

    Science.gov (United States)

    2010-10-15

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Embraer--Empresa... AD docket. Relevant Service Information Empresa Brasileira de Aeron utica S.A. (EMBRAER) has issued.... 39.13 by adding the following new AD: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket...

  1. 75 FR 31332 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-120, -120ER...

    Science.gov (United States)

    2010-06-03

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira.... For service information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A.... 39.13 by adding the following new AD: ] Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket...

  2. 76 FR 2279 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2011-01-13

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira..., contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Technical Publications Section (PC 060), Av.... 39.13 by adding the following new AD: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket...

  3. 76 FR 59240 - Airworthiness Directives; Empresa Brasileira de Aeronáutica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2011-09-26

    ... 2011-CE-023-AD; Amendment 39-16810; AD 2011-20-01] RIN 2120-AA64 Airworthiness Directives; Empresa... (AD) for Empresa Brasileira de Aeron utica S.A. (EMBRAER) Model EMB-505 airplanes. This AD results... the following new AD: 2011-20-01 Empresa Brasileira de Aeron utica S.A. (EMBRAER): Amendment...

  4. 75 FR 45558 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-500 Airplanes

    Science.gov (United States)

    2010-08-03

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira.... Relevant Service Information Empresa Brasileira de Aeron utica S.A. (EMBRAER) has issued Service Bulletin...: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket No. FAA- 2010-0754; Directorate Identifier...

  5. 77 FR 24425 - Airworthiness Directives; Empresa Brasileria de Aeronáutica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2012-04-24

    ... Directives; Empresa Brasileria de Aeron utica S.A. (EMBRAER) Airplanes AGENCY: Federal Aviation...: We propose to adopt a new airworthiness directive (AD) for certain Empresa Brasileria de Aeron utica... proposed AD, contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Phenom Maintenance Support,...

  6. 77 FR 39159 - Airworthiness Directives; Empresa Brasileria de Aeronáutica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2012-07-02

    ...-011-AD; Amendment 39-17106; AD 2012-13-04] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileria... Empresa Brasileria de Aeron utica S.A. (EMBRAER) Model EMB-505 airplanes. This AD results from mandatory..., contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Phenom Maintenance Support, Av. Brigadeiro...

  7. 75 FR 14333 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and...

    Science.gov (United States)

    2010-03-25

    ...-055-AD; Amendment 39-16248; AD 2010-07-04] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... by adding the following new AD: 2010-07-04 Empresa Brasileira de Aeronautica S.A. (EMBRAER... applies to Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE,...

  8. 78 FR 47778 - Verizon Business Networks Services, Inc. Senior Analysts-Sales Impletmentation (SA-SI) Birmingham...

    Science.gov (United States)

    2013-08-06

    ... Employment and Training Administration Verizon Business Networks Services, Inc. Senior Analysts-Sales Impletmentation (SA-SI) Birmingham, Alabama; Verizon Business Networks Services, Inc. Senior Analysts-Sales Impletmentation (SA-SI) Service Program Delivery Division San Francisco, California; Verizon Business...

  9. Resisting the Script of Indian Education: Zitkala Sa and the Carlisle Indian School.

    Science.gov (United States)

    Enoch, Jessica

    2002-01-01

    Offers a "definition" of Zitkala Sa as an Indian teacher who, at the turn of the 20th century, challenged and countered educational norms that silenced Indian voices and erased Indian culture. Examines her autobiographical essays, "Impressions of an Indian Childhood,""The School Days of an Indian Girl," and "An Indian Teacher among Indians," in…

  10. Fenomenologia heideggeriana como referencial para estudos sobre formação em saúde

    Directory of Open Access Journals (Sweden)

    Alberto Durán González

    2012-09-01

    Full Text Available Reflete-se sobre as possibilidades da fenomenologia heideggeriana como referência na análise da educação na saúde. Heidegger propõe, em "Ser e tempo", a investigação sobre o sentido do ser, fundamental para o conhecimento que o homem possa ter de si mesmo como ser finito. Suas ideias provocaram transformações na concepção humanista moderna e na prática em educação. O indivíduo é sempre ator, sendo na medida em que existe, experimentando a si próprio na existência. O modo de ser privativo da saúde, o padecimento, é acompanhado sempre de uma limitação da possibilidade de viver. Assim, a fenomenologia heideggeriana nos ajuda a questionar a educação em saúde. Compreende-se que o homem se encontra sempre em copresença, entre a preocupação substitutiva e a libertadora. Este caminho se mostra possível quando contemplados os diversos modos de ser-professor e de ser-estudante. Possibilita-se, assim, aprofundar o ensinar-aprender na formação em saúde.

  11. Programa Saúde da Família no Brasil: uma agenda incompleta?

    Directory of Open Access Journals (Sweden)

    Maria Fátima de Sousa

    Full Text Available Este artigo trata de uma análise longitudinal da experiência brasileira com o Programa Saúde da Família (PSF, ao longo dos doze anos da sua implantação e implementação. Toma como ponto de partida o propósito fundamental desta estratégia, que é a reorganização da atenção básica de saúde, contextualizando à luz da experiência que é única e peculiar ao Sistema Único de Saúde (SUS. Evidencia os avanços e desafios do PSF, apontando nesse sentido as necessidades mais urgentes em termos de incorporação tecnológica, formação da força de trabalho, estabelecimento de novos mecanismos e pactos em torno do financiamento da atenção básica e encaminhamento de novas estratégias e tecnologias nos processos de monitoramento e avaliação. Finaliza apontando elementos para subsidiar um debate sobre as questões em pauta, o qual deve ser permanente e lúcido na perspectiva da construção do SUS e do direito à saúde.

  12. Lech Wałęsa - kangelane või reetur? / Zygmunt Dzieciolowski ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Dzieciolowski, Zygmunt

    2016-01-01

    Intervjuu Poola politoloogi ja ajakirjaniku Zygmunt Dzieciolowskiga Solidaarsuse liikumise juhi Lech Wałęsa elu tumedatest varjudest, käimasolevast skandaalist seoses tema sidemetega kommunistliku režiimi salapolitsei SBga ning kohast Poola ühiskonnas ja ajaloos

  13. Remembering Londósa : mediator and counterpoint in a "violent" society

    NARCIS (Netherlands)

    Abbink, J.; Böll, V.

    2004-01-01

    This chapter briefly presents the biography of Londósa, a ritual leader or 'komoru' of the Chari Suri people in southwestern Ethiopia and shows how a personal case study can highlight the social problems of an ethnic group. Suri face a crisis of security and of social continuity. Both their physical

  14. Novel Castellaniella denitrificans SA13P as a Potent Malachite Green Decolorizing Strain

    Directory of Open Access Journals (Sweden)

    Ankita Chawla

    2014-01-01

    Full Text Available Triphenylmethane dyes represent a major group of dyes causing serious environmental hazards. Malachite Green is one of the commonly and extensively used triphenylmethane dyes although it is carcinogenic and mutagenic in nature. Various physicochemical methods have been employed for its elimination but are highly expensive, coupled with the formation of huge amount of sludge. Hence, biological methods being ecofriendly are good alternatives. In the present study, the novel bacterial isolate SA13P was isolated from UASB tank of tannery effluent treatment plant. Phylogenetic characterization of 1470 bp fragment of SA13P has revealed its similarity with Castellaniella denitrificans. This strain has been found to decolorize the dye (malachite green at a concentration of 100 mg L−1 (80.29%. Decolorization was done by living bacterial cells rather than adsorption. Growth conditions have also been optimized for the decolorization. Maximum decolorization was observed at a temperature of 37°C and pH 8.0. Also, it has been found that bacterization of seeds of Vigna radiata with Castellaniella denitrificans SA13P increases germination rate. We have reported for the first time that Castellaniella denitrificans SA13P may be used as a novel strain for dye decolorization (malachite green and biological treatment of tannery effluent.

  15. Processo comunicativo e humanização em saúde

    Directory of Open Access Journals (Sweden)

    Suely Ferreira Deslandes

    2009-01-01

    Full Text Available O artigo aborda o processo comunicacional como um dos desafios enfrentados na humanização em saúde. Reflete sobre potencialidades e requisitos para a produção do agir comunicativo e aponta alguns obstáculos, baseando-se em estudos antropológicos sobre a cultura biomédica. Com base no conceito de entendimento, discute sobre os encontros em saúde e a relevância da validação e do reconhecimento do discurso dos diferentes atores. Aponta para a importância de se relativizarem marcas identitárias associadas à cultura biomédica, desconstruírem-se alguns conceitos, criticarem seus contextos de aplicabilidade e até mesmo se propor novas marcas por meio da humanização. Discute-se a relação entre as tecnologias biomédicas e o processo comunicacional. O desafio colocado é o de aprender, reconhecer e negociar com o outro, que detém direitos, autonomia e estoque cultural peculiares. Finalmente, discute os esforços teóricos para que a humanização das práticas em saúde venha a fazer parte do ethos ou visão do mundo dos profissionais de saúde.

  16. 78 FR 77569 - Airworthiness Directives; Turbomeca S.A. Turboshaft Engines

    Science.gov (United States)

    2013-12-24

    ... Turbomeca S.A. Arriel 1 engine. We are issuing this AD to prevent a loss of FT bearing lubrication... after receipt. FOR FURTHER INFORMATION CONTACT: Robert Morlath, Aerospace Engineer, Engine Certification.... Following the event, which resulted from Free Turbine front bearing deterioration, the...

  17. Do real ao ideal - o (descuidar da saúde dos idosos longevos

    Directory of Open Access Journals (Sweden)

    Tatiane Michel

    2015-06-01

    Full Text Available RESUMOObjetivo:analisar semelhanças e dessemelhanças nos significados do cuidado à saúde de idosos longevos atribuídos por eles e pelos profi ssionais de enfermagem no cenário de uma unidade básica de saúde.Método:pesquisa qualitativa etnográfica, alicerçada no método de Spradley e McCurdy e na antropologia interpretativa de Geertz e Kleinman. Participaram 20 informantes-chaves, as informações foram coletadas por meio da observação participante e entrevista etnográfica no período de março a outubro de 2013 e analisadas em domínios, taxonomias e tema cultural.Resultados:emergiram seis domínios e taxonomias culturais que mostraram razões, atributos e recursos para cuidar, na perspectiva dos idosos e dos profissionais de enfermagem e, por fim, o tema cultural: do real ao ideal - o (descuidar da saúde dos idosos longevos.Conclusão:o estudo mostrou o distanciamento entre o cuidado almejado e o realizado à saúde das pessoas com idade mais avançada no cenário estudado.

  18. Data of evolutionary structure change: 1A7SA-1HFDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A7SA-1HFDA 1A7S 1HFD A A IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTA...pdbChain>A 1HFDA HCLEDAADGKVQVL 1HFD A 1HFDA RAVPHPDS...A 1HFDA VCGNRKKPGIYT EEEE...1HFD A 1HFDA LSQPE-PSKRL

  19. Resisting Colonial Education: Zitkala-Sa and Native Feminist Archival Refusal

    Science.gov (United States)

    Terrance, Laura L.

    2011-01-01

    This paper examines resistance through a Native Feminist lens, employing the boarding school memoirs of Zitkala-Sa. Within a "story" of appropriation in methodology, it considers protest and parody, and presents archival refusal as modes of resistance to colonial education. (Contains 1 figure.)

  20. Data of evolutionary structure change: 3GD5D-3D7SA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 3GD5D-3D7SA 3GD5 3D7S D A --TRFRPDLLSLDDLDEAQLHALLTLAHQLKRGERVANL...HGKVLGLVFLKASTRTRVSFTVAMYQLGGQVIDL------------EPVRDTARVLGRYVDGLAIRTFAQTELEEYAHYAG-IPVINALTD-HEHPCQVVADLLTIRENFGRLAGLKLAYVGD...ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSFETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSGNVPVLNAGD...GSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYILDMLDEK----GIAWSLH.../index> 3GD5 D 3GD5D

  1. Data of evolutionary structure change: 1A7SA-2GDDC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A7SA-2GDDC 1A7S 2GDD A C IVGGRKARPRQFPFLASIQNQ---GRHFCGGALIHARFV...FPRFVNVTVTPEDQC-----------------RPNNVCTGVLTRRGGICNGDGGTPLVCE----GLAHGVASFSLGPCGR--GPDFFTRVALFRDWIDGVLNNPGPGP...Y----QDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGD...n14> 2GDD C 2GDDC ARG CA 404 PHE CA 422 VAL CA 380

  2. Direito à saúde: demanda por suplementos no Tribunal de Justiça

    Directory of Open Access Journals (Sweden)

    Leandro Felipe Mufato

    2012-03-01

    Full Text Available Buscou-se compreender como o Tribunal de Justiça de Mato Grosso contribui na efetivação do direito à saúde, ao atuar como mediador na demanda de pessoas e/ou famílias por suplementos. Objetivou conhecer a origem, o motivo, o objeto, o sujeito demandante e a resolutividade das decisões judiciais. Trata-se de estudo qualitativo baseado em pesquisa documental. Das 28 decisões analisadas, 92,8% (26 demandaram compostos alimentares e 7,1% (2, fitas de controle glicêmico. O magistrado acolheu o pedido em 96,5% (27 das decisões, recorrendo estritamente à Constituição Federal, em seu discurso sobre o direito à saúde, e à prescrição médica como prova jurídica. Tais prescrições impõem marcas comerciais em 100% (28 dos casos, e a alergia alimentar pediátrica constitui principal motivo da demanda, 17,8% (5. A maioria dos adoecimentos, considerados condições crônicas de saúde, demanda cuidados continuados e prolongados, frente aos quais o caráter pontual das decisões judiciais pouco contribui para efetivação da equidade e integralidade em saúde.

  3. Data of evolutionary structure change: 1A7SA-2IOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A7SA-2IOTA 1A7S 2IOT A A IVGGRKARPRQFPFLASIQNQ----GRHFCGGALIHARF...ain> 2IOT A 2IOTA CV...in> 1.7549999952316284 13.41100025177002 27.16900062561035 ...73 0.5460000038146973 0.7860000133514404 tion> 3.8209950923919678 2IOT A 2IOTA

  4. A categoria racionalidade médica e uma nova epistemologia em saúde

    Directory of Open Access Journals (Sweden)

    Marilene Cabral do Nascimento

    2013-12-01

    Full Text Available O artigo é um relato analítico da trajetória de 20 anos da categoria racionalidade médica, que emergiu no Campo da Saúde Coletiva, área das Ciências Sociais e Humanas em Saúde, no início da década de 1990, com o objetivo de estudar sistemas médicos complexos e terapêuticas tradicionais, complementares e alternativas. Com base em revisão crítica da literatura, apresentam-se aspectos do contexto cultural, político-institucional e social de seu surgimento, como também suas principais contribuições e desdobramentos nos planos teórico e das políticas e práticas sociais em saúde. Utiliza-se o conceito de epistemologia do sul de Boaventura de Sousa Santos, para a reflexão sobre a contribuição da categoria racionalidade médica à crítica da racionalidade científica pós-moderna e à construção de uma nova epistemologia em saúde.

  5. Transcriptome Analysis in Haematococcus pluvialis: Astaxanthin Induction by Salicylic Acid (SA) and Jasmonic Acid (JA).

    Science.gov (United States)

    Gao, Zhengquan; Li, Yan; Wu, Guanxun; Li, Guoqiang; Sun, Haifeng; Deng, Suzhen; Shen, Yicheng; Chen, Guoqiang; Zhang, Ruihao; Meng, Chunxiao; Zhang, Xiaowen

    2015-01-01

    Haematococcus pluvialis is an astaxanthin-rich microalga that can increase its astaxanthin production by salicylic acid (SA) or jasmonic acid (JA) induction. The genetic transcriptome details of astaxanthin biosynthesis were analyzed by exposing the algal cells to 25 mg/L of SA and JA for 1, 6 and 24 hours, plus to the control (no stress). Based on the RNA-seq analysis, 56,077 unigenes (51.7%) were identified with functions in response to the hormone stress. The top five identified subcategories were cell, cellular process, intracellular, catalytic activity and cytoplasm, which possessed 5600 (~9.99%), 5302 (~9.45%), 5242 (~9.35%), 4407 (~7.86%) and 4195 (~7.48%) unigenes, respectively. Furthermore, 59 unigenes were identified and assigned to 26 putative transcription factors (TFs), including 12 plant-specific TFs. They were likely associated with astaxanthin biosynthesis in Haematococcus upon SA and JA stress. In comparison, the up-regulation of differential expressed genes occurred much earlier, with higher transcript levels in the JA treatment (about 6 h later) than in the SA treatment (beyond 24 h). These results provide valuable information for directing metabolic engineering efforts to improve astaxanthin biosynthesis in H. pluvialis.

  6. SaTool - a Software Tool for Structural Analysis of Complex Automation Systems

    DEFF Research Database (Denmark)

    Blanke, Mogens; Lorentzen, Torsten

    2006-01-01

    The paper introduces SaTool, a tool for structural analysis, the use of the Matlab (R)-based implementation is presented and special features are introduced, which were motivated by industrial users. Salient features of tool are presented, including the ability to specify the behavior of a comple...

  7. 77 FR 73557 - Airworthiness Directives; Turbomeca S.A. Turboshaft Engines

    Science.gov (United States)

    2012-12-11

    ... proposed AD, contact Turbomeca S.A., 40220 Tarnos, France; phone: 33 (0) 5 59 74 40 00; telex: 570 042; fax... Tarnos, France; phone: 33 (0) 5 59 74 40 00; telex: 570 042; fax: 33 (0) 5 59 74 45 15. You may view...

  8. 78 FR 48824 - Airworthiness Directives; Turbomeca S.A. Turboshaft Engines

    Science.gov (United States)

    2013-08-12

    ... 59 74 40 00; telex: 570 042; fax: 33 (0)5 59 74 45 15. You may view this service information at the... Turbomeca, S.A., 40220 Tarnos, France; phone: 33 (0)5 59 74 40 00; telex: 570 042; fax: 33 (0)5 59 74 45...

  9. Sentimentos e percepções da equipe de saúde frente ao paciente terminal

    Directory of Open Access Journals (Sweden)

    Alberto Manuel Quintana

    2006-12-01

    Full Text Available O atendimento a pacientes terminais pelas equipes de saúde, comprovadamente apontado por evidências na literatura, mostra a grande dificuldade que esses profissionais têm em lidar com o tema "morte". O presente estudo objetivou compreender como as equipes de saúde definem e vivenciam o paciente terminal. Para tanto, utilizou-se uma abordagem qualitativa que empregou a pesquisa etnográfica através de observação não-participativa, além de entrevistas semi-estruturadas nas unidades de hemato-oncologia e de infectologia de um hospital público. Os resultados certificaram as dificuldades por parte da equipe em lidar com pacientes terminais, bem como em defini-los como tais e comunicar aos mesmos a sua condição. Dessa forma, percebeu-se a intensa necessidade da realização de um trabalho direto com as equipes de saúde com o intuito de lhes proporcionar um espaço de reflexão e de entendimento, propiciando a continência das emoções suscitadas na equipe de saúde perante a situação da morte.

  10. Propagandas de medicamentos: a saúde como produto de consumo

    Directory of Open Access Journals (Sweden)

    Elaine Teixeira Rabello

    2012-06-01

    Full Text Available O objetivo deste estudo foi discutir as propagandas televisivas de medicamentos como forma de transmissão e representação das concepções circulantes sobre saúde, funções e uso de medicamentos. Foi realizada uma análise de conteúdo qualitativa em dez propagandas televisivas, diretas ao consumidor, de medicamentos de comercialização livre no mercado brasileiro, e uma propaganda institucional de uma empresa farmacêutica. Os dados mostraram que a noção que entrelaça as ideias subjacentes às mensagens e as funções do medicamento anunciadas é a de que os "problemas de saúde" advêm de questões corporais, relacionais ou sociais, mas a solução apresentada é individual e consagra-se na compra e no uso do medicamento. A análise sugere, enfim, que noções de saúde e qualidade de vida podem estar marcadas por noções que fundamentam o ideal de saúde atrelado ao consumo.

  11. Propagandas de medicamentos: a saúde como produto de consumo

    Directory of Open Access Journals (Sweden)

    Elaine Teixeira Rabello

    Full Text Available O objetivo deste estudo foi discutir as propagandas televisivas de medicamentos como forma de transmissão e representação das concepções circulantes sobre saúde, funções e uso de medicamentos. Foi realizada uma análise de conteúdo qualitativa em dez propagandas televisivas, diretas ao consumidor, de medicamentos de comercialização livre no mercado brasileiro, e uma propaganda institucional de uma empresa farmacêutica. Os dados mostraram que a noção que entrelaça as ideias subjacentes às mensagens e as funções do medicamento anunciadas é a de que os "problemas de saúde" advêm de questões corporais, relacionais ou sociais, mas a solução apresentada é individual e consagra-se na compra e no uso do medicamento. A análise sugere, enfim, que noções de saúde e qualidade de vida podem estar marcadas por noções que fundamentam o ideal de saúde atrelado ao consumo.

  12. Across the City, Toward the Nation: Philippine Poetry, Metropolitan Trains, and the Tulaan sa Tren Project

    Directory of Open Access Journals (Sweden)

    Oscar Tantoco Serquiña, Jr.

    2014-06-01

    Full Text Available In 2008 and 2010, the Philippine government’s National Book Development Board (NBDB and Light Railway Transit Authority (LRTA launched Tulaan sa Tren, a project “designed to provide train passengers with an appreciation for Philippine Literature as they listen to their favorite celebrities reading poems about Manila over the public announcement system of LRT Line 2 stations” (goodnewspilipinas.com. This project also initiated a poetry writing contest and produced poetry anthologies that predominantly depicted views of the city and city life. Part appreciation, part revaluation, part critique, this paper initiates a sensing of: (1 the train as a figure of modern life; (2 NBDB and LRTA’s enterprise as a state measure to bridge the disparity between the public’s reception to Philippine literature and the intelligentsia’s academic way of life; and (3 literary representations of the city in the poetry anthologies this project produced, namely Train of Thought: Poems from Tulaan sa Tren and Off the Beaten Track: Poems from Tulaan sa Tren 2. This paper argues that the institutional intervention of popularizing travel, literature, and the city may be seen as a way of generating a socio-political and literary consciousness among train commuters who are linked to and implicated in the issues and anxieties of their lives in the urban environment. By analyzing the poems in the anthologies, this essay ultimately critiques Tulaan sa Tren’s attempt at nation building, identity making, and city mapping.

  13. SpringSaLaD: A Spatial, Particle-Based Biochemical Simulation Platform with Excluded Volume.

    Science.gov (United States)

    Michalski, Paul J; Loew, Leslie M

    2016-02-02

    We introduce Springs, Sites, and Langevin Dynamics (SpringSaLaD), a comprehensive software platform for spatial, stochastic, particle-based modeling of biochemical systems. SpringSaLaD models biomolecules in a coarse-grained manner as a group of linked spherical sites with excluded volume. This mesoscopic approach bridges the gap between highly detailed molecular dynamics simulations and the various methods used to study network kinetics and diffusion at the cellular level. SpringSaLaD is a standalone tool that supports model building, simulation, visualization, and data analysis, all through a user-friendly graphical user interface that should make it more accessible than tools built into more comprehensive molecular dynamics infrastructures. Importantly, for bimolecular reactions we derive an exact expression relating the macroscopic on-rate to the various microscopic parameters with the inclusion of excluded volume; this makes SpringSaLaD more accurate than other tools, which rely on approximate relationships between these parameters.

  14. SA-based concrete seismic stress monitoring: a case study for normal strength concrete

    Science.gov (United States)

    Hou, S.; Zhang, H. B.; Ou, J. P.

    2016-09-01

    The stress history of concrete structures that have survived an earthquake can serve as a critical index to evaluate the health of the structure. There are currently few reliable monitoring methods to assess concrete stress after a seismic event. Piezoelectric-based smart aggregate (SA) provides an innovative experimental approach to monitor stress on concrete. The principle of SA-based concrete seismic stress monitoring is based on the assumption that concrete stress can be reliably predicted by the average output voltages of limited SAs with an acceptable margin of error. In this study, the meso-scale randomness of concrete was evaluated throughout the overall stress range of concrete and the influence of different load paths was considered. Four cylindrical specimens of normal strength concrete were embedded with a total of 24 SAs. The SA output sensitivity curve in the paths of loading-unloading with different amplitudes and monotonic loading up to failure was obtained. Monitoring errors were analyzed during pre- and post-peak stages from the experimental results. This research suggests that SA-based concrete seismic stress monitoring for normal strength concrete is reliable.

  15. Mulher, direito e saúde: repensando o nexo coesivo Women, rights and health

    Directory of Open Access Journals (Sweden)

    Rosa Maria Godoy Serpa da Fonseca

    1999-12-01

    Full Text Available Esse artigo é construído a partir de três elementos básicos: mulher, direito e saúde, articulados entre si a partir de: 1 considerações acerca das condições objetivas de constituição das mulheres enquanto sujeitos sociais na sociedade contemporânea; 2 direitos das mulheres como direitos humanos e 3 direito das mulheres à saúde no contexto da implementação do PAISM (Programa de Atenção Integral à Saúde da Mulher, como focalização do SUS (Sistema Único de Saúde.That article is built from three basic elements: women, rights and health, articulated to each other starting from: 1 considerations concerning the objective conditions of the women's constitution as social subjects in contemporary society; 2 women's rights as human rights and 3 women's rights to health in the context of PAISM (Program of Integral Attention to the Woman's Health, as part of SUS (Unified System of Health.

  16. 77 FR 24342 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2012-04-24

    ...-250-AD; Amendment 39-17014; AD 2012-07-08] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... (75 FR 30284, June 1, 2010), and adding the following new AD: 2012-07-08 Empresa Brasileira de...) Applicability (1) This AD applies to all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100...

  17. 76 FR 64785 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2011-10-19

    ...-159-AD; Amendment 39-16838; AD 2011-21-15] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira...: 2011-21-15 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16838. Docket No. FAA-2011...) becomes effective November 23, 2011. Affected ADs (b) None. Applicability (c) This AD applies to...

  18. 77 FR 16155 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2012-03-20

    ...-035-AD; Amendment 39-16980; AD 2012-05-08] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... directive (AD) for all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 airplanes. This AD... amends Sec. 39.13 by adding the following new AD: 2012-05-08 Empresa Brasileira de Aeronautica...

  19. 76 FR 81894 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2011-12-29

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira..., except Federal holidays. For service information identified in this proposed AD, contact Empresa... the following new AD: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket No. FAA-...

  20. 75 FR 19201 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2010-04-14

    ...-212-AD; Amendment 39-16261; AD 2010-08-06] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... 2. The FAA amends Sec. 39.13 by adding the following new AD: 2010-08-06 Empresa Brasileira de...)(2) of this AD; certificated in any category. (1) Empresa Brasileira de Aeronautica S.A....