WorldWideScience

Sample records for accueille sa nouvelle

  1. Nouvelles Pascaliennes

    OpenAIRE

    Descotes, Dominique

    2016-01-01

    Départ à la retraite Suzanne Montagne, l’un des plus fidèles Amis de Blaise Pascal et du Centre International Blaise Pascal, a pris sa retraite de conservateur de la Bibliothèque municipale. Une chaleureuse réception à l’Hôtel de Ville de Clermont-Ferrand a marqué l’événement, où Roger Quilliot, sénateur-maire de la Ville, et Jean-Marc Monteil, président de l’Université Blaise-Pascal, ont salué l’une des personnalités les plus actives de la Bibliothèque Municipale et Interuniversitaire. Les a...

  2. A Nouvelle Vague

    OpenAIRE

    Michel Marie

    2003-01-01

    In this discussion about Nouvelle Vague, the author demonstrates that the cinematographic phenomena appeared by chance, between 1959/1960, from a wide reaction against the French cinema. Particularly linked to the criticai Cahiers du Cinéma, the movement was consolidated after having excited a complex and paradoxical cinematographic practice involving happenings, ideas, authors, conceptions of direction and low budgets. It also allowed the appearance of a remarkable generation of cinematograp...

  3. A Nouvelle Vague

    Directory of Open Access Journals (Sweden)

    Michel Marie

    2003-06-01

    Full Text Available In this discussion about Nouvelle Vague, the author demonstrates that the cinematographic phenomena appeared by chance, between 1959/1960, from a wide reaction against the French cinema. Particularly linked to the criticai Cahiers du Cinéma, the movement was consolidated after having excited a complex and paradoxical cinematographic practice involving happenings, ideas, authors, conceptions of direction and low budgets. It also allowed the appearance of a remarkable generation of cinematographers, which is still a reference to the

  4. La nouvelle-tableau (2

    Directory of Open Access Journals (Sweden)

    Géraldine Jenvrin

    2012-06-01

    Full Text Available La nouvelle « Frémissante, la feuille se flétrit » met en scène le trouble d'un détenu qui par les seuls objets dont il dispose, lutte pour s'échapper intérieurement. L'usage du regard cinématographique porté sur les détails infimes de la matérialité carcérale, leur exposition sous forme de tableaux se faisant échos, les techniques de l’anonymat et du brouillage des repères objectifs, portent à son comble les dimensions énigmatiques et l'esthétique de la  brièveté propre à la nouvelle tout en permettant de  représenter la résistance de l'homme à l'enfermement et à la persécution.

  5. Nouvelle économie et gouvernance

    OpenAIRE

    Gérard Charreaux

    2000-01-01

    L'objectif de cet article exploratoire est d'éclairer les relations entre nouvelle économie et gouvernance. D'une part, il s'interroge sur la façon de modéliser les liens entre nouvelle économie, création de valeur et système de gouvernance de façon à appréhender, selon un double sens de causalité, la contrainte exercée par les systèmes de gouvernance sur les trajectoires de développement et, inversement, les évolutions des configurations des systèmes de gouvernance. D'autre part, l'article p...

  6. Nella filigrana di “Nouvelle Vague”

    Directory of Open Access Journals (Sweden)

    Roberto Chiesi

    2012-06-01

    Full Text Available Jean-Luc Godard’s Nouvelle Vague (1990 presents an emblematic title that celebrates the 30th anniversary of A bout de souffle. Godard’s film is dominated by doubles – two times, two identities, two stories, two loves, two drownings – and by a range of echoes and literary quotations (Chandler, Homer, Leopardi, Dante, Rimbaud, Spengler, or cinematographic allusions (Hitchcock, Mankiewicz, Lewin, Antonioni, Huston which form the fabric of a story told as the reflection or the superimposition of another one.

  7. La zone nouvelle de Pudong (Shangai

    Directory of Open Access Journals (Sweden)

    Gabriel Weissberg

    2000-09-01

    Full Text Available Depuis 1990 et au prix de lourds investissements en infrastructures, le gouvernement et les autorités locales espèrent faire de la Zone Nouvelle de Pudong un élément clé de l’expansion de Shanghai. Neuf zones d’activités accueillent habitat, services et industries. Le développement de la ZNP reste cependant marqué par certaines faiblesses qui posent la question de son rôle dans le renouveau attendu de Shanghai.

  8. Villes et nouvelle économie

    Directory of Open Access Journals (Sweden)

    Emmanuel Éveno

    2003-06-01

    Full Text Available Cet article analyse les modes d’insertionspatiale des technologies de l’information et de la communication (TIC dans les métropoles puis aborde la question des mythes d’une «antigéographie» soulevés par cette nouvelle vague d’innovations dont les postulats sont basés sur les effets de réseaux et les technologies de lutte contre la distance. Trois approches (hiérarchie urbaine, réorganisation de l’espace métropolitain, nouveaux objets urbains essaient de montrer toute la place de la géographie et des problématiques territoriales autour des TIC.

  9. Yoram Mouchenik, L’enfant vulnerable. Psychotherapie transculturelle en pays kanak (Nouvelle-Caledonie)

    OpenAIRE

    Juillerat, Bernard

    2008-01-01

    Formé en psychologie et notamment en psychothérapeutique transculturelle, Yoram Mouchenik a entrepris dès 1992 – en collaboration avec des éducateurs, des psychologues des institutions locales – un certain nombre d’enquêtes dans les îles Loyauté (Nouvelle-Calédonie) : un travail de longue haleine dont il nous livre dans cet ouvrage trois cas d’enfants psychologiquement (physiquement aussi pour l’un d’entre eux) handicapés et où il nous explique sa méthode. Précisons-le d’emblée : cette derniè...

  10. Une nouvelle épitaphe latine découverte à Chalon-sur-Saône (Cabillonum, cité des Éduens) : à propos des monuments funéraires et de l’onomastique en pays éduen

    OpenAIRE

    Fernoux, Henri-Louis; Mathieu, Nicolas

    2008-01-01

    La publication d’une épitaphe inédite découverte en 2003 dans l’enceinte romaine de Chalon-sur-Saône permet de faire provisoirement le point sur le corpus des monuments funéraires du Chalonnais et offre de nouveaux éclairages sur l’onomastique et les courants de population dans le pays éduen à la fin du IIe siècle ap. J.-C. Ce nouveau document, stèle du type le plus simple, que le formulaire permet de situer dans la période 150 - 200 ap. J.-C., fournit la nomenclature de deux pérégrins probab...

  11. NOUVELLES TECHNOLOGIES EDUCATIVES, RISQUES PEDAGOGIQUES ET CONTROLE DE GESTION

    OpenAIRE

    Bescos, Pierre-Laurent

    2000-01-01

    International audience Les Nouvelles Technologies Educatives (NTE) peuvent être très utiles pour augmenter l'efficacité pédagogique et l'implication des étudiants, notamment pour des cours en comptabilité ou contrôle de gestion. Mais leur utilisation ne se fait pas sans certains risques, à partir du moment où cela s'accompagne nécessairement de nouvelles approches pédagogiques et du fait de la dépendance vis-à-vis des diverses technologies employées. A partir d'une expérimentation sur un c...

  12. Nouvelles technologies et travail du dirigeant

    OpenAIRE

    Fallery, Bernard

    2001-01-01

    Presque quinze ans après l'étude de H. Mintzberg, et presque quinze ans avant l'étude de Y. Lemarié, notre thèse, soutenue en 1983 sous la direction de R. Reix, avait pris sa place dans la longue suite des investigations sur les dirigeants: notre objet d'analyse n'était pas les managers en général, mais bien LE dirigeant, cet acteur qui tient une place si particulière dans l'imagerie de l'entreprise, et le terrain d'étude était volontairement la petite entreprise de moins de 100 salariés. Dan...

  13. SEMINAIRE DE L'ENSEIGNEMENT TECHNIQUE Nouvelles Technologies en Tuyauteries Multicouches - French version only

    CERN Multimedia

    Davide Vitè

    2002-01-01

    Mardi 28 mai, mercredi 29 mai 28 mai, 9:30 - 12:00 - Training Centre Auditorium, Room 11, bldg. 593 28 mai, 14:00 - 17:00; 29 mai, 9:00 - 12:00 - Training Centre Rooms 13 and 15, bldg. 593 Nouvelles Technologies en Tuyauteries Multicouches Jacques Dougoud / GEBERIT SA, Lausanne, Suisse Mario Bettini / GEORG FISCHER PFCI S.r.l., Peschiera del Garda, Brescia, Italie Christian Tacco / VALSIR S.P.A., Vestone, Brescia, Italie Depuis quelques années l'apparition de tubes multicouches a changé radicalement la conception des tuyauteries, tant pour les applications industrielles que domestiques. Les utilisations au CERN concernent pratiquement tous les fluides, c'est-à-dire eau sanitaire, eau déminéralisée, air comprimé, fluorocarbones liquides ou gazeux, et tous les gaz, depuis l'hélium jusqu'au xénon. Ce séminaire de l'Enseignement Technique est adressé à toute personne concern&eac...

  14. Nouvelle application de control des cavités 200 MHz RF du PS (CERN)

    CERN Document Server

    Cotte, D

    2011-01-01

    Le système Radio Fréquence (RF) 200MHz du PS est un outil essentiel pour la préparation des faisceaux haute intensité du PS. Dans l’anneau PS on trouve 6 cavités 200 MHz utilisées pour contrôler : • l’émittance longitudinale des « bunches » • le processus de « Rebunching » du faisceau avant de l’envoyer au SPS. Chaque cavité est pilotée par des événements appelés « timing » et suit une fonction de tension programmée. Cependant, l’électronique utilisée pour piloter les cavités 200 MHz du PS est obsolète et sa fiabilité non garantie pour cause du manque de pièces de rechange. Ce document décrit le fonctionnement du nouveau programme d’application qui fait abstraction de l’ancienne matrice hardware. Elle suit les recommandations décrites dans l’étude d’une nouvelle structure pour le système RF 200MHz du PS. [1

  15. La « nouvelle orthographe », 21 ans plus tard

    Directory of Open Access Journals (Sweden)

    Farid Georges

    2012-07-01

    Full Text Available La « nouvelle orthographe » (appellation discutable découle du rapport du Conseil supérieur de la langue française de France "Les rectifications de l'orthographe", lequel a été approuvé par l’Académie française et publié dans le Journal officiel de la République française en 1990. Ces modifications orthographiques touchent au départ 2000 mots, et plus tard, 5000 mots avec l'intégration de termes techniques, et ce, en lien avec le trait d’union et la soudure, le singulier et le pluriel des noms composés et des mots étrangers, les accents et le tréma, les consonnes doubles, le participe passé de « laisser » suivi d’un infinitif, et certaines anomalies. Où en sommes-nous aujourd’hui : 21 ans plus tard? Qui les met en application : ministères, dictionnaires, grammaires, logiciels, correcteurs orthographiques? Qui s’y oppose et pourquoi? Quelles sont les forces et faiblesses des rectifications en question? Quels en sont les avantages ou les inconvénients pour les scripteurs? Autant de questions auxquelles cette communication répondra, avec de multiples références à l'appui. Après un bref historique de l’évolution de l’orthographe française de 1694 à 1975, et de 1975 jusqu’à 2011, nous rappellerons en quoi consistent les rectifications orthographiques de 1990. Nous analyserons les avantages et inconvénients (observations linguistiques de la « nouvelle orthographe » qui, pour ses détracteurs est une infamie, et pour ses partisans, une « réformette », mieux, une timide rectification. Seront discutées, entre autres, les points de vue de linguistes et de grammairiens : Catach, Goosse, Bentolila, Honveault, Duneton, Müller, Contant, et jusqu’à quel degré sept règles modernes contribuent réellement à la cohérence du système graphique et à la simplification de l'apprentissage. Enfin, nous soulèverons les questions qui préoccupent les scripteurs en termes de mise en application des

  16. LHC 2008 lectures "Une nouvelle vision du monde"

    CERN Multimedia

    2008-01-01

    The history of the science of the Universe and the science of matter have been marked by a small number of "revolutions" that have turned our understanding of the infinitesimally large and the infinitesimally small on its head. New ways of looking at the world have come about sometimes through conceptual advances and sometimes through innovations in scientific instrumentation. How do things stand at the beginning of the 21st century? Will today’s large-scale machine projects like the LHC and gravitational wave detectors pave the way for a new scientific revolution? Thursday, 15 May 2008 at 8.00 p.m. Une nouvelle vision du monde Jean-Pierre Luminet, Research Director at the CNRS The Globe, first floor No specialist knowledge required. Entrance free. To reserve call + 41 (0) 22 767 76 76 http://www.cern.ch/globe

  17. Evolution de la stratégie multicanal chez Vedia S.A.

    OpenAIRE

    Hug, Nicole; Morand, Jean-Claude

    2009-01-01

    La société Vedia S.A. est active dans le domaine de la vente par correspondance sur le territoire Suisse. Elle vend des articles de tout genre pour une utilisation quotidienne sous deux noms de marque : Vedia et Kays. La nouvelle stratégie qu’aimerait poursuivre la société est de se lancer dans le multicanal de distribution en ouvrant un magasin qui lui permettera en partie de liquider de la marchandise à prix réduit. Lors d’une analyse de l’environnement démographique et économique il en est...

  18. Description d’une espèce nouvelle du genre Potamophora, Guen

    NARCIS (Netherlands)

    Snellen, P.C.T.

    1884-01-01

    Dans les „Suites à Buffon, Noctuélites III, p. 122”, le genre Potamophora de Mr. Guenée ne comprend qu’une seule espèce, la Pot. Manlia Cram. Depuis, trois nouvelles espèces ont été publiées dont deux, la Pot. Neocherina Butler, Ent. Monthly Mag. XIV (1877) p. 109 de Queensland (Nouvelle Hollande) e

  19. Sûreté de fonctionnement des convertisseurs - Nouvelles structures de redondances pour onduleurs sécurisés à tolérance de pannes

    OpenAIRE

    Dou, Zhifeng

    2011-01-01

    Au sein d'un convertisseur la défaillance d'un composant de puissance est un événement critique tant par le risque d'explosion du boitier et sa propagation au sein du système (forte énergie stockée dans l'alimentation) que par l'interruption de service qui en découle (systèmes embarqués, systèmes de production en flux tendu). Ce mémoire de thèse propose un ensemble de solutions nouvelles portant sur la problématique de l'isolement ultime de défauts "derniers secours" d'une part, et sur la con...

  20. « L’Iran, la démocratie et la nouvelle citoyenneté ». Cahiers internationaux de sociologie, CXI, (2001), pp. 291-317.

    OpenAIRE

    Bromberger, Christian

    2006-01-01

    Les mouvements des étudiants, des intellectuels et des femmes traduisent le décalage de plus en plus sensible entre la société et l’État dans l’Iran d’aujourd’hui. Une nouvelle génération juvénile refuse le puritanisme du régime et sa prétention à régir la vie de l’individu dans sa totalité au nom de l’islam. Plusieurs intellectuels « post-islamistes » revendiquent une démarcation du politique et du religieux, assurant au croyant son autonomie spirituelle, un qabḍ-e dīn (« une religion contra...

  1. L’élevage de la crevette bleue en Nouvelle -Calédonie

    OpenAIRE

    Della Patrona, Luc; Brun, Pierre; Peignon, Jean-marie

    2009-01-01

    Ce poster présente l'ouvrage homonyme qui représente une somme de connaissances considérable sur l’élevage de la crevette bleue Litopenaeus stylirostris en Nouvelle-Calédonie. Les différents aspects de l’élevage y sont détaillés avec de nombreux exemples très concrets et une iconographie abondante, 320 pages,101 figures, 49 photos, 85 tableaux, près de 500 références bibliographiques. Cet ouvrage satisfera naturellement les professionnels de la crevetticulture en Nouvelle-Calédonie et au delà...

  2. Telecomunicaciones S.A.

    OpenAIRE

    2010-01-01

    En este documento se encuentra el caso de Telecomunicaciones S.A., una empresa nacional de telecomunicaciones cuya visión es ofrecer servicios de calidad, en forma permanente, buscando su actualización en este campo con el fin de hacer cobertura a una amplia poblaci�n colombiana.

  3. Tradition et innovations esthétiques dans la nouvelle yéménite contemporaine Tradition and aesthetic innovations in contemporary Yemeni short stories

    Directory of Open Access Journals (Sweden)

    Géraldine Jenvrin

    2008-04-01

    Full Text Available Le nouveau recueil de Mu/hammad ‘Abd al-Wakîl Jâzim témoigne d’une transformation capitale dans la littérature yéménite contemporaine :  le passage d’une forme expérimentale en rupture avec les règles de la nouvelle traditionnelle et avec la réalité yéménite, à une autre forme plus accomplie dans laquelle les principes traditionnels de la nouvelle sont ici associés sans complexe aux formes renouvelées du genre.  La nouvelle intitulée Le maître des vautours, présente, dans une structure narrative traditionnelle, un conte fantastique moderne qui mêle réalisme, symbolisme et poésie, et dans lequel l’auteur traite à sa manière les thèmes littéraires contemporains de la dualité du rêve et de la réalité, du désenchantement et de l’enfermement perpétuel.  C’est notamment en s’inspirant de la langue, des pratiques orales, des croyances et de l’imaginaire populaire, que l’auteur, soucieux de donner un ancrage au texte dans la réalité yéménite, transfigure cette expérience existentielle moderne.The latest collection of short stories by Mu/hammad 'Abd al-Wakîl signals a major shift in contemporary Yemeni literature: from an experimental form, breaking away from both traditional short story conventions and Yemeni reality, to another, more accomplished form, unabashedly mixing traditional short story principles with renewed genre forms. The short story entitled The Vulture Master presents us, from within a traditional narrative structure, with a modern fantasy tale blending in realism, symbolism and poetry, and where the writer deals in his own way with such contemporary literary themes as disenchantment, perpetual captivity, and the duality of dream and reality. Drawing his inspiration from language itself, oral practices, beliefs and popular imagery, the writer, seeking to set his tale firmly in Yemeni reality, manages to transfigure this modern existential experiment.

  4. Prise en compte du spirituel et nouvelles représentations du soin

    OpenAIRE

    Chatel, Tanguy

    2006-01-01

    International audience To what extended comprehension of "care", the spiritual care in the secularized and public context of palliative care may lead us ? A quelles nouvelles représentations du soin nous convie une prise en compte de la souffrance spirituelle dans le contexte laïque et public des soins palliatifs ?

  5. Equity valuation - Aena, SA

    OpenAIRE

    Matos, Maria Inês Viegas Aleixo de

    2016-01-01

    This dissertation presents the valuation of Aena SA, traded on Madrid Stock Exchange. Two methods were applied – Adjusted Present Value and Relative Valuation – and a sensitivity analysis was performed to challenge the values obtained. Through Adjusted Present Value methodology a share price of €121,4 per share was obtained. Thus, an Overweight recommendation applies. Relative valuation was considered only as a validation tool and, therefore, the recommendation was not based on its results. L...

  6. Equity valuation : Eurocash SA

    OpenAIRE

    Valdez, Francisco Miguel Gomes da Silva

    2013-01-01

    valuation is a cumbersome endeavor, dependent on different theoretical frameworks and subject to the analysts’ subjective interpretations. This dissertation is focused on valuing Eurocash SA, a Polish wholesaler. Thus, providing an illustration of the challenges faced when valuing enterprises. In particular, three different theoretical frameworks, suggested by the most renowned authors in this field of study, were utilized to capture the value of Eurocash. To successfully accom...

  7. IFP Energies Nouvelles. 2014 Activity report - Innovating for energy

    International Nuclear Information System (INIS)

    As part of the public-interest mission with which it has been tasked by the public authorities, IFP Energies Nouvelles (IFPEN) focuses on: - providing solutions to take up the challenges facing society in terms of energy and the climate, promoting the emergence of a sustainable energy mix, - creating wealth and jobs by supporting French and European economic activity, and the competitiveness of related industrial sectors. Despite the current economic environment, 2014 was a good year for IFPEN. In the field of renewable energies, major milestones were reached in two significant projects dedicated to the production of second generation biofuels in which IFPEN is very actively involved: processes developed in FuturolTM are already in the pre-marketing phase, while the construction of the two pilot units for the BioTfueL project has just been launched. In the field of ocean energies, IFPEN research has led to the first partnership agreements relating to floating wind turbines anchor technologies and command control systems for wind energy and wave energy conversion. In the transport sector, game-changing concepts are beginning to emerge, such as smart battery charging and a Rankine cycle system for an internal combustion engine transforming combustion heat into energy. In addition, IFPEN have joined forces with innovative SMEs to boost their research in the fields of electric power-trains and power electronics. Finally, IFPEN launched an eco-driving application that has proved extremely popular with the public. Turning now to oil and gas, IFPEN continued to expand its range of basin and reservoir simulation, modeling and characterization software, and it signed several contracts in the field of chemical enhanced recovery solutions with its EOR (Enhanced Oil Recovery) AllianceTM partners. IFPEN also developed new generations of high-performance catalysts and improved the conversion rate of its processes to enable refiners to convert increasingly heavy crudes and comply

  8. Nouvelle structure de capteur à courants de Foucault et algorithme associé pour la mesure des propriétés électrique et magnétique d'un métal

    OpenAIRE

    Lê, Minh-Quang; Placko, Dominique

    1995-01-01

    Cet article décrit une nouvelle structure de capteur à courants de Foucault qui permet d'améliorer la sensibilité du capteur tout en conservant sa résolution latérale. Nous avons développé un modèle analytique de ce capteur qui peut être inversé pour estimer la conductivité électrique, la perméabilité magnétique d'une cible homogène et/ou la distance capteur-cible. La procédure d'inversion a été décrite et montre une possibilité d'estimer ces trois paramètres avec précision. L'expérience a ét...

  9. Deux nouvelles lèvres de Cassidae au PPNB

    Directory of Open Access Journals (Sweden)

    Gaëlle Le Dosseur

    2008-03-01

    Full Text Available En 2008, deux nouvelles lèvres de Cassidae ont été mises au jour sur deux sites néolithiques (Néolithique Précéramique B : PPNB du Levant Sud : Beisamoun et Yiftahel. Il s’agit d’objets façonnés sur la lèvre externe de coquillages méditerranéens appelés Phalium granulatum. Des aménagements pour la suspension (perforations aux extrémités laissent penser que ces objets ont été utilisés comme pendentifs ou qu’ils ont été cousus sur des vêtements ou des accessoires. Ces découvertes alimentent la discussion sur l’approvisionnement en matières premières mais aussi sur les parentés culturelles et les singularités de chaque site à cette époque. Si l’usage de lèvres de Cassidae est partagé par de nombreux sites PPNB, les modes de fabrication et de suspension ne sont pas strictement les mêmes sur tous. Ces variations reflètent-elles une évolution des modes de suspension dans le temps (au cours du PPNB moyen/récent ? Ou révèlent-elles des choix « contemporains » distincts, qui contribueraient à définir l’identité propre de chaque site ?   Après le Néolithique, l’usage des lèvres de Cassidae se poursuit aux Âges des métaux. À cette époque plus qu’au Néolithique, ces objets sont retrouvés dans des contextes funéraires. Il est difficile de savoir si cette situation résulte des méthodes de fouilles distinctes adoptées sur les sites néolithiques et sur ceux des Âges des métaux ou si elle est une réalité archéologique. Dans le second cas, on pourrait proposer que le sens donné aux lèvres de Cassidae, en partie reflété par le lieu de dépôt, a pu évoluer avec le temps.Two more cassid lips for the PPNBBeisamoun and Yiftahel In 2008, two new cassid lips have been found on two Neolithic sites (Pre Pottery Neolithic B, in the Southern Levant: Beisamoun and Yiftahel. These objects are shaped on the external lip of shells coming from the Mediterranean Sea and called Phalium

  10. L’Observatoire numérique Nouvelle-Calédonie

    Directory of Open Access Journals (Sweden)

    Charlotte Ullmann

    2013-06-01

    Full Text Available Ses missions consistent à observer le développement numérique et favoriser l’animation territoriale des acteurs en Nouvelle-Calédonie. Parrainée par l’association calédonienne pour les technologies de l’information et de la communication (ACTIC et le ministère en charge de l’économie numérique du Gouvernement de Nouvelle-Calédonie nommé depuis mai 2009, une mission d’étude a été menée depuis juin 2010 pour définir les contours d’un Observatoire numérique. A travers cette étude, il s’agissai...

  11. La formation d’une nouvelle régulation sociale en Tchécoslovaquie

    OpenAIRE

    Jiří Večerník

    1994-01-01

    Dans cet article, l’auteur s’intéresse à l’instauration d’une nouvelle forme de protection sociale en Tchécoslovaquie, parallèlement aux réformes économiques. Il s’intéresse ici aux problèmes liés à la mise en place de nouvelles régulations sociales, en posant la question du rôle de l’héritage du passé, et en analysant les nouveaux défis lancés par l’Europe et le nouvel Etat tchécoslovaque démocratique. Enfin, il se penche sur les adaptations et les transformations des institutions et du syst...

  12. La Nouvelle-Calédonie: modèle d'île

    Directory of Open Access Journals (Sweden)

    Thérèse PANOUILLÈRES

    1986-12-01

    Full Text Available Relief, précipitations, répartition de la population accusent un certain nombre de dissymétries est-ouest en Nouvelle-Calédonie; la colonisation récente et la concentration de plus de la moitié des habitants à Nouméa sont un facteur supplémentaire de déséquilibre spatial.

  13. Description d’une nouvelle espèce du genre Platypria

    NARCIS (Netherlands)

    Gestro, R.

    1898-01-01

    Je suis redevable à l’amabilité de M. Ritsema de l’occasion de décrire une nouvelle espèce de Platypria, genre qui a été jadis l’objet de quelques uns de mes travaux et je remercie le savant Conservateur au Musée de Leyde d’avoir été et d’être toujours si obligeant et si large dans ses communication

  14. Meta Analisis sa Pagsusuri ng Maiikling Kwento sa mga Tesis at Disertasyon

    OpenAIRE

    Regina I. Cuizon

    2014-01-01

    Anumang mga pagbabago na makikita sa mundo ay bunga ng pananaliksik. Ang meta-analisis ay isa sa mga bunga ng pananaliksik na ginagamit sa kasalukuyan bilang teknik upang malaman iba pang mga nagsulputang informasyon. Ito’y pag-aaral sa mga pag-aaral. Isang kritikal at sistematikong pagsusuri sa istruktura ng mga pag-aaral. Maging gabay sa mga gradwadong paaralan sa pagpili ng paksang pagaaralan. Pangunahing layunin na matiyak ang mga pamamaraan sa pagsusuri ng maiikling kwento ng...

  15. Varyasyong Leksikal sa mga Dayalektong Mandaya

    OpenAIRE

    Dr. Raymund M. Pasion

    2014-01-01

    Layuning panlahat sa pag-aaral na ito na tuklasin ang varyasyong leksikalsa Wikang Mandaya na matatagpuan sa Probinsyang Davao Oriental. Bilang lunsaran sa paglilikom ng mga datos, ginamit ang mga terminong kultural na pangkabuhayan tulad ng pagsasaka, pangangaso, pangingisda at paghahayupan nanababatay sa Indigenous Knowledge System and Practices (IKSP).Sinikap sagutin sa pagaaral ang suliraning ano-anong varyasyong liksikal ang makikita sa mga terminong kultural na pangkabuha...

  16. Business valaution - Pegas Nonwovnes SA

    OpenAIRE

    Mihardja, André

    2007-01-01

    This thesis concerns valuation of Pegas Nonwovens SA. The valuation was carried out using DFC entity method and market comparable approach. The valuation also contains financial analysis of the company, market analysis and projected financial statements and value drivers.

  17. Meta Analisis sa Pagsusuri ng Maiikling Kwento sa mga Tesis at Disertasyon

    Directory of Open Access Journals (Sweden)

    Regina I. Cuizon

    2014-10-01

    Full Text Available Anumang mga pagbabago na makikita sa mundo ay bunga ng pananaliksik. Ang meta-analisis ay isa sa mga bunga ng pananaliksik na ginagamit sa kasalukuyan bilang teknik upang malaman iba pang mga nagsulputang informasyon. Ito’y pag-aaral sa mga pag-aaral. Isang kritikal at sistematikong pagsusuri sa istruktura ng mga pag-aaral. Maging gabay sa mga gradwadong paaralan sa pagpili ng paksang pagaaralan. Pangunahing layunin na matiyak ang mga pamamaraan sa pagsusuri ng maiikling kwento ng mga tesis at disertasyong nagawa mula sa mga piling SUCs. Desinyong kwalitatibo - kontent analisis sa pagsusuri ng: kaanyuan ayon sa suliranin, metodolohiya, paglalahad at interpretasyon ng mga datos, natuklasan, konklusyon, at rekomendasyon; kahinatnan ayon sa pagkatulad, pagkakaiba at kabuluhan; Emerging tema. Napag-alaman na ang karaniwang pinag-aralan ay 30% kahalagahang pangkatauhan, 20% larawangdiwa ng mga kababaihan at 10% gramatikang aspeto. Sa metodolohiyang ginamit, 80% desinyong kwalitatibo at 20% kwantitatibo-kwalitatibo. Sa paglikom ng datos 60% diretsahang pagsusuri, 30% talatanungan at 10% tseklis. Sa pag-analisa 90% kontent analisis at 10% gramatikal analisis. Batay sa natuklasan, ang pagsusuri ng maiikling kwento sa mga tesis at disertasyon mula sa iba’t ibang paaralan gamit ang meta analisis ay isang epektibo, mabisa, objektibong paraan at kagamitan na magagamit sa makatarungang paghatol; pamumuna sa kabuluhan at kagandahan; paghaham- bing sa mga kritikal na isyu; at pormulasyon ng panibagong pamantayan at batas.

  18. David, Charles-Philippe et la Chaire Raoul-Dandurand (éds : Repenser la sécurité, nouvelles menaces, nouvelles politiques, Quebec : Fides la Presse, 315 p, annexes.

    Directory of Open Access Journals (Sweden)

    Gérard Groc

    2004-12-01

    Full Text Available La Remmm couvrant essentiellement le monde arabe et musulman, le livre Repenser la sécurité, nouvelles menaces et nouvelles politiques dont nous faisons ici le compte-rendu, nous interpelle moins dans le fourmillement de considérations militaires, stratégiques, balistiques extrêmement techniques qu'en fonction de la prémisse à partir de laquelle est faite cette réévaluation de la sécurité, à savoir l'aire musulmane mais aussi l'islam. L'objet global de ce livre, réalisé par toute une équipe ...

  19. Une nouvelle étape dans la sociologie des professions en France

    OpenAIRE

    Vézinat, Nadège

    2010-01-01

    La sociologie des groupes professionnels ne constitue pas un objet nouveau de la sociologie ; néanmoins, des redéfinitions de l’objet, du champ et des approches ont été proposées récemment dans la sociologie française avec pour enjeu, d’introduire de nouvelles perspectives. Le passage d’une sociologie des professions (plutôt anglo-saxonne) à une sociologie des groupes professionnels (portée par la France) peut constituer un virage important dans la compréhension des communautés professionnell...

  20. Nouvelles découvertes dans le quartier du Mīdān

    OpenAIRE

    Dayoub, Bassam

    2013-01-01

    Le quartier du Mīdān est sans aucun doute le faubourg de Damas le plus représentatif de l’histoire de l’expansion de la ville hors de ses murailles. Toutefois, plusieurs édifices de ce secteur demeurent non identifiés. Ces monuments viennent cependant nous renseigner sur l’histoire de la ville et sur les personnages qui sont à l’origine de l’urbanisation des espaces extra-muros. Le but de cet article est de fournir des données nouvelles contribuant à identifier, à travers quatre monuments, le...

  1. Perspective anthropologique sur l'infanticide. : La notion de personne en Nouvelle-Guinée

    OpenAIRE

    Bonnemère, Pascale

    2009-01-01

    National audience Cet article cherche à décentrer le regard sur l'infanticide en présentant plusieurs travaux qui abordent de près ou de loin le sujet dans la littérature anthropologique sur la Nouvelle-Guinée. C'est à des conceptions différentes de la personne et du statut du nourrisson que nous renvoient ces travaux, ainsi que ceux, bien connus, consacrés à la Rome antique, par exemple.

  2. Une nouvelle approche de la relation vision-commande en robotique

    OpenAIRE

    Espiau, Bernard; Chaumette, François; Rives, Patrick

    1990-01-01

    Ce rapport presente les concepts et les resultats relatifs a une nouvelle approche de la commande referencee vision en robotique. L'idee de base consiste a considerer un systeme de vision comme un capteur particulier associe a une tache, et insere dans une boucle de commande. Une fois effectuee l'etape necessaire de modelisation, la problematique ainsi posee ressort alors de l'automatique, et met en avant des questions naturelles de stabilite et de robustesse. Ce rapport est structure comme s...

  3. Nouvelle gouvernance agricole et politique environnementale : harmonisation ou conflits d'objectifs ?

    OpenAIRE

    Rivaud, Audrey

    2007-01-01

    La prise en compte du contexte international, notamment dans le cadre des négociations au sein de l'organisation mondiale du commerce, a conduit à une réforme très importante, en 2003, de la politique de soutien à l'agriculture. Parallèlement, les préoccupations environnementales et la nécessité d'intégrer les objectifs relatifs au développement durable se posent comme des priorités pour le modèle agricole. C'est autour de ces deux piliers que s'articule la nouvelle gouvernance agricole. En a...

  4. A Robust Separation Assurance (SA) Architecture Using Integrated Airborne and Ground SA Concepts Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Intelligent Automation, Inc. proposes a robust SA architecture that uses integrated airborne and ground-based SA concepts such that SA functions are switched...

  5. La christianisation de la Nouvelle-Espagne ou le rêve d’une église indienne : la praxis de l’évangélisation

    Directory of Open Access Journals (Sweden)

    Hervé Pujol

    2012-01-01

    Full Text Available En consacrant la partition du Nouveau monde entre l’Espagne et le Portugal et en fixant aux deux royaumes les limites de leur souveraineté, les bulles alexandrines de 1493 ont assigné aux Espagnols la mission d’évangéliser les Indiens. Ainsi, avant même le débarquement de Cortès au Mexique, cette interaction entre le temporel et le spirituel encourageait déjà la dynamique de conversion autant qu’elle scellait le sort des autochtones appelés à devenir et vassaux et chrétiens. Initié brutalement, le processus évangélisateur assura pourtant la renaissance de l’âme indigène tandis qu’il apparut, aux yeux des missionnaires en charge de sa réalisation, comme l’occasion de poser, en Nouvelle-Espagne, les fondements d’une nouvelle église, plus vertueuse.In partitioning the New World, Pope Alexander VI in the papal bulls of 1493 (Inter Caetera granted sovereignty of these lands to Spain and Portugal, ordering the religious conversion of the indigenous people by the Spaniards in exchange. Even before the arrival of Cortès in Mexico, the temporal and spiritual conditions of the sovereignty motivated the missionaries and started the conversion dynamic that would seal the fate of the natives to become vassals and Christians. Though brutal conversion tactics were utilized, the religious souls of the natives were re-ignited as Christians, and in the eyes of the missionaries responsible, provided the opportunity to establish a new and more virtuous church in the New World.

  6. La christianisation de la Nouvelle-Espagne ou le rêve d’une église indienne : les agents de l’évangélisation

    Directory of Open Access Journals (Sweden)

    Hervé Pujol

    2012-01-01

    Full Text Available En consacrant la partition du Nouveau monde entre l’Espagne et le Portugal et en fixant aux deux royaumes les limites de leur souveraineté, les bulles alexandrines de 1493 ont assigné aux Espagnols la mission d’évangéliser les Indiens. Ainsi, avant même le débarquement de Cortès au Mexique, cette interaction entre le temporel et le spirituel encourageait déjà la dynamique de conversion autant qu’elle scellait le sort des autochtones appelés à devenir et vassaux et chrétiens. Initié brutalement, le processus évangélisateur assura pourtant la renaissance de l’âme indigène tandis qu’il apparut, aux yeux des missionnaires en charge de sa réalisation, comme l’occasion de poser, en Nouvelle-Espagne, les fondements d’une nouvelle église, plus vertueuse.In partitioning the New World, Pope Alexander VI in the papal bulls of 1493 (Inter Caetera granted sovereignty of these lands to Spain and Portugal, ordering the religious conversion of the indigenous people by the Spaniards in exchange. Even before the arrival of Cortès in Mexico, the temporal and spiritual conditions of the sovereignty motivated the missionaries and started the conversion dynamic that would seal the fate of the natives to become vassals and Christians. Though brutal conversion tactics were utilized, the religious souls of the natives were re-ignited as Christians, and in the eyes of the missionaries responsible, provided the opportunity to establish a new and more virtuous church in the New World.

  7. The genesis, methodical foundations, and problems in the realisation of the Atlas de la Nouvelle-Calédonie

    Directory of Open Access Journals (Sweden)

    Gay Jean-Christophe

    2014-03-01

    Full Text Available The article presents the main organisational, epistemological, and methodical principles assumed by one of the two scientific editors of the Atlas de la Nouvelle-Calédonie, and the problems they faced. The presented solutions may be useful to the authors of similar projects in the future.

  8. “Bachelard, science, poésie, une nouvelle éthique?” Convegno di Cerisy-la-Salle

    Directory of Open Access Journals (Sweden)

    Aurosa Alison

    2012-10-01

    Full Text Available “Bachelard, science, poésie, une nouvelle éthique?” Convegno di Cerisy-la-Salle (Direzione e coordinamento di Jean-Jacques Wunenburger ; Centre Culturel International de Cerisy-la-Salle 25 giugno-1 agosto 2012 di  Aurosa Alison

  9. The Importance of the Idealist Discourse in Defence of American Foreign Policy Initiatives: beyond rhetoric towards a new form of imperialism L’importance du discours idéaliste pour défendre la politique étrangère américaine : vers une nouvelle forme d’impérialisme

    Directory of Open Access Journals (Sweden)

    Andrew Ives

    2009-10-01

    Full Text Available Les États-Unis font rarement appel à un discours basé sur la défense de leurs propres intérêts nationaux pour défendre sa politique étrangère. Dans leur discours officiel, ils tentent plutôt de subordonner l’intérêt national aux objectifs plus nobles de défendre les droits de l’homme ou la démocratie. Cet article commence par retracer les origines de ce discours idéaliste américain. Puis, il tente d’analyser le rôle important joué par ce discours, suggérant qu’il est révélateur d’une nouvelle forme d’impérialisme. Elle est nouvelle dans la mesure où l’État-nation dominant se présente comme l’incarnation de la démocratie libérale faisant en sorte que ses propres intérêts coïncident avec ceux de la démocratie libérale. Le discours idéaliste serait, selon l’auteur, non pas une façade, mais plutôt un élément essentiel d’une nouvelle forme d’impérialisme car la relation étroite qui s’établit entre démocratie libérale et interventionnisme américain renforcerait les intérêts du capitalisme moderne.  

  10. Nouvelle cuisine

    CERN Multimedia

    2007-01-01

    Diners at CERN's Restaurant No. 1 have been adjusting to some temporary arrangements while building work takes place in the main service area. The essential renovation will bring many improvements in the near future. The restaurant before restoration. A huge white marquee erected on a green lawn greets the eye. The sight is familiar in the summer months, but the sharp chill in the air disrupts the scene. Instead of a mid-summer's day, it's actually the middle of January. This apparently strange reversal of seasons is a way of providing an additional dining and service area outside Restaurant No. 1. As renovations get underway inside, the mysterious hum of drills and the hollow echo of hammering behind scaffold boards raise our curiosity about what is in-store. 'Everything will be better,' says Mario Zanolini, head waiter of Restaurant No. 1. 'It will be more comfortable for the customers. The free-flow area will be bigger and there will be 7 tills instead of the previous 5.' These are just for starters. ...

  11. Nouvelles pascaliennes

    OpenAIRE

    Descotes, Dominique; Miteran, Stéphanie; Goyet, Thérèse

    2016-01-01

    Les journées sur le théologico-politique (3-4 mai 1996) Ces deux journées d’étude se sont déroulées à l’initiative du professeur Laurent Jaffro de l’Université de Paris I, dans le cadre des activités du Centre d’Études sur les Réformes, l’Humanisme et l’Âge Classique (CERHAC), à l’Université Blaise Pascal de Clermont-Ferrand ; elles ont réuni neuf intervenants autour de la question du théologico-politique. Le champ d’investigation des communications a permis de parcourir le vaste panorama de ...

  12. Varyasyong Leksikal sa mga Dayalektong Mandaya

    Directory of Open Access Journals (Sweden)

    Dr. Raymund M. Pasion

    2014-12-01

    Full Text Available Layuning panlahat sa pag-aaral na ito na tuklasin ang varyasyong leksikalsa Wikang Mandaya na matatagpuan sa Probinsyang Davao Oriental. Bilang lunsaran sa paglilikom ng mga datos, ginamit ang mga terminong kultural na pangkabuhayan tulad ng pagsasaka, pangangaso, pangingisda at paghahayupan nanababatay sa Indigenous Knowledge System and Practices (IKSP.Sinikap sagutin sa pagaaral ang suliraning ano-anong varyasyong liksikal ang makikita sa mga terminong kultural na pangkabuhayan ng Mandaya na makikita sa munisipalidad ng Caraga, Manay, Bagangaat Cateel? Disenyong kwalitatibo ginamit.Metodong indehinusat deskriptibo naman ang ginamit mula sa paglilikom hanggang sa pag-aanalisa ng mga datos. Samantalang, ang mga impormante ay pinilisa pamamagitan ng kombinasyong purposive at snow-ball sampling. Natuklasan, na ang wikang Mandaya ay nakitaan ng varyasyong lekisikal ayon sa magkakaiba ang anyo, may pagkakatulad ang anyo, at magkakatulad ang anyo subalit magkakaiba ang bigkas. Gayunpaman, pinaniniwalaang dahil sa paktor na heograpikal, sikolohikal at sosyolohikal na nagaganap sa kanilang kultura ay hindi rin maipagkailang nagyari ang varyasyong leksikal na aspekto nito.

  13. Sexualité, transgression et politique dans les premières nouvelles de Yu Dafu

    OpenAIRE

    Veg, Sebastian

    2013-01-01

    Parmi les écrivains de la génération du 4 mai, Yu Dafu (1896-1945) est sans conteste le plus scandaleux, ayant fait son entrée sur la scène littéraire en 1921 avec une nouvelle sur la misère sexuelle d’un étudiant chinois au Japon et sur le « délit » de masturbation qui le tourmente. Dans le même recueil, « Départ au sud » évoque les relations sexuelles entre un étudiant et une jeune fille japonaise dans un environnement rural idyllique. Ces premiers textes ont contribué à faire de Yu un écri...

  14. Nouvelle stratégie énergétique 2050

    OpenAIRE

    Dyllick-Brenzinger, Ralf Matthias; Yoon, David C.; Püttgen, Hans Björn

    2012-01-01

    La nouvelle politique énergétique de la Suisse prévoit, d’une part, l’arrêt progressif des centrales nucléaires et, d’autre part, la compensation de cette perte de production notamment par le développement intensif de l’énergie photovoltaïque et par des mesures de réduction de la consommation. Le Centre de l’énergie de l’EPFL a mené une étude sur l’interaction entre la production photovoltaïque et le stockage hydraulique afin de déterminer dans quelles mesures une telle stratégie pourrait êtr...

  15. Nouvelles mobilités et pratiques sociales : les Starbucks à Pékin

    OpenAIRE

    Pons, Blandine; Xiaoting, Jin; Puel, Gilles

    2007-01-01

    La multinationale Starbucks s'est montrée pionnière aux Etats-Unis, avec le déploiement de l'accès Wi-Fi. Autoproclamée entreprise éthique, elle offre un espace non-fumeur, des boissons non alcoolisées et un accès Internet payant et sécurisé, dans les lieux « branchés » des grandes métropoles.Après avoir resitué le modèle économique de l’entreprise dans le contexte global des nouvelles formes de mobilités et du développement de leurs enjeux marchands, les auteurs présentent les premiers résul...

  16. Relativité et quanta une nouvelle révolution scientifique

    CERN Document Server

    Cohen-Tannoudji, Gilles

    2016-01-01

    Ces trois dernières années, les moissons scientifiques ont été exceptionnellement fructueuses, de la découverte du boson de Higgs à celles des ondes gravitationnelles émises lors de la coalescence de deux trous noirs massifs, et aux observations du fond cosmologique par le satellite Planck. L'humanité vient alors d'atteindre un nouveau palier dans la compréhension du monde quantique et du monde de la gravitation : nos bases théoriques, expérimentales et technologiques forment un socle scientifique solide pour aller plus loin et tenter de répondre aux nouvelles questions qui surgissent suite à ces découvertes... Enquête et mise au point sur une révolution en cours.

  17. Hydrodiffusion assistée par micro-ondes : nouvelle technique d'éco-extraction

    OpenAIRE

    Zill-E-Huma, Huma

    2010-01-01

    L'hydrodiffusion générée par micro-ondes est une nouvelle technique d'extraction mise au point au sein de l'Université d'Avignon et des Pays de Vaucluse. Ce procédé est une combinaison entre une technique traditionnelle et une technologie innovante. En effet, le chauffage par micro-ondes a permis d'initier et de générer le transfert de matière et de chaleur de l"intérieur des matrices végétales (oignons) vers l'extérieur et de réduire de façon considérable les temps d'extraction des antioxyda...

  18. Images de femmes dans le cinéma de la Nouvelle Vague

    OpenAIRE

    Sellier, Geneviève

    2006-01-01

    L’émergence de la Nouvelle Vague au tournant des années 1960 peut se lire comme la revendication d’une posture créatrice relevant de la culture d’élite, dans un medium jusque là éminemment populaire, le cinéma. S’inscrivant dans une tradition culturelle particulièrement forte en France, ce nouveau cinéma va se conjuguer quasi-exclusivement au masculin singulier, et les figures féminines qu’il crée oscillent entre la prise en compte de l’émancipation des femmes réelles et des fantasmes romanti...

  19. Turquie, Grèce : un passé commun, des nouvelles perspectives

    OpenAIRE

    Akgönül, Samim; Bertrand, Gilles; Bilici, Faruk; Dalègre, Joëlle; Drettas, Georges; Sawas, Stéphane; Tonnet, Henri; YÉRASIMOS, Stéphane; Zerouali, Basma

    2013-01-01

    Sans être naïfs sur les questions aussi importantes que le contentieux en mer Égée, le problème chypriote, la question des minorités, la confrontation des nationalismes, l’instrumentalisation de l'histoire, l’utilisation des différends comme outil politique interne, avec ce numéro spécial « Turquie et Grèce : un passé commun, des nouvelles perspectives », nous avons voulu délibérément mettre l’accent sur la complémentarité et la communauté culturelle entre Grecs et Turcs, bien plus encore que...

  20. Ville nouvelle, quarante ans après : les pionniers vieillissants de Maurepas

    Directory of Open Access Journals (Sweden)

    Marie Peretti-Ndiaye

    2009-01-01

    Full Text Available Construites à partir des années 1960 sous l’impulsion du Schéma directeur d’Aménagement et d’Urbanisme de 1965, cinq villes nouvelles ont vu le jour en région parisienne. Leur aménagement laisse entrevoir une volonté de répondre à des besoins urbains identifiés, se conjuguant parfois avec l’offre d’espaces, de services ou d’équipements envisagés alors comme novateurs. Maurepas, rattachée jusqu’en 1984 à l’agglomération nouvelle de Saint-Quentin-en-Yvelines, a été façonnée en partie par ces aspirations. Elle constitue aujourd’hui une commune à la population vieillissante et à l’urbanisme marqué par des jeux d’échelle, des cloisonnements et par une relative uniformité. La configuration de la ville laisse entrevoir la volonté d’ébaucher « un nouveau genre de vie urbaine »(Pachaud, 2006 manifeste durant les années soixante et soixante-dix tandis que l’histoire de la commune permet d’envisager les difficultés inhérentes à l’intercommunalité. Au cœur de cette histoire se retrouvent des ménages de la classe moyenne, entrés dans le périurbain comme des pionniers. Portés par l’idéologie d’une ville-nouvelle où « tout est à construire » et qui leur ouvrait, parallèlement, des perspectives nouvelles en termes « d’espaces à soi », ces derniers sont aujourd’hui âgés de plus de soixante ans. Quarante ans après leur installation, leurs discours sur la ville révèlent l’existence de plusieurs ordres de tension : tension entre ruralité et urbanité, d’une part, tension entre adhésion, différenciation et réflexivité, de l’autre. Ces tensions peuvent être mises en parallèle avec les évolutions de la ville et la façon dont les formes urbaines sont mises en question dans l’espace des débats publics. Ces différents éléments nous conduiront à envisager les résistances et les projections à l’œuvre ainsi que les processus de subjectivation qu’elles r

  1. Les orientations nouvelles des politiques de réforme administrative en France

    OpenAIRE

    Jacques Chevallier

    2012-01-01

    Depuis les années 2000, les politiques de réforme administrative ont été caractérisées en France par une dynamique nouvelle, illustrée par le lancement en 2001 de la réforme budgétaire (LOLF) et en 2007 de la “révision générale des politiques publiques” (RGPP), et marquées par une influence beaucoup plus nette du New Public Management. Le bilan qu’il est possible d’en dresser reste pourtant incertain, les ambitions des réformateurs contrastant avec la réalité du terrain et la stratégie top do...

  2. Securite, dangerosite, biopolitique: trois versants d'une nouvelle pratique de pouvoir sur les individus

    Directory of Open Access Journals (Sweden)

    Jean-François Bert

    2012-01-01

    Full Text Available Le questionnement de Foucault sur la judiciarisation des sociétés contemporaines renvoie à plusieurs controverses qui, entre 1974 et 1976, ont spécifiquement concerné la question du vivant comme de son rapport au champ du droit et des institutions politiques. Ces polémiques se sont cristallisées autour d'affaires judiciaires retentissantes mais également autour d'un discours technique et politique qui donne une place nouvelle aux notions de dangerosité, de sécurité et à la question plus générale de la gestion du vivant. Trois discours qui, pour Foucault, sont révélateur d'un profond changement de société et de mode de gouvernement des individus.

  3. La nouvelle donne de la santé globale : dynamiques et écueils

    Directory of Open Access Journals (Sweden)

    Marine Buissonnière

    2012-04-01

    Full Text Available Les quinze dernières années ont été marquées par l’avènement de nouveaux acteurs dans le champ de la santé globale et l’augmentation de l’aide au développement en faveur de la santé. Ces acteurs ont capté une partie importante des ressources privées et publiques supplémentaires disponibles et se sont imposés comme les pièces maîtresses de ce nouvel échiquier, aux dépens des institutions traditionnelles qui ont graduellement perdu leur prépondérance et ont vu leur leadership s’affaiblir. Les choix et politiques de santé ont peu à peu échappé à la seule autorité des institutions qui en avaient jusqu’alors le mandat et en assumaient la charge. Certains pans entiers de la santé sont désormais dominés par des financeurs privés, devenus de facto prescripteurs d’orientations de santé publique. Cette nouvelle donne pose des questions essentielles de gouvernance et de responsabilité. Qui décide des orientations ? Comment les décisions sont-elles prises ? Les pays destinataires de l’aide doivent encore trop souvent subir le manque de coordination des donateurs et l’absence d’alignement des agendas. Dans ce contexte, et en prenant acte de cette nouvelle réalité, quelques pistes mériteraient d’être explorées afin de garantir que les orientations en matière de santé globale reflètent au mieux la réalité des besoins et les aspirations des pays.

  4. Karl Polanyi, la Nouvelle sociologie économique et les forces du marché

    Directory of Open Access Journals (Sweden)

    Ronan Le Velly

    2008-12-01

    Full Text Available Cet article montre en quoi plusieurs auteurs de la Nouvelle sociologie économique tendent à adopter un regard incomplet sur les forces du marché. Pour cela, l’auteur distingue deux notions d’encastrement renvoyant pour la première à un cadre méthodologique institutionnaliste et pour la seconde à l’observation du poids variable des forces du marché. Il établit qu’autant des sociologues classiques comme Weber ou Polanyi ont su coupler ces deux approches, autant plusieurs travaux majeurs de la Nouvelle sociologie économique, notamment ceux de Zelizer, de Fligstein et de Biggart, adoptent la première perspective mais ne traitent que de façon partielle de la seconde. L’auteur met particulièrement en cause les objets de recherche retenus par ces derniers auteurs, dès lors que sont systématiquement privilégiées des situations où les forces du marché sont tenues à l’écart.This article shows how many authors of the New Economic Sociology tend to adopt an incomplete view of market forces. The author distinguishes two notions of embeddedness, one related to the institutionalist theories and the second to the observation of the variable weight of market forces. It is established that classical sociologists such as Weber or Polanyi have joined these two approaches, while manyu works of the New sociological economy, for examle those of Zelizer, Fligstein or Biggart adopt the first perspective, but only treat the second partially. The author particularly questions the research objects chosen by these authors, since he considers that they generally refer to situations where market forces are held at bay.

  5. Isang Reaksyon sa “Ang Demokratikong Sistema at ang mga Modelo ng Pamumuno sa Pilipinas”

    OpenAIRE

    Paolo A. Bolanos

    2010-01-01

    Kinukundisyon ng nalalapit na eleksyon sa Mayo ang ating kolektibongpag-iisip bilang mamamayan ng Pilipinas. Bahagyang hinuhubog nitoang ating kilos at salita na syang kumakatawan sa ating pag-asa at mgapangarap para sa ating sarili at para sa ating bansa. Dahil nakatuon ang atensyon natin sa nalalapit na eleksyon at dahil hindi maiwasang pag-usapan ang mga pambansang isyu na kadalasa’y mga pambansang suliranin (tulad ng kurapsyon at kahirapan), nagkakaroon tayo ng natatangi at mas malawak na...

  6. Ocenenie spolocnosti Zabka Polska, SA

    OpenAIRE

    Dratva, Martin

    2011-01-01

    The aim of this thesis is business valuation of Zabka Polska, SA. This company operates retail convenience stores in Poland. The goal of this thesis is to estimate fair market value of the Company as of December 31st 2010. DCF Equity valuation method has been used as the main valuation method. Comparable traded companies and comparable historic transaction analyses methods have been used as complementary valuation methods. Master thesis has similar structure as legal valuation report and is d...

  7. Elevage de la Crevette Bleue en Nouvelle-Calédonie. Litopenaeus Stylirostris. Bases biologiques et zootechnie

    OpenAIRE

    Della Patrona, Luc; Brun, Pierre

    2009-01-01

    L’ouvrage « Elevage de la Crevette Bleue en Nouvelle-Calédonie – Bases biologiques et zootechnie » est sans aucun doute le document de référence dont la crevetticulture de Nouvelle-Calédonie avait besoin. L’élaboration de cette synthèse des connaissances a été initiée lors du déroulement du projet de recherche Ifremer DESANS (DEfi SANté Stylirostris) construit sur la période 2003-2006 et a été finalisée sous le projet DEDUCTION (DEveloppement DUrable de la Crevetticulture, Traitement de l’Inf...

  8. Nouvelle structure de capteur à courants de Foucault et algorithme associé pour la mesure des propriétés électrique et magnétique d'un métal

    Science.gov (United States)

    Lê, Minh-Quang; Placko, Dominique

    1995-06-01

    This paper describes a new structure for eddy-current transducers which improves sensitivity while maintaining high lateral resolution. We have developed an analytical model to allow a model-based inversion from transducers signals to estimate thick and homogeneous plates electrical conductivity, magnetic permeability and/or lift-off. The inversion procedure is described and shows the possibility of a precise simultaneous estimation of the three parameters. Experiments were conducted with magnetic and non magnetic metals. Cet article décrit une nouvelle structure de capteur à courants de Foucault qui permet d'améliorer la sensibilité du capteur tout en conservant sa résolution latérale. Nous avons développé un modèle analytique de ce capteur qui peut être inversé pour estimer la conductivité électrique, la perméabilité magnétique d'une cible homogène et/ou la distance capteur-cible. La procédure d'inversion a été décrite et montre une possibilité d'estimer ces trois paramètres avec précision. L'expérience a été effectuée sur des métaux magnétiques et amagnétiques.

  9. Lingon sa Iskolarsyip sa Dulaan (1948-2007 Looking Back on Theater Scholarship (1948-2007

    Directory of Open Access Journals (Sweden)

    Apolonio B. Chua

    2012-12-01

    Full Text Available From 1948 to 2007, the academic community produced about a hundred titles of theses and dissertations on drama and theater, or made use of data from drama and theater for larger spheres of studies. The current article looked into identifying trends and points of emphasis, as the researches and studies progressed through roughly half a century of research production in the academic setting. Inductive in approach and tentative and exploratory in its analysis, the study identified four trends and points of emphasis in research production. In the fifties and sixties, the emphasis was more on studying the play text or drama; studies veered towards a literary reading and orientation. Eventually, this trend gave way to studying the larger phenomenon of mounting, and the mise en scéne and the spectator became additional units of concern for research. Studies began to have sections on props, costumes, and staging techniques. In the eighties, a larger concern for looking at theater as social production followed. Participant observation, field work and ethnography gave equal emphasis on the social context of theater. Marxism and other perspectives from the social sciences framed theater studies then; correlations between theater and society became useful. Towards the last decade of the century, theater studies aimed at a more conceptual approach, emphasizing core concepts like panata and other related or equivalent terms, elevating and defining the study of theater as a study of culture itself. Gamit ang mahigit sa sandaang tesis at disertasyon hinggil sa dula at dulaan o sinasangkot ang mga ito na lumabas sa akademya mula 1948 hanggang 2007, kapwa sa Unibersidad ng Pilipinas at sa iba pa, nilayon ng “Lingon sa Iskolarsyip sa Dulaan (1948-2007” na pulsuhan ang pangkalahatang daloy, tutok, tunguhin o kalakaran sa pagdadala ng mga pag-aaral. Panimula at exploratory sa inductive nitong lapat, nakatukoy ang pag-aaral ng apat na sapit o tutok sa daloy ng

  10. features using RBF-SA

    Directory of Open Access Journals (Sweden)

    Rafael do Espírito Santo

    2006-01-01

    Full Text Available We present in this work a new type of classes discriminator based upon nonlinear and combinational optimization techniques: radial basis functions-simulated annealing (RBF-SA. The combinational optimization method is used here as a preestimation of some parameters of the network classifier. We compare the classifier performance with and without pre-estimation. For training the classifiers, adopting the leave-one-out procedure, we have used case examples such as mammographic masses (malignant and benign. The classifier is trained with shape factors and edge-sharpness measures extracted from 57 regions of interest (ROI (37 malignant and 20 benign, manually delineated, that describe mammographic masses and tumor features in terms of polygonal models for shape factors (compactness [CC], Fourier description [FF], fractional concavity [FCC] and speculated index [SI] and edge sharpness-acutance (A . The classifier performance is compared in terms of the area under the receive operating characteristic (ROC curve – (A. Higher values of A correspond to a better performance of classifier. Experiments with mammographic tumor and masses show that the best result of 0.9776 is obtained with RBF-SA when RBF parameters such as centers and spread matrix are pre-estimated, which is significantly better than the results obtained with no pre-estimation or only pre-estimation of the RBF centers, which are, 0.7071 and 0.9552 respectively.

  11. Chacun sa carte? Le nouveau Google Maps

    Directory of Open Access Journals (Sweden)

    Thierry Joliveau

    2013-08-01

    Full Text Available Google prépare une nouvelle version de Google Maps qu’il est possible de tester en avant-première. L’interface utilisateur est réaménagée pour une plus grande fluidité et une meilleure interactivité entre la carte et les photographies, avec une intégration optimisée des recherches d’itinéraires à la consultation. Mais la principale innovation mise en avant par la firme est plus radicale. Dans cette nouvelle version, la carte va s’adapter à l’utilisateur: «plus vous utilisez la carte plus elle devient utile», annonce Google. Le principe est simple. En fonction de vos recherches, des endroits que vous visitez, des lieux conseillés par vos amis sur les réseaux et des remarques que vous ajoutez, Google Maps apprendra à mieux cerner vos intérêts et vous proposera un contenu plus adapté. La carte est personnalisée et intègre les habitudes et les besoins de l’utilisateur.

  12. Isang Reaksyon sa “Ang Demokratikong Sistema at ang mga Modelo ng Pamumuno sa Pilipinas”

    Directory of Open Access Journals (Sweden)

    Paolo A. Bolanos

    2010-06-01

    Full Text Available Kinukundisyon ng nalalapit na eleksyon sa Mayo ang ating kolektibongpag-iisip bilang mamamayan ng Pilipinas. Bahagyang hinuhubog nitoang ating kilos at salita na syang kumakatawan sa ating pag-asa at mgapangarap para sa ating sarili at para sa ating bansa. Dahil nakatuon ang atensyon natin sa nalalapit na eleksyon at dahil hindi maiwasang pag-usapan ang mga pambansang isyu na kadalasa’y mga pambansang suliranin (tulad ng kurapsyon at kahirapan, nagkakaroon tayo ng natatangi at mas malawak na pag-mumuni-muni sa ating sosyoholikal at politikal na sitwasyon, na tila namang nambubuyo sa ating pakiramdam ng kabiguan. Talaga naman na ang panahon ng eleksyon ay parehong panahon ng pag-asa at kabiguan—kadalasa’y ang pangalawa ang nananatiling realidad ng mga Pilipino!

  13. Contraintes et enjeux de développement de la Nouvelle-Calédonie

    Directory of Open Access Journals (Sweden)

    Christian Jost

    2010-02-01

    Full Text Available En 2008 a été lancée en Nouvelle-Calédonie une vaste consultation pour élaborer un Schéma d’Aménagement et de Développement du territoire à l’horizon 2025. Si l’économie calédonienne a connu une forte croissance pendant plus d’une décennie, pouvant soutenir les besoins de la population et les investissements, le grand défi d’aujourd’hui réside dans la capacité à construire une communauté de destin basée sur une reconnaissance d’aspirations multiculturelles et sur un projet commun. Lancé dix ans après l’Accord de Nouméa qui le prévoyait, le S.A.D. est cette chance qu’ont les Néo-Calédoniens d’écrire enfin leur avenir ensemble. La réflexion stratégique globale et la mise en place d’une politique générale restent toutefois encore à mettre en place.In 2008 a vast consultation was launched in New Caledonia aimed at establishing a development plan for the territory, directed at the year 2025. If the Caledonian economy has experienced high growth over the past decade, thereby satisfying population and investment needs, the current challenge resides in the capacity to build the society of the future based on the recognition of multi-cultural aspirations and a shared project. Envisaged by the Accord de Nouméa and launched ten years later, the SAD offers all New Caledonians the opportunity to plan the future together. The over-arching strategic reflection and the creation of the broad politic foundations for the project have yet, however, to be determined.

  14. Nouvelle perception de l’espace dans les marais littoraux: le Marais Vernier

    Directory of Open Access Journals (Sweden)

    Lydie GOELDNER

    1993-03-01

    Full Text Available Le Marais Vernier est un marais estuarien symbolique: sa conquête séculaire demeure actuelle et induit des conflits d’ordre économique et écologique entre usagers de l’espace. Son histoire retrace celle de l’ensemble des marais littoraux et démontre que la perception de l’espace a plus qu’évolué dans les zones humides.

  15. How the Nouvelle Vague Invented the DVD: Cinephilia, new waves and film culture in the age of digital dissemination

    OpenAIRE

    Malte Hagener

    2014-01-01

    Whereas the currently emerging configurations of audiovisualcy in the age of digital networks are often addressed in terms of absolute novelty and innovation, this article wishes to shift the focus slightly, articulating instead the new in terms of the old. This essay proposes the argument that it was within the Nouvelle Vague and the French film culture of the 1960s that the DVD was “invented”. Obviously, this is a contrafactual argument, but if we understand the DVD as a discursive construc...

  16. The preliminary study of autophagy induction of SA and MeSA by confocal

    Science.gov (United States)

    Yun, Lijuan; Chen, Wenli

    2010-02-01

    Autophagy appears to be a highly conserved process from unicellular to multicellular eukaryotes which contributes to the equilibrium of intracelluar environment. While it would be harmful to the cells when it is excessive by inducing programmed cell death (PCD). It is a protein degradation process in which cells recycle cytoplasmic contents when subjected to environmental stress conditions or during certain stages of development. Previous studies have demonstrated autophagy can be induced during abiotic or biotic stresses. salicylic acid (SA) and methyl salicytic (MeSA) are endogenous signal molecules. We found SA and MeSA can induce autophagy in Arabidopsis thaliana respectively. While autophagy was not induced by SA or MeSA in tobacco suspension cells under the same concentration and period. The differences in stuctures or physiological states may contribute to the results.

  17. LambdaSa1 and LambdaSa2 Prophage Lysins of Streptococcus agalactiae▿

    OpenAIRE

    Pritchard, David G.; Dong, Shengli; Kirk, Marion C.; Cartee, Robert T.; Baker, John R.

    2007-01-01

    Putative N-acetylmuramyl-l-alanine amidase genes from LambdaSa1 and LambdaSa2 prophages of Streptococcus agalactiae were cloned and expressed in Escherichia coli. The purified enzymes lysed the cell walls of Streptococcus agalactiae, Streptococcus pneumoniae, and Staphylococcus aureus. The peptidoglycan digestion products in the cell wall lysates were not consistent with amidase activity. Instead, the structure of the muropeptide digestion fragments indicated that both the LambdaSa1 and Lambd...

  18. How the Nouvelle Vague Invented the DVD: Cinephilia, new waves and film culture in the age of digital dissemination

    Directory of Open Access Journals (Sweden)

    Malte Hagener

    2014-01-01

    Full Text Available Whereas the currently emerging configurations of audiovisualcy in the age of digital networks are often addressed in terms of absolute novelty and innovation, this article wishes to shift the focus slightly, articulating instead the new in terms of the old. This essay proposes the argument that it was within the Nouvelle Vague and the French film culture of the 1960s that the DVD was “invented”. Obviously, this is a contrafactual argument, but if we understand the DVD as a discursive construction articulating a specific perspective on film, then the DVD simulates and emulates some key features of 1960s cinephilia that emerged within the context of the new waves. On the other hand, the Nouvelle Vague is understood as a broad discursive movement encompassing all segments of the institution cinema rather than five auteur-directors — Truffaut, Godard, Chabrol, Rohmer and Rivette — and their respective films. By arguing for the continuing importance of film history and culture, this article wishes to underline the fact that technological as well as aesthetic transformations are central to our understanding of media culture.

  19. SA3654 Component characterization. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Meir, G.W.

    1996-06-01

    AlliedSignal Inc., Federal Manufacturing & Technologies (FM&T), was provided with production capability assurance program (PCAP) funding to develop, characterize, and qualify purchased product components for use on the PRESS-A program. The SA3654, N-Channel, Power MOSFET was identified as a component needing such activity to support PRESS-A. This report presents the characterization activities and results for the SA3654.

  20. Åsa portreed / Åsa Johannesson ; intervjueerinud Kaisa Eiche

    Index Scriptorium Estoniae

    Johannesson, Åsa

    2009-01-01

    Rootsi fotograafist Åsa Johannessonist, kelle portreefotode seeriat "Portraits of Her" eksponeeriti Riias toimunud kunstiüritusel "MOMENT". Tema õpingutest ja elust Londonis. Naiselikkusest ja mehelikkusest

  1. Elaboration de nouvelles approches micromecaniques pour l'optimisation des performances mecaniques des materiaux heterogenes

    Science.gov (United States)

    Aboutajeddine, Ahmed

    Les modeles micromecaniques de transition d'echelles qui permettent de determiner les proprietes effectives des materiaux heterogenes a partir de la microstructure sont consideres dans ce travail. L'objectif est la prise en compte de la presence d'une interphase entre la matrice et le renforcement dans les modeles micromecaniques classiques, de meme que la reconsideration des approximations de base de ces modeles, afin de traiter les materiaux multiphasiques. Un nouveau modele micromecanique est alors propose pour tenir compte de la presence d'une interphase elastique mince lors de la determination des proprietes effectives. Ce modele a ete construit grace a l'apport de l'equation integrale, des operateurs interfaciaux de Hill et de la methode de Mori-Tanaka. Les expressions obtenues pour les modules globaux et les champs dans l'enrobage sont de nature analytique. L'approximation de base de ce modele est amelioree par la suite dans un nouveau modele qui s'interesse aux inclusions enrobees avec un enrobage mince ou epais. La resolution utilisee s'appuie sur une double homogeneisation realisee au niveau de l'inclusion enrobee et du materiau. Cette nouvelle demarche, permettra d'apprehender completement les implications des approximations de la modelisation. Les resultats obtenus sont exploites par la suite dans la solution de l'assemblage de Hashin. Ainsi, plusieurs modeles micromecaniques classiques d'origines differentes se voient unifier et rattacher, dans ce travail, a la representation geometrique de Hashin. En plus de pouvoir apprecier completement la pertinence de l'approximation de chaque modele dans cette vision unique, l'extension correcte de ces modeles aux materiaux multiphasiques est rendue possible. Plusieurs modeles analytiques et explicites sont alors proposee suivant des solutions de differents ordres de l'assemblage de Hashin. L'un des modeles explicite apparait comme une correction directe du modele de Mori-Tanaka, dans les cas ou celui ci echoue a

  2. Les Sapotaceae de Madagascar, deux nouvelles espèces du genre Mimusops L.

    Directory of Open Access Journals (Sweden)

    Richard Randrianaivo

    2013-11-01

    Full Text Available Members of the family Sapotaceae, occurring in Madagascar’s various forest types, are mostly known as nanto in local dialects; some of their cultural and social values are described here. While the circumscription of Mimusops is well-defined, the delimitation of species within the genus remains unclear and their identification is often difficult. A study of herbarium specimens assigned to this genus deposited in key herbaria, two in Madagascar (TAN and TEF and three outside the country (G, MO and P, revealed two new species: Mimusops boeniensis Randrianaivo sp. nov. and Mimusops masoalensis Randrianaivo sp. nov. This brings the number of Mimusops species recognized in Madagascar to 16. Both of these newly recognized species are illustrated, and detailed information is provided concerning their morphology and the differences between them and other members in the genus, as well as on their ecology and distribution. RÉSUMÉLes Sapotaceae de Madagascar sont rencontrés dans tous les types de forêt de l’île et sont connus sous un même nom vernaculaire sur l’ensemble du territoire, nanto. Les nanto sont importants dans la Société malgache et leur valeur culturelle est décrite ici. La circonscription taxinomique de Mimusops est bien définie. En revanche, la délimitation entre les différentes espèces au sein du genre reste confuse et l’identification des récoltes est souvent difficile. L’étude des spécimens d’herbier connus dans les herbiers nationaux (TAN et TEF et internationaux (G, MO et P nous a néanmoins permis de reconnaitre et de décrire deux nouvelles espèces : Mimusops boeniensis Randrianaivo sp. nov. et Mimusops masoalensis Randrianaivo sp. nov., le nombre d’espèces malgaches de Mimusops passant ainsi de 14 à 16. Cet article s’attache ensuite à fournir une description morphologique détaillée et illustrée de ces deux espèces ainsi que des renseignements sur leur distribution et leur écologie. Les diff

  3. Pagdalumat Sa Mga Sinaunang Di- Materyal Na Kultura Ng Mga B’laan Sa Brgy. Pisan, Kabacan, Cotabato Mula Sa Kanilang Kwentong Bayan

    OpenAIRE

    Dr. Nelia O. Du

    2014-01-01

    Nilayon ng pag-aaral na lumikom ng kwentong bayan ng mga B’laan sa Brgy. Pisan, Kabacan, North Cotabato at dalumatin ang kanilang di-materyal na kulturang masasalamin dito.Sa pagbibigay katuparan sa layunin, nasagot ang mga sumusunod na katanungan: (1) Ano ang mga kwentong bayan ng mga B’laan sa Pisan, Kabacan, Cotabato? (2) Anong mga di-materyal na kultura ang maaaring pagkakakilanlan ng mga B’laan ang masasalamin sa kanilang mga kwentong bayan? Paano ipinakita ang mga ito sa ...

  4. Entre Classicisme et Modernité : La Nouvelle Revue Française dans le champ littéraire de la Belle Epoque

    NARCIS (Netherlands)

    Koffeman-Bijman, M.N.

    2003-01-01

    The literary review La Nouvelle Revue Française enjoys an enormous prestige in France. In Entre Classicisme et Modernité, Maaike Koffeman explores the origins of this legend of French literary life by means of a historical, literary and sociological analysis of the first years of the review s existe

  5. Application de la diffraction des rayons X in situ à haute température pour l'identification d'une nouvelle phase lors de l'oxydation à 900circC de l'acier 304

    Science.gov (United States)

    Riffard, F.; Buscail, H.; Caudron, E.; Cueff, R.; Issartel, C.; El Messki, S.; Perrier, S.

    2004-11-01

    Une nouvelle interprétation du comportement atypique couramment appelé "breakaway" observé lors de l'oxydation à haute température d'alliages chromino-formeurs est proposée grâce à l'utilisation de la diffraction des rayons X in situ à haute température. L'acier chromino-formeur AISI 304 doit établir une couche d'oxyde superficielle généralement dense et majoritairement, constituée de chromine, dont la vitesse de croissance est lente, afin d'assurer sa protection contre la corrosion à haute température. Cette faible vitesse de croissance de la couche d'oxyde est effectivement observée à 1000circC. Elle serait favorisée par l'établissement d'une couche de chromine induite par la présence d'une sous-couche continue de silice à l'interface interne. Cette dernière limiterait la diffusion du fer. Le phénomène du "breakaway" est observé à la température de 900circC après 40 heures d'oxydation. Ce phénomène serait lié à la croissance initiale d'oxydes contenant du fer. L'oxyde Fe{7}SiO{10, }a été identifié{ }pour la première fois grâce à la technique de diffraction des rayons X in situ à haute température. Cet oxyde semble piéger le silicium dans la couche d'oxyde, empêchant son accumulation à l'interface interne et la formation d'une couche continue de silice.

  6. Justice française en Nouvelle-Calédonie  la fin du rêve tropical French judicial practice in Nouvelle-Calédonie: the end of a tropical dream

    Directory of Open Access Journals (Sweden)

    Pierre Frezet

    2009-04-01

    Full Text Available Territoire d’outre-mer. - Nouvelle-Calédonie. - Article 77 de la Constitution de 1958. - Loi organique n°99-209 du 19 mars 1999. - Statut coutumier kanak. – Portée de l’article 7 de la loi précitée. - Composition du tribunal pour enfants saisi en matière d’assistance éducative en présence de parties de statut coutumier Kanak.SOMMAIRE. – Conformément à l’article 7 de la loi organique n°99-209 du 19 mars 1999 les personnes de statut coutumier kanak étant régies, pour l’ensemble du droit civil, ...

  7. Pagdalumat Sa Mga Sinaunang Di- Materyal Na Kultura Ng Mga B’laan Sa Brgy. Pisan, Kabacan, Cotabato Mula Sa Kanilang Kwentong Bayan

    Directory of Open Access Journals (Sweden)

    Dr. Nelia O. Du

    2014-12-01

    Full Text Available Nilayon ng pag-aaral na lumikom ng kwentong bayan ng mga B’laan sa Brgy. Pisan, Kabacan, North Cotabato at dalumatin ang kanilang di-materyal na kulturang masasalamin dito.Sa pagbibigay katuparan sa layunin, nasagot ang mga sumusunod na katanungan: (1 Ano ang mga kwentong bayan ng mga B’laan sa Pisan, Kabacan, Cotabato? (2 Anong mga di-materyal na kultura ang maaaring pagkakakilanlan ng mga B’laan ang masasalamin sa kanilang mga kwentong bayan? Paano ipinakita ang mga ito sa kanilang mga kwentong bayan? Saklaw ng pag-aaral na ito ang mga kwentong bayan na inuri ayon sa alamat, mito, salaysayin at pabula na kasasalaminan ng di-materyal na kultura ng mga B’laan na nakatira sa Brgy. Pisan, Kabacan, Cotabato. Kwantitatibo at Kwalitatibong disenyo ng pananaliksik ang ginamit sa pag-aaral at sinuri ang mga datos sa pamamagitan ng deskriptibong pamaraan partikular ang kontent analisis. Pamaraang indihenus o pangkatutubo ang pamaraang ginamit. Natuklasan na (1 May iba’t ibang kwentong bayan sa genre na alamat na etiolohikal, mito, salaysayin, at pabula ang mga Blaan; (2 Iba’t ibang di-materyal na kultura ang masasalamin sa mga kwentong bayan ng B’laan. Ito ang nabuong konklusyon: (1 Ang mga kwentong bayan ng B’laan ay kasasalaminan ng kanilang di-materyal na kultura.

  8. IFP Energies nouvelles - 2013 Activity Report. 2013 financial report. Innovating for energy

    International Nuclear Information System (INIS)

    IFP Energies nouvelles (IFPEN) is a public research and training player. It has an international scope, covering the fields of energy, transport and the environment. From research to industry, technological innovation is central to all its activities. As part of the public-interest mission with which it has been tasked by the public authorities, IFPEN focuses on: - providing solutions to take up the challenges facing society in terms of energy and the climate, promoting the emergence of a sustainable energy mix; - creating wealth and jobs by supporting French and European economic activity, and the competitiveness of related industrial sectors. IFPEN has proven expertise across the entire value chain, from fundamental research to industrial research and innovation. It is funded both by a state budget and by resources provided by French and foreign international partners. The aim of IFPEN's R and D programs is to overcome existing scientific and technological barriers in order to develop innovations that can be used by industry. Through its research and resulting innovations, IFPEN fosters the economic development of fields related to the energy, transport and eco-industry sectors. In so doing, it also contributes to creating wealth and jobs. IFPEN's innovations are developed industrially through close partnerships with industrial players and IFP Group subsidiaries. In both emerging and mature markets, IFPEN creates companies or acquires stakeholdings in companies of significant potential, either directly or via capital funds. In addition, IFPEN supports the development of SMEs and SMIs as part of collaboration agreements, contributing its technical and legal expertise. Representing over 50 professions, from geological engineers to power-train engineers, IFPEN's employees form a unique body of globally recognized scientific specialists and an unparalleled network of expertise. In order to carry out their research work at the cutting edge of innovation, they have

  9. Caractérisation des nouvelles technologies de batteries lithium-ion

    OpenAIRE

    VAISMAN PINTO, Henrique

    2015-01-01

    La gestion de l'énergie embarquée est un enjeu crucial pour les voitures possédant une batterie électrochimique. La caractérisation et la modélisation des éléments de batteries sont indispensables pour disposer de modèles complets et fiables de simulations de véhicules hybrides ou électriques. Un paramètre très important pour la batterie est sa résistance interne, car il est lié directement aux pertes d'énergie interne. Une amélioration de la méthode de calcul de la résistance interne est pro...

  10. Socialisation active et nouvelles perspectives en psychologie de l’orientation

    OpenAIRE

    Beaumatin, Ania; Baubion-Broye, Alain; Hajjar, Violette

    2013-01-01

    L’article a été élaboré à partir de la publication « Construire sa vie : un paradigme pour l’orientation au 21e siècle ». Il en examine les principaux concepts et les perspectives théoriques et méthodologiques qu’elle définit. Il veut contribuer au débat actuel sur les modèles et les pratiques de l’orientation scolaire, professionnelle, tout au long de la vie. Les auteurs présentent quelques éléments de leur modèle d’analyse qui estime que les situations d’orientation constituent pour la pers...

  11. Literaire strategieën: de drie satellieten van La Nouvelle Revue Française (1910-1914

    Directory of Open Access Journals (Sweden)

    Maaike Koffeman

    2000-12-01

    Full Text Available La Nouvelle Revue Française, opgericht in 1908 door een groep schrijvers rond André Gide, is het belangrijkste Franse literaire maandblad van het interbellum geweest. In de jaren voorafgaand aan de Eerste Wereldoorlog is de reputatie van het tijdschrift nog relatief bescheiden, maar er is al wel een duidelijke progressie te constateren. Deze is niet alleen toe te schrijven aan de inhoudelijke kwaliteit van de bijdragen, maar vooral ook aan de manier waaorp de redactie het tijdschrift promoot. De oprichters bedienen zich van een 'mutimedia-strategie': zij ontwikkelen rond de NRF verschillende nevenactiviteiten om de naamsbekendheid van het tijdschrift te vergroten en zijn literatuuropvattingen onder een breder publiek te verspreiden. 

  12. Test des photomultiplicateurs en silicium couplés à un scintillateur plastique pour la nouvelle Tape Station

    CERN Document Server

    sekal, Smain

    2014-01-01

    L’une des parties essentielles de la l’installation ISOLDE est la tape Station (contrôleur de bandes), qui permet la vérification de la qualité du faisceau délivré aux expériences. On prévoit à ISOLDE de remplacer l’ancienne Tape Station, par une nouvelle Tape station; et l’un des paramètres essentiels pour la performance de la tape Station est l’efficacité de détection. Le but de ce travail est de vérifier l’efficacité des détecteurs de particules bêta, composés par l’association des photomultiplicateurs en Silicium à un scintillateur plastique pour differentes distances.

  13. Pêcheurs kanak et politiques de développement de la pêche en Nouvelle-Calédonie

    OpenAIRE

    Leblic, I.

    1999-01-01

    Si, en Nouvelle-Calédonie, beaucoup de recherches ont été réalisées sur l'agriculture, rares sont celles qui concernent la pêche. Aucune étude ethnologique sur les sociétés de pêcheurs kanak n'existait en 1982 lorsque j'ai commencé mes recherches sur les clans pêcheurs de l'île des Pins. Les seules références bibliographiques, que j'ai pu trouver à l'époque, traitaient de biologie marine, d'océnographie, sans oublier quelques nomenclatures de poissons et coquillages réalisées par des linguist...

  14. Nouvelle image de la mère dans La Mayonnaise de l’écrivaine Jeon Hye-sung

    OpenAIRE

    WANG-LE, Min Sook

    2014-01-01

    Les écrivaines coréennes participent aujourd’hui à la transformation du monde littéraire et contribuent à travers leur écriture au changement de leur statut et de celui des autres femmes. Elles mettent en avant la complexité de l’image de la mère dans une nouvelle perspective. Tantôt rejetée, tantôt valorisée, la maternité devient chez certaines d’entre elles une matière privilégiée dans leur quête d’identité féminine. Cette étude privilégie le cas de l’écrivaine Jeon Hey-sung (1960-), auteur...

  15. Os desafios para a saúde

    Directory of Open Access Journals (Sweden)

    José R. Carvalheiro

    1999-04-01

    Full Text Available O TRABALHO DÁ ênfase à natureza econômica da saúde num momento em que o setor terciário da economia é o que mais cresce e a área da saúde é de todas a mais dinâmica. Aborda a crise da saúde pública considerando seus problemas, métodos e serviços. Adota o conceito de comunidade epistêmica para a análise da situação atual. Identifica duas correntes, com paradigmas conceituais distintos - o da Saúde Pública e o da Economia da Saúde. As principais agências de formulação desses paradigmas são, respectivamente, a Organização Mundial da Saúde e o Banco Mundial. No plano nacional, lembra que a Constituição de 1988 previu um Sistema Único de Saúde (SUS universal, com integralidade das ações, descentralizado e participativo, com controle social. O SUS vem sendo implementado através de Normas Operacionais e dos mecanismo de compensação representados pelas Comissões Intergestores. Questão ainda não totalmente resolvida é a do financiamento do SUS.THIS PAPER emphasizes the economic nature of health care at a time when the tertiary sector is the one fastest growing in economy and health care is the most dynamic. It touches upon the public health crisis considering health problems, methods and services. The epistemic community concept is used to analyse the current situation. Two trends are identified, exhibiting distinct conceptual paradigms: one in Public Health, the other in Health Economics. The main agencies for the formulation of those paradigms are, respectively, the World Health Organization and the World Bank. On the national level, the 1988 Constitution provided a universal Unified Health System (SUS - Sistema Unificado de Saúde, complete in its activities, decentralized and fully engaged, under social control. The SUS has been established according to the Operational Rules and the compensation mechanisms represented by its Intermanaging Committees. An issue not yet fully settled is the SUS finacing.

  16. A saúde do adolescente homossexual

    OpenAIRE

    Valente, Tânia Raquel Telmo

    2015-01-01

    Contexto: A homossexualidade, em particular durante a adolescência, é um tema ainda difícil de abordar em Portugal, por estigmas e preconceitos que vigoram na sociedade. Assim, existe uma forte carência de informação rigorosa e fidedigna sobre a homossexualidade entre profissionais de saúde, educadores, pais e mesmo entre os adolescentes. Essa lacuna de informação pode ter consequências graves na saúde destes jovens. Neste sentido, surge a necessidade de definir conceitos relacionados com a s...

  17. L.J. van der Veen et S. Bodinga-bwa-Bodinga. Gedandedi sa Geviya/ Dictionnaire Geviya?Fran?ais

    Directory of Open Access Journals (Sweden)

    P.A. Mavoungou

    2011-10-01

    Full Text Available La parution aux ?ditions Peeters de l'ouvrage de r?f?rence lexicographique intitul? Gedandedi sa Geviya/Dictionnaire Geviya?Fran?ais (en abr?g? DGF dans les reste de l'article a ?t? accueilli avec joie et fiert? aussi bien par les locuteurs geviya1 en particulier que par les Gabonais en g?n?ral. Ce dictionnaire, r?sultat d'une longue et fructueuse collaboration scientifique entre Lolke van der Veen et S?bastien Bodinga-bwa-Bodinga, marque le d?but d'une nouvelle ?re dans la r?daction des dictionnaires au Gabon. En effet, la majorit? des ouvrages de r?f?rence lexicographique disponibles dans les langues gabonaises sont des dictionnaires bilingues r?dig?s par les missionnaires catholiques et protestants ou par les administrateurs coloniaux dans la p?riode allant de 1800 ? 1960, date de l'accession du Gabon ? la souverainet? internationale (Nyangone Assam et Mavoungou 2000, Mavoungou 2001.

  18. Psicologia da saúde no ISPA

    OpenAIRE

    Teixeira, José A. Carvalho

    1992-01-01

    Na presente nota didáctica, após algumas considerações gerais, procura-se fazer o ponto da situação actual da Psicologia da Saúde no ISPA, e destacar aigumas perspectivas futuras de desenvolvimento.

  19. Le CERN accueille une conférence sur la communication scientifique

    CERN Multimedia

    CERN Press Office. Geneva

    2001-01-01

    More than 70 communication professionals will try to answer these questions at the conference "Bridging the gap between theory and practise" which takes place at CERN on 1-3 February 2001. This conference is promoted and organised by the Public Communication of Science and Technology network (PCST), an international organisation of individuals interested in all aspects of the relationship between science and the public.

  20. Commerce électronique et nouvelles configurations de marché: une approche théorique des stratégies d'intermédiation

    OpenAIRE

    Curchod, Corentin

    2003-01-01

    La thèse analyse un type de stratégie particulier, les stratégies d'intermédiation, définies comme toute orientation délibérée de l'activité d'une firme ou d'une part de son activité vers la gestion des relations entre deux groupes ou plus d'acteurs dans une chaîne d'offre. Elle pose la question: comment une nouvelle stratégie d'intermédiation peut-elle contribuer, face à des menaces ou des opportunités nouvelles, à créer, accroître ou maintenir le niveau de rente de la firme sur ses clients,...

  1. Caractérisation et propriétés des "matériaux culturels"... vers une nouvelle discipline en Science des Matériaux

    OpenAIRE

    Robbiola, Luc

    1999-01-01

    This work mainly aims to introduce a new discipline in materials science: the cultural materials science, which is depicted through the example of the bronze alteration. Methodological aspects as well as presentation of research investigation performed both on ancient and modern copper-tin alloys are summarised. Illustrative examples are given. Ce rapport porte principalement sur la mise en place d'une nouvelle discipline en science des matériaux : la science des matériaux culturels. Celle...

  2. Question 9. Compte tenu de toutes ces informations, peut-on établir un tableau des risques encourus par la Nouvelle-Calédonie ?

    OpenAIRE

    Coléno, Alain

    2014-01-01

    RésuméTrois grand type de risques peuvent être identifiés :– risque d’introduction d’espèces allochtones absentes de Nouvelle-Calédonie ;– risque d’implantation et de développement d’espèces allochtones introduites fortuitement ;– risque d’envahissement d’espèces déjà installées fortuitement ou volontairement.

  3. Notes sur les limaces 2. Description d’une espèce nouvelle de Gigantomilax provenant des environs de Kouldja (Chine)

    NARCIS (Netherlands)

    Regteren Altena, van C.O.

    1954-01-01

    Parmi les limaces non-identifiées du Musée Zoologique d’Amsterdam, que M. le Professeur Dr. H. Engel et Mme. W. S. S. van der Feen née van Benthem Jutting ont bien voulu me permettre d’étudier, il se trouvait une espèce nouvelle dont je donne ci-après la description. Gigantomilax (Turcomilax) iliens

  4. DAYA SAING KAKAO INDONESIA DI PASAR INTERNASIONAL

    Directory of Open Access Journals (Sweden)

    Anggita Tresliyana

    2015-07-01

    Full Text Available Cocoa is one of the major Indonesian agricultural export products. Cocoa international market has great potential regarding world’s consumption growth, therefore Indonesia is expected to take advantage on existing opportunities. The aims of this study were to analyze the competitiveness of Indonesian cocoa beans and processed cocoa trade in the international market as well as the level of competition between cocoa exporting countries. By using Revealed Comparative Advantage (RCA and Spearman Rank Correlation, it showed that Indonesia had a comparative advantage as an cocoa exporter on the international market, the highest for cocoa beans and the lowest for cocoa paste; Indonesia also had a significant correlation to exporting countries in cocoa beans’ market (Ghana and cocoa paste’s market (Netherlands and Malaysia, the correlation suggests that there were high correlation between Indonesia and the exporting country in competing for market share.Keywords: cocoa, comparative advantage, international trade, competitiveness, market share, RCA ABSTRAKKakao merupakan salah satu komoditas pertanian unggulan ekspor Indonesia.  Pasar kakao memiliki potensi yang besar dilihat dari peningkatan konsumsi dunia, sehingga Indonesia diharapkan dapat memanfaatkan peluang yang ada.  Tujuan penelitian ini adalah menganalisis daya saing perdagangan biji kakao dan kakao olahan Indonesia di pasar internasional serta hubungan daya saing antar negara eksportir kakao. Dengan menggunakan Reavealed Comparative Advantage (RCA, dan Korelasi Rank Spearman, hasil analisis menunjukkan bahwa Indonesia memiliki keunggulan komparatif sebagai eksportir biji kakao dan kakao olahan di pasar internasional, tertinggi untuk biji kakao dan terendah untuk kakao pasta;  Indonesia juga memiliki korelasi yang signifikan di beberapa negara untuk pasar biji kakao (Ghana dan kakao pasta (Belanda dan Malaysia, korelasi tersebut menunjukkan bahwa terdapat hubungan daya saing yang cukup

  5. 什么是SA8000

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    20世纪末期,欧洲、美国和澳大利亚都先后出现了一些关于“企业社会责任”的多边组织,并逐步形成了一些评价体系和认证制度。SA8000(SOCIAL ACCOUT ABILTY8000的英文简称)是其中最有名的标准之

  6. La circulation des nouvelles sur l’internet. L’interconnexion médiatique au service du pluralisme ?

    Directory of Open Access Journals (Sweden)

    Emmanuel Marty

    2013-04-01

    Full Text Available L’article consiste en une étude pluri-méthodologique du paysage des actualités en ligne, dans le cadre d’un projet de recherche intitulé Internet Pluralisme et Redondance de l’Information. L’étude cherche à repérer, dans le flux de publication comme dans la circulation d’une nouvelle, les éléments de convergence et de reprise, ou au contraire de créativité et de singularisation des différents types de sites d’information (médias en ligne, infomédiaires, sites natifs de l’internet et blogs à partir de la publication le 8 mars 2011 d’articles sur un sondage donnant Marine Le Pen en tête des intentions de vote pour l’élection présidentielle de 2012. L’article répond essentiellement à deux objectifs. Le premier est d’identifier le volume de production de l’information dédié au sujet dans les différents sites en tenant compte de la circulation de la nouvelle dans sa dimension diachronique. Le second est d’identifier certains standards dans la production des différents sites, par l’étude des sources et signatures, du traitement visuel ainsi que de l’usage des liens hypertextes. Les résultats dessinent des lignes de convergence et de divergence entre les différentes catégories de sites. Là où les médias en ligne, les infomédiaires et dans une moindre mesure certains sites natifs de l’internet (les plus professionnalisés se positionnent sur des stratégies de productivité, de réactivité et de reprise normalisée de l’information, les blogs et une grande partie des sites natifs de l’internet (ceux tournés vers l’amateurisme et la participation optent pour des valeurs fondées sur la singularité, la créativité, le re-traitement de l’information et la mise en avant d’un réseau de sites « amis », au sein de plateformes techniques néanmoins contraignantes du point de vue de l’interface. The article consists in a pluri-methodological study of the online news landscape. It

  7. Pristup bolesniku sa sumnjom na akutni pankreatitis

    OpenAIRE

    Mikolašević, Ivana; Krznarić Zrnić, Irena; Štimac, Davor

    2013-01-01

    Kliničke manifestacije akutnog pankreatitisa širokog su spektra i često predstavljaju diferencijalno dijagnostički problem. U pristupu bolesniku sa sumnjom na razvoj akutnog pankreatitisa nužna je iscrpna anamneza i detaljan fizikalni pregled, što nam uz najmanje trostruko povećanje aktivnosti amilaza i dvostruko povećanje aktivnosti lipaza s velikom vjerojatnošću upućuje na razvoj akutne upale gušterače. Nužno je potom procijeniti težinu akutnog pankreatitisa, kako bismo pravo...

  8. AGREEMENT BETWEEN CERN AND UBS SA

    CERN Multimedia

    2002-01-01

    We wish to inform you that the agreement between CERN and UBS SA has been renewed for a period of five years with effect from 1st July 2002. This represents the culmination of work carried out since 1999 by a group consisting of representatives of the Finance Division, the SPL Division, the Staff Association and the Users Office. After analysis of the results of a market survey, it emerged that OVERALL the UBS offered the best conditions and guarantees for the CERN personnel. Owing to developments in the banking market, new conditions have had to be negotiated, which will be presented to you by the UBS (see article).

  9. An investigation on SA 213-Tube to SA 387-Tube plate using friction welding process

    International Nuclear Information System (INIS)

    Friction welding of tube to tube plate using an external tool (FWTPET) is a relatively newer solid state welding process used for joining tube to tube plate of either similar or dissimilar materials with enhanced mechanical and metallurgical properties. In the present study, FWTPET has been used to weld SA 213 (Grade T12) tube with SA 387 (Grade 22) tube plate. The welded samples are found to have satisfactory joint strength and the Energy dispersive X-ray analysis (EDX), X-ray diffraction (XRD) study showed that inter metallic compound is absent in the weld zone. The different weld joints have been identified and the phase composition is found using EDX and XRD. Microstructures have been analyzed using optical and Scanning electron microscopy (SEM). The mechanical properties such as hardness, compressive shear strength and peel test for different weld conditions are studied and the hardness survey revealed that there is increase in hardness at the weld interface due to grain refinement. The corrosion behavior for different weld conditions have been analyzed and the weld zone is found to have better corrosion resistance due to the influence of the grain refinement after FWTPET welding process. Hence, the present investigation is carried out to study the behavior of friction welded dissimilar joints of SA 213 tube and SA 387 tube plate joints and the results are presented. The present study confirms that a high quality tube to tube plate joint can be achieved using FWTPET process at 1120 rpm

  10. An investigation on SA 213-Tube to SA 387-Tube plate using friction welding process

    Energy Technology Data Exchange (ETDEWEB)

    Rajan, S. Pandia; Kumaraswamidhas, L. A. [Indian Institute of Technology, Jharkhand (India); Kumaran, S. Senthil [RVS School of Engineering and Technology, Tamil Nadu (India); Muthukumaran, S. [National Institute of Technology, Tamil Nadu (India)

    2016-01-15

    Friction welding of tube to tube plate using an external tool (FWTPET) is a relatively newer solid state welding process used for joining tube to tube plate of either similar or dissimilar materials with enhanced mechanical and metallurgical properties. In the present study, FWTPET has been used to weld SA 213 (Grade T12) tube with SA 387 (Grade 22) tube plate. The welded samples are found to have satisfactory joint strength and the Energy dispersive X-ray analysis (EDX), X-ray diffraction (XRD) study showed that inter metallic compound is absent in the weld zone. The different weld joints have been identified and the phase composition is found using EDX and XRD. Microstructures have been analyzed using optical and Scanning electron microscopy (SEM). The mechanical properties such as hardness, compressive shear strength and peel test for different weld conditions are studied and the hardness survey revealed that there is increase in hardness at the weld interface due to grain refinement. The corrosion behavior for different weld conditions have been analyzed and the weld zone is found to have better corrosion resistance due to the influence of the grain refinement after FWTPET welding process. Hence, the present investigation is carried out to study the behavior of friction welded dissimilar joints of SA 213 tube and SA 387 tube plate joints and the results are presented. The present study confirms that a high quality tube to tube plate joint can be achieved using FWTPET process at 1120 rpm.

  11. North America and South America (NA-SA) neuropathy project.

    Science.gov (United States)

    Pasnoor, Mamatha; Nascimento, Osvaldo J M; Trivedi, Jaya; Wolfe, Gil I; Nations, Sharon; Herbelin, Laura; de Freitas, M G; Quintanilha, Giseli; Khan, Saud; Dimachkie, Mazen; Barohn, Richard

    2013-08-01

    Peripheral neuropathy is a common neurological disorder. There may be important differences and similarities in the diagnosis of peripheral neuropathy between North America (NA) and South America (SA). Neuromuscular databases were searched for neuropathy diagnosis at two North American sites, University of Kansas Medical Center and University of Texas Southwestern Medical Center, and one South American site, Federal Fluminense University in Brazil. All patients were included into one of the six major categories: immune-mediated, diabetic, hereditary, infectious/inflammatory, systemic/metabolic/toxic (not diabetic) and cryptogenic. A comparison of the number of patients in each category was made between North America and South America databases. Total number of cases in North America was 1090 and in South America was 1034 [immune-mediated: NA 215 (19.7%), SA 191 (18%); diabetic: NA 148 (13.5%), SA 236 (23%); hereditary: NA 292 (26.7%), SA 103 (10%); infectious/inflammatory: NA 53 (4.8%), SA 141 (14%); systemic/metabolic/toxic: NA 71 (6.5%), SA 124 (12%); cryptogenic: NA 311 (28.5%), SA 239 (23%)]. Some specific neuropathy comparisons were hereditary neuropathies [Charcot-Marie-Tooth (CMT) cases] in NA 246/292 (84.2%) and SA 60/103 (58%); familial amyloid neuropathy in SA 31/103 (30%) and none in NA. Among infectious neuropathies, cases of human T-lymphotropic virus type 1 (HTLV-1) neuropathy in SA were 36/141(25%), Chagas disease in SA were 13/141(9%) and none for either in NA; cases of neuropathy due to leprosy in NA were 26/53 (49%) and in SA were 39/141(28%). South American tertiary care centers are more likely to see patients with infectious, diabetic and hereditary disorders such as familial amyloid neuropathies. North American tertiary centers are more likely to see patients with CMT. Immune neuropathies and cryptogenic neuropathies were seen equally in North America and South America.

  12. Peut-on penser le travail par le don ? Débat avec la rédaction de la Nouvelle Revue du Travail Conceptualising work as a gift? Debate with editors of the Nouvelle Revue du Travail ¿Es posible pensar el trabajo a través del don? Debate con el comité de redacción de la Nouvelle Revue du Travail

    OpenAIRE

    Alain Caillé; Norbert Alter

    2012-01-01

    Dans un échange avec la Nouvelle Revue du Travail, Alain Caillé et Norbert Alter soutiennent leur lecture maussienne des réalités contemporaines du travail en discutant les questions centrales du capitalisme, du salariat, de l’entreprise et du travail sociologique. Cet échange fait suite aux contributions d’Alain Caillé et Norbert Alter dans ce Chorus « Peut-on penser le travail par le don ? De la mise en œuvre du paradigme du don contre-don en sociologie du travail. »In an exchange with the ...

  13. Nouvelles Techniques d'Intervention sur la Corrosion des Armatures du Béton Armé

    CERN Document Server

    Colloca, C

    1999-01-01

    Les principaux dégâts constatés dans les armatures passives du béton armé sont la corrosion généralisée et la corrosion locale. Ces dégradations sont provoquées soit par la carbonatation du béton soit par le contact avec l'eau pure ou l'eau chargée de chlorures pénétrant dans les pores et dans les fissures de surface. Ce document présente de nouvelles techniques d'intervention, fondées sur d'anciens principes, introduites pour le traitement électrochimique des zones altérées liées aux différentes conditions. La réalcalinisation (dans le cas de béton carbonaté) permet d'augmenter le pH du béton et de rétablir un niveau de basicité garantissant la passivation de l'armature. La désalification (dans le cas de béton entamé par les chlorures) provoque l'élimination des ions chlorure à travers la surface du béton. Les avantages de ces traitements, par rapport aux anciennes techniques, sont appréciables si l'on considère la durée d'exécution et leur coût moins élevé.

  14. Le désir sexuel des femmes, du DSM à la nouvelle médecine sexuelle

    OpenAIRE

    Vuille, Marilène

    2015-01-01

    Les « troubles du désir sexuel » apparaissent dans le Manuel diagnostique et statistique des troubles mentaux (DSM-III) en 1980, sous une forme unisexe. Au cours des révisions successives du DSM jusqu’à sa version actuelle, un désir sexuel féminin spécifique se détache de l’entité commune. Sa définition est plus complexe que celle de la catégorie autrefois unisexe et désormais masculine. La formulation actuelle du désir sexuel féminin et de ses « dysfonctions » dans le DSM découle de l’influe...

  15. Peut-on penser le travail par le don ? Débat avec la rédaction de la Nouvelle Revue du Travail

    OpenAIRE

    Caillé, Alain; Alter, Norbert

    2012-01-01

    Dans un échange avec la Nouvelle Revue du Travail, Alain Caillé et Norbert Alter soutiennent leur lecture maussienne des réalités contemporaines du travail en discutant les questions centrales du capitalisme, du salariat, de l’entreprise et du travail sociologique. Cet échange fait suite aux contributions d’Alain Caillé et Norbert Alter dans ce Chorus « Peut-on penser le travail par le don ? De la mise en œuvre du paradigme du don contre-don en sociologie du travail. »

  16. La réception des films de la Nouvelle Vague dans le courrier des lecteurs de Cinémonde

    OpenAIRE

    Sellier, Geneviève

    2014-01-01

    L’auteure propose d’explorer les traces d’une forme ordinaire de cinéphilie, celle des spectatrices qui forment les deux tiers du courrier des lecteurs de l’hebdomadaire français Cinémonde (1928-1966). La période choisie (1959-1960), moment d’émergence de la Nouvelle Vague, suscite parmi les (jeunes) correspondantes régulières de ce magazine populaire une intensification des commentaires et des échanges. Bien que citées partiellement, ces lettres évaluent le plus souvent la performance des ac...

  17. La catalyse d'épuration des gaz d'échappement automobiles. Situation actuelle et nouvelles orientations Catalytic Automotive Exhaust Gas Depollution. Present Status and New Trends

    OpenAIRE

    Prigent M.

    2006-01-01

    Cet article passe en revue les différents systèmes catalytiques de post-traitement utilisés actuellement sur la plupart des automobiles pour limiter leurs rejets de polluants. Les systèmes sont différenciés par leur mode de fonctionnement, le type de moteur à dépolluer (deux-temps, quatre-temps, diesel ou essence) ou par leur mode de réalisation. Les nouvelles orientations, prévues pour respecter les futures réglementations antipollution, sont également décrites. On montre que certains véhicu...

  18. Le système urbain nord-américain à l’heure de la «nouvelle économie»

    Directory of Open Access Journals (Sweden)

    Chrystel Alvergne

    2003-06-01

    Full Text Available Contrairement aux pronostics, la hiérarchie urbaine nord-américaine évolue vers une structure polycentrique où une dizaine de villes peuvent prétendre occuper une place importante. Grâce aux changements technoscientifiques, à l’Internet et à la « nouvelle économie », on peut aujourd’hui parler de hiérarchies urbaines spécialisées et de sous-ensembles régionaux reliés les uns aux autres.

  19. Etude de la Commande et de l'Observation d'une Nouvelle Structure de Conversion d'Energie de type SMC (Convertisseur Multicellulaire Superposé)

    OpenAIRE

    Lienhardt, Anne-Marie

    2006-01-01

    Ce manuscrit apporte une contribution à la commande et à l'observation du convertisseur multicellulaire superposé (SMC). Cette nouvelle structure de conversion d'énergie, brevetée en 2001, présente des caractéristiques très intéressantes qui lui confèrent un intérêt certain pour les applications industrielles de forte puissance. Les présents travaux ont pour objet principal d'améliorer le fonctionnement des convertisseurs SMC et de montrer leur compétitivité pour ce domaine d'application. Cet...

  20. Entre Classicisme et Modernité : La Nouvelle Revue Française dans le champ littéraire de la Belle Epoque

    OpenAIRE

    Koffeman-Bijman, M.N.

    2003-01-01

    The literary review La Nouvelle Revue Française enjoys an enormous prestige in France. In Entre Classicisme et Modernité, Maaike Koffeman explores the origins of this legend of French literary life by means of a historical, literary and sociological analysis of the first years of the review s existence (1908-1914). She shows that the NRF owes its remarkable success not only to its high literary standards, but also to the strategies employed by its editors in order to conquer a dominant positi...

  1. Hagkis ng Halakhak: Ang Nagpapatuloy na Kabuluhan ng Kritika ni Hernandez sa Pulitika sa Magkabilang Mukha ng Isang Bagol

    Directory of Open Access Journals (Sweden)

    Rosario Torres-Yu

    2012-12-01

    Full Text Available Itinanong ng kritikong si Epifanio San Juan, Jr., sa okasyon ng paggunita sa sentenaryo ng pagsilang ni Amado V. Hernandez, kung bakit wala pang panunuring historikal, liban sa isinulat ni Agoncillo at Lumbera, sa mga kuwento, dula, at sanaysay ng Pambansang Alagad sa Panitikan. Isang tugon ang panunuring ito sa isang dula ni Hernandez. Susuriin ang kahalagahang panlipunan at pangkasaysayan ng dula niya:1 sa lente mismo ng dalumat ni Hernandez sa relasyon ng panitikan at ng lipunan, 2 sa konteksto ng tagisang ideolohikal ng dula niya at ng panahong nasulat ang dula, at3 sa pangkasalukuyang sipat sa mga ito bilang diskurso na may diin sa usapin ng kapangyarihan at “katotohanan.” Malapitang susuriin, lalo na ang may kaugnayan sapangatlong pagbasa, ang dulang Magkabilang Mukha ng Isang Bagol (1961, dahil sa palagay ng nagsusuri na sa dulang ito higit na makikita na nagpapatuloy angkabuluhan ni Hernandez sa kasalukuyan, at dito lumulutang ang lakas at kapangyarihan ng kanyang kritika sa sistemang pampulitika.Writer and critic Epifanio San Juan Jr. observed, on the occasion of the centenary of the birth of Amado V. Hernandez, that except for the works of Agoncillo and Lumbera, no other historical analysis, particularly of the essays and plays, of the National Artist Hernandez has been written. This paper is an attempt to fill the gap. It evaluates the social and historical significance of one of his plays, Magkabilang Mukha ng Isang Bagol (1961, through the lens of Hernandez’s view of the relations of literature and society and in the context of the ideological position of his play and the ideological struggle atthe time the play was written. The play is treated, too, as discourse and centers on the discussion of power and “truth.” It is this writer’s position that it is in this play that Hernandez’s continuing relevance to the present ideological debaterests. It is also in this play that the strength of his critique is clearly

  2. Conceptual design of JT-60SA cryostat

    International Nuclear Information System (INIS)

    JT-60U modification program to fully superconducting device has been proceeded, namely ''JT-60SA'', toward early realization of fusion energy based on tokamak concept. The design of JT-60SA cryostat is expected to achieve a vacuum thermal insulation for super conducting coils, a bio-shielding boundary and structural gravity support. The cryostat is required to cover JT-60SA tokamak device, which is 15 m of total height and 7 m of radius, but there is geometrical limit due to surrounding devices reutilized. Although the cryostat consists of vessel body and gravity support, and the structural material is low cobalt 304 stainless steel (Co: 2, and the design of the leaf spring is considered to reduce thermal stress, and to withstand the mechanical loads of plasma disruption and seismic loads. The coolant is 80 K gas helium and both sides of panel are covered with multi-layers super insulation (SI) to reduce heat load (radiation) up to 1/100. Fraction of non-covered region is assumed to be 2% due to many port-joints and supports for the vacuum vessel. Total heat load for inner surface of cryostat (600 m2) is 9kW and the heat load for the port-joints (-300 m2) is assumed up to 9 kW. The operational pressure of the cryostat is required to keep less than 10-2 Pa and about 100,000 m2 of structural surfaces is considered for exhaust system specification. Another role of the cryostat is the radiation protection. Biological shielding up to 10 micro-Sv/h (for maintenance acceptance) is required of the cryostat surface after the 10 years operation. Thus the cryostat consists of boron (2 wt%) doped concrete of 220 mm thickness and structural SS304 of total 40 mm thickness. The concrete reduces the air activation (41Ar) in the torus hall by 90% rather than the normal one by the thermal neutron absorption of boron. (orig.)

  3. Biodiversidade, biotecnologia e saúde

    OpenAIRE

    Garcia Eloi S

    1995-01-01

    Este artigo apresenta a importância da biodiversidade, da biotecnologia a da saúde e discute vários aspectos dos problemas biológicos, ambientais e o dilema ético, relacionados com a expansão e a exploração dos recursos naturais em razão das quais espécies de plantas e animais têm sido extintas. Por outro lado, o conhecimento da biodiversidade tem possibilitado a identificação e a utilização de novos recursos naturais para a melhoria da vida do homem neste planeta. É importante que nossos pes...

  4. Biodiversidade, biotecnologia e saúde

    Directory of Open Access Journals (Sweden)

    Garcia Eloi S.

    1995-01-01

    Full Text Available Este artigo apresenta a importância da biodiversidade, da biotecnologia a da saúde e discute vários aspectos dos problemas biológicos, ambientais e o dilema ético, relacionados com a expansão e a exploração dos recursos naturais em razão das quais espécies de plantas e animais têm sido extintas. Por outro lado, o conhecimento da biodiversidade tem possibilitado a identificação e a utilização de novos recursos naturais para a melhoria da vida do homem neste planeta. É importante que nossos pesquisadores se envolvam na luta pela preservação do ecossistema tropical. Os programas de exploração da biodiversidade devem estar baseados em sólidos conhecimentos científicos e favorecer ecológica e economicamente a sociedade.

  5. Biodiversidade, biotecnologia e saúde

    Directory of Open Access Journals (Sweden)

    Eloi S. Garcia

    1995-09-01

    Full Text Available Este artigo apresenta a importância da biodiversidade, da biotecnologia a da saúde e discute vários aspectos dos problemas biológicos, ambientais e o dilema ético, relacionados com a expansão e a exploração dos recursos naturais em razão das quais espécies de plantas e animais têm sido extintas. Por outro lado, o conhecimento da biodiversidade tem possibilitado a identificação e a utilização de novos recursos naturais para a melhoria da vida do homem neste planeta. É importante que nossos pesquisadores se envolvam na luta pela preservação do ecossistema tropical. Os programas de exploração da biodiversidade devem estar baseados em sólidos conhecimentos científicos e favorecer ecológica e economicamente a sociedade.

  6. SA 8000 - ACCOUNTING FOR CORPORATE SOCIAL RESPONSIBILITY

    Directory of Open Access Journals (Sweden)

    Boca Ileana-Sorina

    2010-12-01

    Full Text Available In the current context, organizations are evaluated not only in terms of product quality. The modern organization is valued beyond its economic performance, quality management and communication policy, and by its contribution to the social life of the community it takes part of. The new social responsibilities that appear for the companies involve the increasement of information requests from both outside and inside for better management of the entity. Social responsibility accounting is a branch of accounting in the context of scientific knowledge that provides answers to social problems, the causes, manifestations and projections in a dynamic environment. This article aims to show what social responsibility is and how it works according to SA 8000:2008, what would be its implications and its main objectives, emphasizes the importance of publishing additional information on corporate social responsibility other than traditional financial situations.

  7. SAED and HRTEM Investigation of Palygorskite

    Institute of Scientific and Technical Information of China (English)

    CHEN Tao; WANG Hejing; ZHANG Xiaoping; ZHENG Nan

    2008-01-01

    The microstructure of palygorskite from Longwang Mountain of Xuyu County, Jiangsu Province, was studied by energy dispersive X-ray analysis (EDX), selected-area electron diffraction (SAED) and high-resolution transmission electron microscopy (HRTEM). The average composition of the palygorskite studied is (Si7.38Al0.62) (Al0.96Fe3+0.62Mg2.86□0.56)Ca0.03K0.06O20(OH)2(OH2)4, which is rich in Mg. Several SAED patterns from a single crystal of palygorskite were obtained with different zone axes. The polymorphs (monoclinic and orthorhombic) are unequivocally distinguished by distant interplanar angles, even though they possess similar sets of d-values. High-resolution images of three principal zones ([010], [100] and [110]) were obtained. The lattice fringes on HRTEM images along [010] have spacings of 0.319 nm. These fringes are interpreted as periodic alterations of two tetrahedral (T) sheets and one octahedral (O) sheet (-TT-O-TT-O-). We have directly observed trioctahedral and dioctahedral individual palygorskite particles along [100]. They are all presented as dark lines along [001], but the width of dark lines corresponding to trioctahedral crystals (0.913 nm) is twice that of the dioctahedral ones (0.456 nm). This is because the trans-sites are occupied by cations in trioctahedral palygorskite. The width of dark lines along [110] is 1.024 nm, a bit thinner than the theoretical spacing (1.044 nm). This is because water molecules quickly leave the structure upon the irradiation by the electron beam.

  8. Gasto privado com saúde por classes de renda

    Directory of Open Access Journals (Sweden)

    KILSZTAJN SAMUEL

    2002-01-01

    Full Text Available OBJETIVO: O artigo analisa a participação do gasto privado com saúde das famílias no PIB e no total da renda familiar per capita e a distribuição do gasto privado com saúde das famílias por classes de renda. MÉTODOS: A pesquisa utilizou os microdados da Pesquisa Nacional por Amostra de Domicílios de 1998, com a divisão da população em quatro classes de renda familiar per capita e a distribuição dos gastos em planos de saúde, consultas médicas, consultas com outros profissionais de saúde, exames, medicamentos, artigos ortopédicos e aparelhos médicos, óculos e lentes, odontologia, hospitais, enfermagem domiciliar e outros gastos com saúde. RESULTADOS: Apenas 7,2% da população com renda familiar per capita até 1 salário mínimo em 1998 tinha direito a algum plano de saúde, e o gasto privado com saúde das famílias desta classe, que representava 52,5% da população, era em média de R$ 5,36 por pessoa. Para as pessoas com renda familiar per capita acima de 9 salários mínimos, os planos de saúde atingiam 83,2% da população e o gasto privado com saúde das famílias R$ 133,04. CONCLUSÕES: A implantação do Sistema Único de Saúde foi acompanhada pelo crescimento expressivo dos planos de saúde nos anos 90. Mesmo se todo o gasto público com saúde fosse destinado à população sem planos de saúde, ainda assim o gasto destas pessoas em 1998 só alcançaria R$ 352,62, ou seja, 43% do gasto com saúde das pessoas com planos, R$ 819,08.

  9. Saúde oral: um desafio para a equipe de saúde

    Directory of Open Access Journals (Sweden)

    Vera Lúcia de Oliveira Gomes

    2001-03-01

    Full Text Available Esta pesquisa teve como objetivo desvelar o conhecimento dos formandos dos cursos de Enfermagem e Medicina de uma Universidade do Rio Grande do Sul acerca da promoção da Saúde Oral. Participaram do estudo 58 acadêmicos, sendo 26 do Curso de Enfermagem e 32 do Curso de Medicina, estes responderam a um questionário com três perguntas semi-estruturadas. Através da triangulação constatamos que esse conhecimento entre os formandos dos referidos cursos é deficitário. Sabemos que é grande a dificuldade de acesso da população infantil carente aos gabinetes dentários, por esse motivo, acreditamos ser indispensável que os profissionais de Enfermagem e Medicina tenham conhecimentos referentes à promoção de saúde oral em crianças.

  10. Saúde mental e trabalho: os problemas que persistem

    Directory of Open Access Journals (Sweden)

    Leny Sato

    2005-12-01

    Full Text Available Este artigo toma por objeto a Saúde Mental e Trabalho como uma subárea do campo da Saúde do Trabalhador. Parte da constatação de que os problemas de saúde mental e trabalho, já identificados em meados da década de 1980, persistem. Após retomar a taxonomia de tais problemas, busca evidenciar algumas de suas expressões atuais a partir da assistência e da vigilância em saúde do trabalhador, bem como pela perspectiva de alguns sindicatos mais atentos à questão. Para tal, toma como ponto de partida o Centro de Referência em Saúde do Trabalhador (CRST de Campinas. Por fim, pontua algumas características do trabalho no contexto atual para compreender as motivações dessa persistência.

  11. Ang Demokratikong Sistema at ang mga Modelo ng Pamumuno sa Pilipinas

    OpenAIRE

    F. P. A. Demeterio

    2010-01-01

    Maraming paraan ang pagsusuri sa problema ng pulitika sa Pilipinas.Para sa mga moralista at ideyalista, halimbawa, maaari itong tingnangamit ang perspektibo ng sistema ng pagpapahalaga (values) at moralidad; para sa mga materyalista naman, maaari din itong himayin gamit ang perspektibo ng pagka-di-pantay-pantay ng kayamanan at kapangyarihan(unequal wealth and power) ng ating mga mamamayan; o hindi kaya para sa mga eksperto sa sistema at istraktura, maaari din itong dalumatin gamit ang perspek...

  12. A Short Story from Canada in the German EFL-Classroom — “Borders” or a Sense of Belonging in a Multicultural Society Une nouvelle canadienne dans l’enseignement de l’anglais langue étrangère en Allemagne : « Borders » ou le sentiment d’appartenance dans une société multiculturelle.

    Directory of Open Access Journals (Sweden)

    Albert Rau

    2009-10-01

    Full Text Available Depuis quelques années, l’apprentissage interculturel joue un rôle central dans l’enseignement de l’anglais langue étrangère. Au lieu de divulguer uniquement des informations factuelles relatives à un pays étranger, l’apprentissage interculturel vise à comprendre une culture, un monde qui diffère du sien. Une façon d’appréhender une culture étrangère peut se faire en lisant sa littérature car les textes littéraires n’offrent pas seulement un sentiment d’empathie envers les personnages ou une impression de vivre leur quotidien par procuration, ils suscitent des questions et des réponses de la part des étudiants. La littérature canadienne se prête bien à l’apprentissage interculturel car les grandes interrogations portant sur le contexte socio-culturel canadien servent de modèles aux étudiants. La nouvelle Borders de Thomas King en est un exemple. Elle relate le vécu d’une famille nouvellement établie, piégée dans un terrain vague situé aux confins du Canada et des Etats-Unis, une famille désireuse de préserver son identité « pied noire » (Blackfoot.

  13. Nouvelle manga, mon amour. Reflexiones sobre la narración gráfica de historias cotidianas

    Directory of Open Access Journals (Sweden)

    Olalla Hernández Ranz

    2010-03-01

    Full Text Available Desde sus primeras manifestaciones hace más de un siglo, el cómic se ha ido consolidando como un género popular sobretodo dirigido a un lector juvenil. Su evidente atractivo entre los lectores ha hecho que algunos padres, educadores y profesionales del ámbito de la promoción de la lectura se plantearan el por qué de dicha afición, llegando a conclusiones erróneas como la creencia de que se trata de una lectura menor, dirigida esencialmente a la pura distracción de quien los lee. El manga, en concreto, es el género dentro del cómic que más se consume en occidente. Se ha convertido en un fructífero producto de mercado que deriva en videojuegos, series de televisión, películas de cine… Su gran acogida entre el público infantil y juvenil preocupa a mediadores por la supuesta carga violenta y sexual y la baja calidad literaria de sus obras. El presente propuesta tratará de deshacer algunos tópicos en relación con la concepción errónea la historieta nipona, a partir del estudio de un corpus de obras creadas por autores japoneses y europeos que quieren aportar un cómic de calidad tanto en su forma como en el contenido, abriendo así las puertas a nuevas investigaciones de gran interés. La Novelle manga es un nuevo género dentro del cómic nipón que aúna las estrategias comunicativas más destacables de las novelas gráficas japonesas, el valor estético del cómic francés y la sencillez y el tono de las películas de cine francés dentro de la Nouvelle Vague para crear un cómic que narra historias cotidianas de gran valor literario y estético, muy recomendable para lectores juveniles y adultos.

  14. Conséquences des nouvelles formes de commande sur les matériaux de l'isolation statorique

    Science.gov (United States)

    Bellomo, J. P.; Lebey, Th.; Peltier, Fr.; Oraison, J. M.

    1997-05-01

    Use of inverter drive for rotating machines speed control leads to the application of new stress on stator insulation materials. The integrity of these materials under such stresses has therefore to be studied. Thanks to specially equipped motor, the different voltage shapes have been identified. Very short rise time fronts, large overvoltages and high oscillation frequencies are obtained. These voltages are then reproduced on laboratory samples (Polyethylene Terephtalate). The main result is the existence of trapped surface charges related both to the rise front value and to the existence of polar mechanisms in the material bulk. The consequences of this surface charge existence on the reliability of a real system are then discussed. L'utilisation de nouvelles formes de commande pour les machines à courant alternatif se traduit par l'apparition d'un nouveau type de contraintes sur les matériaux de l'isolation statorique. L'étude de leur comportement sous l'action de ce type de contraintes revêt un intérêt tout particulier pour la validation et la stabilité de ces systèmes dans le temps. Nous présentons, tout d'abord, ces différentes formes de tension identifiées à l'aide d'un moteur spécialement instrumenté. L'existence de fronts de tension très élevés, de surtensions importantes (jusqu'à 500V) et d'oscillations hautes fréquences (2MHz), est mise en évidence. La reproduction de ces contraintes en laboratoire sur des échantillons de polyesters (PolyÉthylène Térephthalate) permet alors de déterminer l'influence des formes de tension carrées sur les propriétés intrinsèques du matériau. Elle se traduit par l'existence d'une charge piégée en surface du diélectrique. Cette charge superficielle est associée, d'une part à l'existence de phénomènes de relaxation dans les matériaux étudiés et d'autre part à la valeur des fronts de tension appliqués. Pour finir, les conséquences possibles de l'existence de ces charges superficielles

  15. Le principe de souveraineté à l’épreuve des nouvelles formes d’administration internationale de territoires

    Directory of Open Access Journals (Sweden)

    Barbara Delcourt

    2011-09-01

    Full Text Available Le concept de souveraineté a fait l’objet de de critiques touchant à la fois ses fondements doctrinaux et ses applications concrètes. L’objectif de cette contribution est de démontrer qu’il serait pourtant prématuré de le remiser au rang des accessoires de la science politique. L’analyse des « nouvelles » formes d’administration internationale de territoires en donne une illustration ­dans la mesure où le concept de souveraineté s’avère être un critère particulièrement pertinent pour évaluer la portée politique et les effets juridiques des interventions extérieures. L’utilité du recours au concept de souveraineté, sur un plan méthodologique, apparaîtra sans doute un peu paradoxale puisqu’il permet de qualifier des situations dans lesquelles il n’existe pas réellement un pouvoir souverain. C’est pourquoi, la seconde partie de la contribution s’interroge sur l’opportunité d’utiliser le concept de gouvernance internationale, un concept que l’on présente généralement comme mieux adapté aux réalités du monde contemporain. Une telle substitution, justifiée le plus souvent par un pragmatisme de bon aloi, est aussi considérée comme plus susceptible de contribuer à la consolidation des principes démocratiques dans les pays placés sous administration internationale. Quoi qu’il en soit, il apparaît évident que les problèmes méthodologiques que soulève l’utilisation du concept de souveraineté et de gouvernance internationale, sont éminemment liés à des positionnements normatifs sur lesquels il est difficile de faire l’impasse.

  16. Nouvelles techniques de mise en valeur des ressources d'hydrocarbures New Techniques for Valorising Hydrocarbon Resources

    Directory of Open Access Journals (Sweden)

    Boy De la Tour X.

    2006-11-01

    Full Text Available Après avoir montré l'importance des réserves de pétrole non conventionnel et l'enjeu que représente pour l'humanité la mise en exploitation de ces ressources, cette étude examine les axes actuels de recherches et l'état de la technologie pour chacune des sources de nouveau pétrole retenues : mers profondes, récupération assistée, huiles lourdes et sables asphaltiques, schistes bitumineux et conversion du charbon. Il en ressort que si les ressources de nouveau pétrole sont considérables, leur mise en valeur nécessitera des investissements très lourds, et le coût du pétrole ainsi produit restera élevé, comparé au coût actuel du pétrole conventionnel. Compte tenu des délais de mise en oeuvre, des problèmes technologiques restant à résoudre et de la nécessité de réaliser des pilotes semi-industriels très coûteux pour expérimenter les nouvelles techniques, il convient de consentir sans attendre un effort important de recherche technologique, impliquant un accroissement sensible des budgets de R&D, mais aussi des incitations financières appropriées. Cet effort de mise au point de technologies adaptées à ces sources d'hydrocarbures sera favorisé par les nouvelles conditions économiques créées par la rareté relative des réserves d'hydrocarbures classiques, à condition que les Etats, par leur politique, favorisent la production de ressources d'hydrocarbures à coût élevé. A l'heure actuelle, on peut évaluer la production de pétrole difficile à environ 100 Mt, l'essentiel étant réalisé dans le domaine des huiles lourdes et de la récupération assistée ; on estime que la production de nouveau pétrole pourrait représenter 200 à 350 Mt en 1990 et se situer entre 600 et 900 Mt en 2000, soit 5 à 8 % de la production de pétrole en 1990 et 15 à 20 % en 2000. Un tel objectif nécessiterait des investissements de l'ordre de 500 à 750 milliards de dollars 1980. After pointing out the importance of

  17. Improving the distribution logistics for House of Åsa

    OpenAIRE

    Broth Wiss, Caroline; Jeppsson, Emma

    2006-01-01

    This thesis is a result of a study performed as an assignment of House of Åsa. House of Åsa is a newly established company on the Swedish market. The company sells furniture produced in India in an Internet shop. The purpose of this study is to map the distribution logistics from the producing company in India to the end customers in Sweden and to develop a cost efficient solution. Outlines for House of Åsa’s pricing have been made based on the logistic costs. House of Åsa has difficulties in...

  18. Ouvidorias públicas de saúde: estudo de caso em ouvidoria municipal de saúde

    Directory of Open Access Journals (Sweden)

    Rita de Cássia Costa da Silva

    2014-02-01

    Full Text Available OBJETIVO : Analisar o papel da ouvidoria e sua contribuição para a gestão da saúde pública segundo usuários de sistema de Saúde e de conselheiros municipais de saúde. MÉTODOS : Pesquisa qualitativa, estudo de caso, descritivo e transversal. A unidade de análise foi uma ouvidoria de saúde, localizada em município do estado de Minas Gerais, de maio a agosto de 2010. O estudo foi de natureza observacional com dados coletados em entrevistas com dois grupos de stakeholders: usuários e conselheiros de saúde. Foram entrevistados 44 usuários do Sistema Único de Saúde que registraram manifestações presenciais na ouvidoria e todos os 20 conselheiros do município. As informações obtidas foram analisadas com base em três questões: (1 natureza das informações obtidas; (2 discussão sobre subsídios para qualificar o funcionamento da ouvidoria como ferramenta de gestão; (3 proposição de ações para o aprimoramento da gestão democrática no campo da saúde pública. RESULTADOS : As demandas reportadas à ouvidoria indicaram dificuldade de acesso às ações e serviços de saúde, correndo o risco de serem percebidas como atalhos para obtenção de acessibilidade, desconsiderando o princípio da justiça social. A atuação da ouvidoria contou com a aprovação dos cidadãos. Os usuários relataram como principais funções da ouvidoria: ajudar a solucionar problemas de saúde e ouvir e esclarecer sobre o funcionamento do Sistema Único de Saúde. A informação foi enfatizada pelos conselheiros de saúde como instrumento de poder e de acesso aos direitos dos usuários do Sistema Único de Saúde. Destacaram que a ouvidoria tem como tarefa garantir justiça na efetivação da política de saúde e que desempenha importante papel de mediação entre o Conselho de Saúde, os cidadãos e os gestores do sistema municipal de saúde. Além disso, atribuíram à ouvidoria caráter executivo que usualmente ela não abriga. CONCLUSÕES : A

  19. Educação em saúde como principal alternativa para promover a saúde do idoso

    Directory of Open Access Journals (Sweden)

    Danielli Gavião Mallmann

    2015-06-01

    Full Text Available Trata-se de uma revisão integrativa que objetivou identificar as evidências científicas sobre as ações educativas em saúde voltadas à promoção da saúde do idoso. A busca dos artigos foi realizada nas bases de dados Medline, Lilacs, BDENF, CINAHL e biblioteca virtual SciELO, por meio do cruzamento dos descritores Educação em Saúde, Idoso, Envelhecimento, Saúde do Idoso, Promoção da Saúde e Qualidade de vida, incluindo-se artigos publicados no período de 2003 a 2013, nos idiomas inglês, espanhol e português, realizados com idosos. Foram selecionados oito artigos, dos quais percebeu-se a qualidade de vida e a promoção do envelhecimento saudável como fatores resultantes das estratégias de educação em saúde. As ações de educação em saúde para idosos necessitam de metodologias que atentem para a complexidade do processo de envelhecimento e relacionem os fatores que cercam o indivíduo, como as crenças, os valores, as normas e os modos de vida.

  20. Saúde e meio ambiente nas cidades: os desafios da saúde ambiental

    Directory of Open Access Journals (Sweden)

    Nelson Gouveia

    1999-02-01

    Full Text Available Dentro de alguns poucos anos, nosso planeta contará com mais habitantes em áreas urbanas do que em áreas rurais. A urbanização desenfreada, sem mecanismos regulatórios e de controle, típica dos países periféricos, trouxe consigo enormes repercussões na saúde da população. Problemas como a insuficiência dos serviços básicos de saneamento, coleta e destinação adequada do lixo e condições precárias de moradia, tradicionalmente relacionados com a pobreza e o subdesenvolvimento, somam-se agora à poluição química e física do ar, da água e da terra, problemas ambientais antes considerados "modernos". Novamente, é sobre as populações mais carentes que recai a maior parte dos efeitos negativos da urbanização, gerando uma situação de extrema desigualdade e iniqüidade ambiental e em saúde. Para reverter esse quadro é preciso que haja uma reincorporação das questões do meio ambiente nas políticas de saúde, e a integração dos objetivos da saúde ambiental numa ampla estratégia de desenvolvimento sustentável. Uma abordagem mais integrada, com mecanismos intersetoriais que possibilitem um diálogo amplo entre as partes, trará enormes benefícios na conquista de melhores condições de vida nas cidades. A saúde ambiental hoje tem o desafio de promover uma melhor qualidade de vida e saúde nas cidades e a oportunidade de enfrentar o absurdo quadro de exclusão social, sob a perspectiva da eqüidade.In a matter of few years there will be more urban than rural dwellers worldwide. The rapid urbanisation lacking adequate control and regulatory mechanisms typical of developing countries, brought along huge effects to the health of the population Environmental problems traditionally related to poverty and underdevelopment such as insufficient provision of sanitation services, waste collection and disposal, and precarious housing conditions, are now added to environmental problems considered of "modern life" such as the

  1. Educação para a Saúde

    OpenAIRE

    Carvalho, Amâncio; Carvalho, Graça Simões

    2006-01-01

    Em 1984 a Comissão Regional da Europa da Organização Mundial de Saúde (OMS) aprovou as metas regionais de Saúde para Todos sob a qual deveriam assentar as bases da política de saúde dos vários estados membros. As estratégias para se atingirem tais metas são as seguintes: a promoção de estilos de vida saudáveis; a protecção do ambiente; a prestação de cuidados de saúde adequados e ajustados à população; e a criação de medidas de suporte pertinentes a nível da pesquisa e informação (Amorim, 200...

  2. Observation of Magnetic Superviscosity in Metglas 2605SA1

    CERN Document Server

    Crawford, Anthony C

    2015-01-01

    A quasi time constant for magnetic domain relaxation of Metglas 20605SA1 has been measured to be 2.6 hours. The effective relative magnetic permeability has been measured to be 57,000 after relaxation.

  3. URGENCES NOUVELLE VERSION

    CERN Multimedia

    Medical Service

    2002-01-01

    The table of emergency numbers that appeared in Bulletin 10/2002 is out of date. The updated version provided by the Medical Service appears on the following page. Please disregard the previous version. URGENT NEED OF A DOCTOR GENEVAPATIENT NOT FIT TO BE MOVED: Call your family doctor Or SOS MEDECINS (24H/24H) 748 49 50 Or ASSOC. OF GENEVA DOCTORS (7H-23H) 322 20 20 PATIENT CAN BE MOVED: HOPITAL CANTONAL 24 Micheli du Crest 372 33 11 382 33 11 CHILDREN'S HOSPITAL 6 rue Willy Donzé 382 68 18 382 45 55 MATERNITY 24 Micheli du Crest 382 68 16 382 33 11 OPHTALMOLOGY 22 Alcide Jentzer 382 84 00 HOPITAL DE LA TOUR Meyrin 719 61 11 CENTRE MEDICAL DE MEYRIN Champs Fréchets 719 74 00 URGENCES : FIRE BRIGADE 118 FIRE BRIGADE CERN 767 44 44 BESOIN URGENT D'AMBULANCE (GENEVE ET VAUD) : 144 POLICE 117 ANTI-POISON CENTRE 24H/24H 01 251 51 510 EUROPEAN EMERGENCY CALL: 112 FRANCE PATIENT NOT FIT TO BE MOVED: call your family doctor PATIENT CAN BE MOVED: ST. JULIE...

  4. Apoio social e saúde entre idosos

    Directory of Open Access Journals (Sweden)

    Ramos Marília P.

    2002-01-01

    Full Text Available O presente artigo trata da relação entre a saúde dos idosos e relacionamentos sociais, bem como na interpretação e entendimento desta problemática sob a luz de dois enfoques teóricos: um macro, centrado na Teoria da Integração Social de Emile Durkheim e outro micro, centrado na Teoria das Trocas, de Peter Blau, com ênfase na Teoria da Eqüidade. A integração social (freqüência de contatos pode ter efeitos negativos na saúde, mas isto tem de ser medido pela qualidade dos contatos. Algumas conclusões apresentadas indicam que as relações sociais têm um efeito na saúde, no sentido de que as pessoas, nas sociedades modernas, esperam a reciprocidade, e, quando isto não é possível, principalmente na fase do envelhecimento, as pessoas sentem-se dependentes, e isso pode afetar a saúde de diferentes maneiras. Por outro lado, quando as pessoas têm problemas de saúde, elas experienciam uma falta de relações sociais balanceadas devido à incapacidade para trocar em bases iguais. Sendo assim, conclui-se que a relação entre relações sociais e saúde na população idosa pode ser uma relação recíproca.

  5. Die Menschen der Virginia Company of London und der Compagnie de la Nouvelle-France – zwei frühneuzeitliche Handelskompanien im Vergleich

    Directory of Open Access Journals (Sweden)

    David Hense

    2014-05-01

    Full Text Available Much has been written about the European overseas expansion to North America during the 17th century. Therefore it is remarkable that there has never been a detailed comparison between the English and French beginnings in this world-changing adventure before. After suffering considerable failures, both nations tried to use modern age chartered trading companies to fulfill their dreams of colonization and trade in the New World. This article tries to answer some significant questions by focussing on the social aspect of the charters of the Virginia Company of London (1606 and the Compagnie de la Nouvelle-France (1627. Who founded the companies? Who were the members of those companies? And how could the membership be acquired? Finally the article provides insight into the great question what was ‘typically’ English and ‘typically’ French in the membership of the companies.

  6. Souvenirs des morts : techniques de gestion de la mémoire dans un village de Nouvelle-Guinée

    OpenAIRE

    Lohmann, Roger Ivar 

    2010-01-01

    Les Asabano de Papouasie Nouvelle-Guinée traitent de diverses façons les objets considérés comme des « mémentos » de leurs compagnons décédés. Plusieurs cas sont abordés ici, notamment la conservation à long terme de ces objets, leur destruction immédiate et leur abandon à la désintégration. Le choix de la stratégie qui va être suivie par les survivants est influencé par divers facteurs, parmi lesquels la valeur pragmatique et sentimentale accordée à l’objet et l’état émotionnel du moment. To...

  7. S. Crépon. La nouvelle extrême droite, enquête sur les jeunes militants du Front national

    OpenAIRE

    Générat, Émilie

    2009-01-01

    Le Front national (FN) progresse depuis la fin des années quatre-vingt. Cette progression a souvent été expliquée par des causes socio-économiques. Pourtant en 2002, lorsque Jean-Marie Le Pen arrive au deuxième tour des élections présidentielles, la France est en période de croissance économique. Dans La nouvelle extrême droite, enquête sur les jeunes militants du Front national, Sylvain Crépon donne la parole aux jeunes militants de ce parti considéré « pas comme les autres », afin de recuei...

  8. Nouvelle filière technologique pour micro-commutateurs parallèles capacitifs micro-ondes sur membrane diélectrique

    OpenAIRE

    Rabbia, Laurent

    2005-01-01

    Ce mémoire traite de l'élaboration d'une nouvelle filière technologique pour micro-commutateurs parallèles capacitifs micro-ondes sur membrane diélectrique. Les micro-commutateurs sont des ponts à air métalliques actionnés électrostatiquement et structurés par un micro-usinage de surface. Un micro-usinage de volume est réalisé pour obtenir une membrane sur laquelle les circuits fabriqués sont faibles pertes. Le chapitre I présente le procédé technologique global utilisé. Dans un premier temps...

  9. L'auteure mise en scène et mise à nu. Sur les fausses confessions de La nouvelle pornographie

    Directory of Open Access Journals (Sweden)

    Joëlle Papillon

    2010-11-01

    Full Text Available L'inclusion dans La nouvelle pornographie (2000 du nom propre de l'auteure est perçue comme une implication qui la met en danger. La métalepse est utilisée pour inscrire le roman dans la mouvance des confessions sexuelles et se jouer de leurs codes. Comme le discours publicitaire, Marie Nimier utilise la rhétorique pornographique afin de « vendre » un contenu domestique : la pornographie de surface dissimule un récit qui réinscrit l'amour comme moteur du désir féminin. Nimier joue de la métalepse pour déjouer les scènes pornographiques et séduire le lecteur par l'intelligence de ses manipulations plutôt que par ses dévoilements.

  10. Phénomène des branchies orange dans les élevages de crevettes en Nouvelle-Calédonie

    OpenAIRE

    Lemonnier, Hugues; Barri, Kiam; Pham, Dominique; Wabete, Nelly; Boulo, Viviane; Lignot, Jean-herve; Royer, Florence; Hubert, Morgane; Blockmans, Bernard; Pierrot, Thomas; Laugier, Thierry; Tostin, Nathalie

    2014-01-01

    L'aquaculture est une activité importante du paysage économique de la Nouvelle-Calédonie., La crevette Bleue du Pacifique, Litopenaeus stylirostris est aujourd’hui l’espèce cible, élevée en semi-intensif, dans des bassins de terre de 4 à 10 hectares. Une coloration orange prononcée au niveau des branchies, comparable à celle observée suite à un stress hypoxique alors qu’aucun déficit en oxygène n’est constaté, est apparue récemment engendrant une décote du produit à la vente et donc un risque...

  11. Les énergies marines renouvelables : qu'est-ce que c'est ? Quelles perspectives en Nouvelle-Calédonie.

    OpenAIRE

    De Roeck, Yann-herve; Loubersac, Lionel

    2013-01-01

    Ce texte présente une revue des différentes technologies d’exploitation des ressources énergétiques qui peuvent être tirées de la mer. On expose ainsi les solutions offertes par la marée et les courants, la houle et les vagues, l’éolien marin, l’énergie thermique des mers, l’énergie osmotique et on précise les degrés de maturité technologique très échelonnés de chaque solution. Cette nouvelle activité économique sur l’espace littoral et côtier comporte également des effets indirects en termes...

  12. Yoram Mouchenik, L’enfant vulnérable. Psychothérapie transculturelle en pays kanak (Nouvelle-Calédonie)

    OpenAIRE

    Jonckers, Danielle

    2008-01-01

    Ce livre s’inscrit dans le champ de l’ethnopsychiatrie, tel qu’il a été notamment constitué dans le domaine francophone par les approches successives de Georges Devereux, Henri Collomb, Tobie Nathan et Marie-Rose Moro – dont Yoram Mouchenik est proche. L’auteur y présente le travail clinique qu’il a mené sous la forme d’entretiens familiaux à domicile sur les îles Loyauté, en Nouvelle-Calédonie. Centré sur la notion de vulnérabilité de l’enfant, l’ouvrage en reconstruit le contexte symbolique...

  13. Poison, médecine et nouvelles technologies dans la série télévisée Doctor Who (2005-2012)

    OpenAIRE

    Dubois, François-Ronan

    2014-01-01

    International audience L'article étudie différents épisodes de la série télévisée Doctor Who dont l'organisation en réseau, grâce à la structure narrative de la série, permet de développer un discours critique sur les nouvelles technologies. Il montre de quelle manière la série télévisée présente certains progrès en nanotechnologies médicales de façon très négative, grâce à des équivalences visuelles avec les virus et le poison.

  14. Les nouvelles perspectives d'analyse spatiale des nuisances sonores. Le projet SIGAUR (Système d'Information Géographique et Acoustique URbaine

    Directory of Open Access Journals (Sweden)

    Erwan Quesseveur

    1999-06-01

    Full Text Available Ce rapport présente un projet de recherche sur l’intégration d’une couche d’information de nuisances acoustiques dans un système d’information géographique.Après un développement sur l’état de la pollution et des moyens aujourd’hui en vigueur pour la combattre, on va montrer les nouvelles perspectives offertes pour l’analyse spatiale du bruit. En confrontant cette nuisance aux enjeux du territoire, elle peut devenir un véritable critère de décision en aménagement du territoire.Ce projet résulte d’une collaboration entre le Centre Scientifique et Technique du Bâtiment C.S.T.B. et l’équipe " S.I.G. " de l'Institut de Géographie Alpine (IGA

  15. Les nouvelles formes de la communication autour des projets urbains : modalités, impacts, enjeux pour un débat participatif

    Directory of Open Access Journals (Sweden)

    Hélène Bailleul

    2008-09-01

    Full Text Available Dans cet article, nous observons les évolutions que l’usage des nouvelles technologies implique dans la communication autour des projets urbains. Notre analyse des nouvelles modalités qu’Internet a pu importer dans la participation des habitants aux projets urbains (partie 1 nous pousse à observer, plus spécifiquement, les modifications qui ont trait, dans ce contexte, à la nature et au statut de l’information sur l’espace. La démocratisation des techniques de représentation de l’espace par ordinateur (3D, simulation entraîne le recours quasi systématique à des images virtuelles du projet, d’une grande qualité (partie 2, mais dont on ne connaît que très peu les impacts sur la perception et la réception que les habitants font du projet (partie 3.In this article, we observe the evolutions involved by the use of new technology in the communication around urban projects. Our analysis of the new modalities, Internet was able to import in the participation of inhabitants in urban projects (chapter 1 urges us to examine, more specifically, the modifications concerning the nature and the status of the information about space. The democratization of computer-based spatial representation’s tools (3D, simulation entails more and more systematic recourse to virtual images of the project, with high definition (chapter 2. But, nowadays, we still know little about their impacts on the perception and the reception, the inhabitants make of the project (chapter 3.

  16. Ang Demokratikong Sistema at ang mga Modelo ng Pamumuno sa Pilipinas

    Directory of Open Access Journals (Sweden)

    F. P. A. Demeterio

    2010-06-01

    Full Text Available Maraming paraan ang pagsusuri sa problema ng pulitika sa Pilipinas.Para sa mga moralista at ideyalista, halimbawa, maaari itong tingnangamit ang perspektibo ng sistema ng pagpapahalaga (values at moralidad; para sa mga materyalista naman, maaari din itong himayin gamit ang perspektibo ng pagka-di-pantay-pantay ng kayamanan at kapangyarihan(unequal wealth and power ng ating mga mamamayan; o hindi kaya para sa mga eksperto sa sistema at istraktura, maaari din itong dalumatin gamit ang perspektibo ng ating marupok na burukrasya. Susubukan ng papel na ito na pag-aralan ang paksa sa pamamagitan ng pagsusuri sa konsepto ng pamumuno na hinihiling ng ating demokratikong sistema at sa kaparehong konseptong umiiiral naman sa kamalayan ng ating mga kababayan. Gagamitin ng pagsusuring ito, bilang teoretikal na balangkas, ang isang uri ng antropolohikalna teorya at pamamaraan na kilala bilang “kognitibong antropolohiya”(cognitive anthropology.

  17. MimoSA: a system for minimotif annotation

    Directory of Open Access Journals (Sweden)

    Kundeti Vamsi

    2010-06-01

    Full Text Available Abstract Background Minimotifs are short peptide sequences within one protein, which are recognized by other proteins or molecules. While there are now several minimotif databases, they are incomplete. There are reports of many minimotifs in the primary literature, which have yet to be annotated, while entirely novel minimotifs continue to be published on a weekly basis. Our recently proposed function and sequence syntax for minimotifs enables us to build a general tool that will facilitate structured annotation and management of minimotif data from the biomedical literature. Results We have built the MimoSA application for minimotif annotation. The application supports management of the Minimotif Miner database, literature tracking, and annotation of new minimotifs. MimoSA enables the visualization, organization, selection and editing functions of minimotifs and their attributes in the MnM database. For the literature components, Mimosa provides paper status tracking and scoring of papers for annotation through a freely available machine learning approach, which is based on word correlation. The paper scoring algorithm is also available as a separate program, TextMine. Form-driven annotation of minimotif attributes enables entry of new minimotifs into the MnM database. Several supporting features increase the efficiency of annotation. The layered architecture of MimoSA allows for extensibility by separating the functions of paper scoring, minimotif visualization, and database management. MimoSA is readily adaptable to other annotation efforts that manually curate literature into a MySQL database. Conclusions MimoSA is an extensible application that facilitates minimotif annotation and integrates with the Minimotif Miner database. We have built MimoSA as an application that integrates dynamic abstract scoring with a high performance relational model of minimotif syntax. MimoSA's TextMine, an efficient paper-scoring algorithm, can be used to

  18. The JT-60SA Cryoplant Current Design Status

    Science.gov (United States)

    Henry, D.; Michel, F.; Roussel, P.; Reynaud, P.; Journeaux, J. Y.; Maréchal, J. L.; Balaguer, D.; Roux, C.; Matsukawa, M.; Yoshida, K.

    2008-03-01

    In the framework of the ITER Broader Approach, CEA is carrying out the procurement of the Cryogenic System to the JA-EU Satellite Tokamak JT-60SA, which should be operated in Japan at JAEA, Naka in 2014. According to the Conceptual Design Report, JT-60SA is to operate for periods of at least 6 months per year, with major shutdown periods in between for maintenance and further installation upgrades. For this operation scenario, the cryoplant and the cryodistribution have to cope with different heat loads which depend on the different JT-60SA operating states. The cryoplant consists of one 4.5 K refrigerator and one 80 K helium loop, each pre-cooled by LN2. These cryogenic subsystems have to operate simultaneously in order to remove the heat loads from the superconducting magnets, 80 K shields and the divertor cryopumps. The first part of this study is based on the Process Flow Diagram (PFD) and presents the current design status of the JT-60SA cryogenic system. The second part is dedicated to the analysis of the cryoplant normal operation modes including the regeneration mode of the divertor cryopumps. Thanks to this analysis, the architecture of the present PFD is proposed in order to match the technical specifications of the cryoplant with the JT-60SA operation requirements.

  19. Uma saúde pública molecular!?

    Directory of Open Access Journals (Sweden)

    Castiel Luis David

    1994-01-01

    Full Text Available As relações da Saúde Pública com a Genética Molecular são enfocadas. Para isto, discutese a noção de Saúde Pública e expressões correlatas, procurando estabelecer seu objeto de estudo e campo de práticas. Além disto, fazse uma breve descrição do precário panorama sanitário no nosso país, destacando a pequena efetividade social do papel atribuído ao sanitarista. Apresenta técnicas e conceitos, desenvolvidos pela Genética Molecular e sua relevância em Saúde Pública. O risco genético é discutido e comparado com a idéia de propensão hereditária, enfatizando aspectos epistemológicos e repercussões éticas. Considera-se a noção de expert e suas relações com o possível perfil do sanitarista para lidar com as questões postas pela Biologia Molecular/Genética Humana nos domínios da Saúde Pública. Por fim, a participação do Estado no estabelecimento das prioridades sociais em Saúde é discutida.

  20. Tungo sa Hardin ng Tao: “Si Bonifacio ang pinakauna, hindi lamang sa Pilipinas, kundi sa buong Indonesia, oo, sa buong Asia na nanggaling sa, at edukado bilang, proletaryado, na nag-organisa ng mga proletaryo.” ni Tan Malaka

    Directory of Open Access Journals (Sweden)

    Ramon Guillermo

    2013-06-01

    Full Text Available Salin ito ng sanaysay na “Ke Taman Manusia” (sinulat taong 1943 nakathang-isip ng Indones na lider komunista na si Tan Malaka o Ibrahimgelar Datuk Tan Malaka (1897-1949 hinggil sa isang “Taman Manusia”o “Hardin ng Tao” na itatayo ng darating na Republika ng Indonesia sahinaharap. Dahil sa futuristiko nitong perspektiba, maihahalintuladang obrang ito ni Tan Malaka sa sanaysay ni Jose Rizal na “Filipinasdentro de cien años” (Ang Pilipinas sa loob ng isang dantaon (1891.Galing ito sa napakalaking akdang pilosopikal ni Tan Malaka napinamagatang Madilog: Materialisme, Dialektika, Logika (1948(Larawan 1 at tila tumatayo bilang pansarang mga repleksyon nito(Magnis-Suseno, 2005, pp. 205-233. Ang akdang ito ay unanginilathala noong 1951 ng Terbitan Widjaya sa Jakarta.

  1. Gestion par projets et risques pour la santé psychologique au travail dans la nouvelle économie

    Directory of Open Access Journals (Sweden)

    Marie-Josée Legault

    2006-05-01

    Full Text Available Y a-t-il des problèmes de santé mentale propres au travail dans la nouvelle économie ? Quoiqu’on puisse constater que le modèle de demande psychologique - autonomie décisionnelle de Karasek et Theorell- trouve aussi son application dans les milieux de travail qui empruntent cette forme, on observe, en fait, des formes particulières de ces facteurs dans la forme d’organisation du travail propre à la gestion par projets. Assimilables à « l’hypersollicitation par le client » comme il a été repéré par Christophe Dejours, ces formes ont été observées lors d’une enquête menée récemment sur la conciliation entre la vie privée et la vie professionnelle dans sept organisations montréalaises. La recherche qualitative a recueilli en tout le discours de 88 répondants distribués également selon le sexe et exerçant des fonctions liées au génie informatique. Ces observations permettent d’envisager une nuance au modèle théorique de la santé mentale ci-haut mentionné, visant à tenir compte des effets délétères d’une très grande latitude décisionnelle assortie de très grandes responsabilités chez des travailleurs hautement qualifiés.Are there distinct mental health problems among workers in the new economy? Although we may observe that the psychological demand - decision latitude model of Karakek and Theorell is appropriate and also finds its application in this type of workplace, we also notice some particular forms that these factors take in the management-by-project work organization model. Akin to the so-called "client’s hyper-demanding activity" as identified by Christophe Dejours, these forms were observed during a recent field study about balancing work and family in seven Montreal organizations. The qualitative study collected data from 88 individual interviews of information technology engineers, evenly distributed by gender. These observations allow a nuance of the above-mentioned theoretical

  2. L’innovation et les réseaux sociaux : de nouvelles sociabilités pour une autre socialité ?

    OpenAIRE

    Pascal, Catherine

    2015-01-01

    Par cette contribution, nous désirons investir les approches spécifiques sur l’innovation qui interrogent le concept de réseau en créant ainsi une Science du réseau. Notre questionnement portera sur les nouvelles interactions créées sur Internet : le terme de « réseaux sociaux » est alors utilisé. Existe-t-il de nouvelles sociabilités qui constitueraient un champs de recherche épistémologique et empirique relevant d‘un croisement de méthodes ? S’agit-il d’une évolution sociale globale ou de c...

  3. La formation d’une nouvelle régulation sociale en Tchécoslovaquie : Cahiers du CEFRES N° 3f, Transition politique et transition économique dans les pays d'Europe centrale et orientale

    OpenAIRE

    Večerník, Jiří

    1994-01-01

    International audience Dans cet article, l’auteur s’intéresse à l’instauration d’une nouvelle forme de protection sociale en Tchécoslovaquie, parallèlement aux réformes économiques. Il s’intéresse ici aux problèmes liés à la mise en place de nouvelles régulations sociales, en posant la question du rôle de l’héritage du passé, et en analysant les nouveaux défis lancés par l’Europe et le nouvel Etat tchécoslovaque démocratique. Enfin, il se penche sur les adaptations et les transformations d...

  4. Le système de l'harmonie de Rameau dans sa correspondance avec d'Alembert et Rousseau

    Directory of Open Access Journals (Sweden)

    Stefanović Ana M.

    2002-01-01

    Full Text Available (francuski L'article examine la correspondance polémique de Rameau avec d'Alembert et Rousseau, entretenue dans la sixième décénie du XVIIIe siècle. Le système de l'harmonie de Rameau y est affronté à deux défis contradictoires: d'un côté, à la provocation d'absolutisation du système venant de son intériorité-même, et de l'autre, à une nouvelle conception de l'autonomie musicale, conçue sur le geste anarchique et destructif envers lui. Tandis que, de la polémique avec d'Alembert, le système vient de ressortir assuré et renforcé, soutenant la suprématie de la musique dans le champ théorique, la polémique avec Rousseau démontre que l'autonomie scientifique n'entraîne pas de soi l'isolation de la musique dans le domaine esthétique. Fondé sur le réseau cohérent de ses propres règles, le système musical est apte de se plier, de se modifier sous l'influence de ce qui lui est "extérieur": du sens contenu dans des énoncés linguistiques. L'idée de représentation musicale est alors modifiée dans la direction d'une réconcilliation possible de la raison (cartésienne et de l'imagination créatrice, du général et du particulier, de la norme et de l'individualité, dans la mesure où le système musical devenant analogue au système linguistique, en tant que "langue en action" participe chaque fois dans l'événement de sa propre création.

  5. SA8000标准的来历

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    社会道德责任标准Social Accoutability 8000或简称SA8000。自1997年问世以来,受到了公众极大的关注,在美欧工商界引起了强烈反响。专家们认为,SA8000是ISO9000、ISO14000之后出现的又一个重要的国际性标准,并迟早会转化为ISO标准;通过SA8000认证将成为国际市场竞争中的又一重要武器。有远见的组织家应未

  6. Le CERN accueille la 17ème Conférence sur la technologie des aimants

    CERN Multimedia

    CERN Press Office. Geneva

    2001-01-01

    Modern particle physics depends upon electromagnets, using them to guide and focus elementary particles like protons and electrons and also ions in accelerators and to analyse the results of their interactions in detectors. Systems consisting of thousands of magnets constitute the backbone of CERN accelerators. The Large Hadron Collider, an accelerator presently under construction at CERN and which will bring protons or ions into head-on collisions at higher energies than ever achieved before and allow scientists to recreate the conditions that existed just after the 'Big Bang', will be equipped essentially with superconducting magnets.

  7. Le CERN accueille le dernier élément de son aimant géant

    CERN Multimedia

    Tesnier, Grégory

    2005-01-01

    The giant machinery that will take place in the future particle accelerator LHC of CERN in 2007 grows rich of a new part. The last module of the superconducting magnet of the CMS detector completes a unit which weighs 50 tons and is six metres in diameter

  8. For-LySa: UML for Authentication Analysis

    DEFF Research Database (Denmark)

    Buchholtz, Mikael; Montangero, Carlo; Perrone, Lara;

    2005-01-01

    The DEGAS project aims at enriching standard UML-centred development environments in such a way that the developers of global applications can exploit automated formal analyses with minimal overhead. In this paper, we present For-LySa, an instantiation of the DEGAS approach for authentication...... analysis, which exploits an existing analysis tool developed for the process calculus LySa. We discuss what information is needed for the analysis, and how to build the UML model of an authentication protocol in such a way that the needed information can be extracted from the model. We then present our...

  9. Pesquisa qualitativa, cartografia e saúde: conexões

    OpenAIRE

    Sabrina Helena Ferigato; Sérgio Resende Carvalho

    2011-01-01

    Trata-se de uma revisão bibliográfica para explorar as fronteiras entre a produção de conhecimento em saúde, as pesquisas qualitativas e a cartografia. Iniciamos com uma breve retrospectiva sobre a construção histórica das pesquisas qualitativas em geral, para, posteriormente, apresentarmos a investigação cartográfica como método possível para as pesquisas qualitativas em saúde. Uma vez apresentados os aspectos conceituais desse modo de produção de conhecimento, identificamos suas potencialid...

  10. Product policy of SC Electrecord S.A.

    Directory of Open Access Journals (Sweden)

    Ph. D. Candidate Cristina Andreescu (Manolache

    2009-12-01

    Full Text Available The global brand has the advantage of the scale economy, facilitates the company image and prestige and sometimes benefits even from its origin country effect. Its use is quite difficult (the semantic variations can impede the use of the same brand. The international brands act as a restriction against standardisation (the product should not be differentiated as there are internationally accepted and recognized brands. This paper makes an overview description of the general market environment, but also of the arket environment of SC ELECTRECORD S.A.; it underlines the product characteristics as well as the commercial diagnosis within SC ELECTRECORD S.A.

  11. Le programme ARTEMIS : nouvel outil pour la datation radiocarbone AMS (Spectromètre de Masse par Accélérateur et nouvelles problématiques

    Directory of Open Access Journals (Sweden)

    Cyrille Billard

    2012-04-01

    Full Text Available La mise en route du nouvel équipement ARTEMIS (Accélérateur pour la Recherche en sciences de la Terre, Environnement, Muséologie, Implanté à Saclay à partir de 2004 ouvre de nouvelles perspectives scientifiques et conduit à de nouvelles procédures de soumission des échantillons destinés à une datation 14C. Le MCC dispose aujourd’hui de droits alloués aux services régionaux de l'archéologie, services du ministère de la Culture, confrontés à ce type de demandes (musées, monuments historiques. Il impose désormais une nouvelle démarche de programmation scientifique des datations, associant une analyse critique des demandes.Since 2004, the availability at Saclay of a new ARTEMIS installation (Accélérateur pour la Recherche en sciences de la Terre, Environnement, Muséologie has opened new scientific perspectives and led to new procedures for submitting samples for carbon-14 dating. The French Ministry of Culture has the possibility of using this tool for radiocarbon dating at the request of its regional archaeological services or other services, such as museums and the historic monuments administration. This use now implies a new approach to the scientific planning for dating problems, associated with a critical analysis of the requests.

  12. La “nouvelle consommation” et les transformations des paysages urbains à la lumière de l’ouverture économique : l’exemple de Damas

    Directory of Open Access Journals (Sweden)

    Leïla Vignal

    2012-02-01

    Full Text Available Cet article propose une analyse géographique des nouvelles formes de consommation qui commencent à se développer en Syrie dans le secteur des biens de consommation courants. Effet de l’insertion de la région dans la mondialisation ou résultat de la timide ouverture économique syrienne ? La “nouvelle consommation” est en train de transformer les paysages urbains, et en particulier ceux de Damas. Elle requalifie les centralités intra-urbaines qui sont la vitrine de cette nouvelle consommation, elle crée de nouveaux réseaux de distribution destinés à désenclaver l’espace de la consommation, elle transforme la base industrielle damascène. This article presents a geographic analysis of emerging forms of consumption and consumer goods in Syria, and the impact of this development on urban landscapes, particularly in Damascus. Whether driven by a regional process of economic globalisation or by cautious Syrian economic overture, the new forms of consumption are transforming traditional patterns of urban centrality, creating new public spaces for retail and consumption, and introducing a shift in Damascus’ industrial base.

  13. Mga Kuwento-Kuwento ng Baliw: Lihis na Pagkilos sa Mga Maikling-Kuwentong Tagalog

    Directory of Open Access Journals (Sweden)

    Diana Ziganay

    1990-12-01

    Full Text Available Ang sulating ito ay nalikha upang magbigay ng isang pagsusuri at pagtatalakay sa pagbuo ng konsepto ng abnormalidad o kakaibang kilos o pananaw buhat sa mga piling uri ng panitikang Pilipinong naisulat sa wikang Ingles noong ika-1900 hanggang 1945. Pag-uukulan ng pansin dito ang panahon at kalagayang binanggit, ang mga suliraning binanggit, ang maga suliranin ng pagbuo ng panitikang Pilipino sa Ingles, at ang daloy ng kaisipan ng mga manunulat na may kaugnayan sa pag-unawa ng konsepto ng abnormalidad na sumasalamin sa ilang mga piling sulatin, tuwiran man o di tuwiran.

  14. Print Culture and the New Maritime Frontier in Rangoon and Penang Culture de l’imprimé et nouvelle frontière maritime à Rangoon et Penang

    Directory of Open Access Journals (Sweden)

    Su Lin Lewis

    2012-10-01

    Full Text Available From the mid-19th century, vast improvements in steamship and communication technology created an interlinked network of port-cities in the Indian Ocean and maritime Asia. Though Rangoon and Penang had starkly different relationships to colonial rule, they shared a lineage as multi-ethnic ports where various communities had existed side-by-side for centuries. The advent of the Victorian era fostered new class and racial divisions between them, yet also created a new feuilleton culture in the port-city with the mushrooming of newspapers, books, and a new reading public. Diverse ethnic and linguistic communities sought platforms to articulate their concerns and inform themselves of the affairs of the world, and their place within it. Burmese in Rangoon, imbued with a renewed sense of cultural pride, absorbed the rising tide of anticolonialism nationalism echoing throughout the world. Penangites transformed their society using the liberal, cosmopolitan tenants of imperial citizenship to make political and cultural claims for a multi-ethnic society. The vibrant, outward-looking atmosphere of the colonial port-city as a node of information and cultural exchange made Penang and Rangoon the intellectual staging grounds for new visions of the nation.À compter du milieu du xixe siècle, d’importantes améliorations dans la navigation à vapeur et les technologies des communications ont créé un réseau de villes portuaires dans l’Océan indien et l’Asie maritime. Même si Rangoon et Penang avaient des relations divergentes avec la puissance coloniale, elles participaient d’un type identique comme ports où cohabitaient depuis des siècles des communautés d’ethnies différentes. L’ère victorienne conduisit à de nouvelles divisions sociales et ethniques, mais suscita dans la ville portuaire une nouvelle culture littéraire avec le foisonnement des journaux, des livres et un nouveau lectorat. Les communautés ethniques et linguistiques

  15. L’inventaire des lieux de mémoire de la Nouvelle-France au Québec

    Directory of Open Access Journals (Sweden)

    Daniel Lauzon

    2012-04-01

    Full Text Available Un projet d’inventaire du patrimoine immobilier issu de l’époque de la Nouvelle–France a été amorcé en 1998 par le ministère de la Culture et des Communications du Québec, à l’instigation de la Commission franco–québécoise des lieux de mémoire communs. L’article présente les enjeux conceptuels d’un projet pilote qui explore des axes novateurs en terme d’inventaire, que ce soit sur le plan des fondements scientifiques (conception élargie du patrimoine, mise en relation des lieux et phénomènes historiques, de la réalisation (une collaboration internationale Québec–France ou de sa diffusion (utilisation des technologies de l’information.In 1998, the Ministère de la Culture et des Communications du Québec initiated an inventory of architectural and archaeological heritage from the New France period at the instigation of the Commission franco–québécoise des lieux de mémoire communs. This article describes the conceptual issues that arose in the course of a pilot project aimed at exploring innovative approaches to inventory work, be they related to its scientific bases (broader concept of heritage, relationship between historic sites and historic events, realization (international collaboration between Québec and France or the dissemination of its results (use of information technology.

  16. SA8000认证及相关费用%General analysis of SA8000 authentication and it's relevant fees

    Institute of Scientific and Technical Information of China (English)

    李少芬; 张琦

    2005-01-01

    SA8000标准推行以来,中国已获得认证的企业多数是应进口商要求认证的,导致SA8000标准认证推行困难的原因较多,但其中一个不容忽视的原因是认证费及相关费用过高,特别是相关费用过高,使得企业无力承担,因而大多中小企业不愿主动认证.

  17. Du « modèle » de développement économique à une nouvelle forme de gouvernance métropolitaine ?

    Directory of Open Access Journals (Sweden)

    Ludovic Halbert

    2007-10-01

    Full Text Available Entre mondialisation économique et diffusion des Nouvelles Technologies de l’Information et de Communication, la région métropolitaine de Bangalore connaît depuis une quinzaine d’années d’importantes mutations qui en font un laboratoire remarquable pour la communauté scientifique. Après avoir montré comment Bangalore est entrée dans une division internationale des tâches de production abstraite (économie de l’information, cet article analyse les transformations de la structure productive, de la géographie métropolitaine, des modes de vie et enfin de la manière dont la région urbaine est développée et aménagée. L’essor d’une classe moyenne enrichie et d’une élite économique encourage une convergence d’intérêts avec certains élus de l’Etat fédéré pour promouvoir une métropole « internationale » suivant un « modèle » d’urbanisation en enclave. On observe en bout de chaîne la formulation d’une nouvelle forme de gouvernance métropolitaine.During the last fifteen years at least, both globalisation and ICTs have favoured a dramatic transformation of the Bangalore metropolitan region which has thus become a laboratory for the scientific community. This paper first considers the determinants of these changes, focusing for instance on the international division of « abstract » production activities (information economy before moving to the analysis of changes in the economic structure, in the regional geography and last in the way the metropolitan region is developed and planned. The upcoming of both a middle-class and an economic elite resulting from global changes met some State policy-makers goals into promoting an « international »  metropolis following the « model » of an enclave urbanisation. This goes as far as to formulate a new form of metropolitan governance.

  18. Promoção da saúde, qualidade de vida e iniquidade em saúde: reflexões para a saúde pública.

    OpenAIRE

    Aline Rodrigues de ALMEIDA; Filipe Tadeu Santanna ATHAYDE

    2016-01-01

    A ideia de promover saúde tem se tornado uma energia fundamental no movimento de saúde coletiva, no qual saúde é um fenômeno social e marcado por iniquidades. Este trabalho teve como objetivo compreender as relações entre promoção da saúde e iniquidades de acesso e assistência em saúde, identificandoos entraves para uma prática equânime da saúde pública com ênfase à qualidade de vida. Os diferentes perfis de doença e suas mediações sociais ultrapassam os estudos de variação biológica e incorp...

  19. [Kas sa Tammsaaret oled lugenud? Kirjanduslik eluloovestlus Helga Nõuga

    Index Scriptorium Estoniae

    2015-01-01

    Tutvustus: Kas sa Tammsaaret oled lugenud? : kirjanduslik eluloovestlus Helga Nõuga : [pühendatud Helga Nõu 80. sünnipäevale] / koostaja Rutt Hinrikus. Tartu : Eesti Kirjandusmuuseumi Teaduskirjastus, 2014 ; Helga Nõu. Valetaja : mälestused, tõeotsimised. Tallinn : Eesti Ajalehed, 2011

  20. Fonoaudiologia em saúde pública

    Directory of Open Access Journals (Sweden)

    Regina M. Freire

    1992-06-01

    Full Text Available Objetivou-se obter o entendimento das funções do fonoaudiólogo enquanto profissional da saúde. Discutem-se as dificuldades ligadas à implantação de um serviço novo, estranho às Unidades Básicas de Saúde. A seguir, analisa-se a demanda pelo serviço de Fonoaudiologia em postos de saúde, e verifica-se que 32% da população que busca esse serviço está em idade escolar e vem encaminhada pelas escolas, com queixa de problemas de aprendizagem. Uma aproximação maior dessas crianças, através do atendimento fonoaudiológico, delineia uma outra realidade: a de que não se pode considerar como distúrbio/desvio/problema/patologia marcas gráficas que se constituem como indícios do choque entre o processo de letramento e o de alfabetização. Entendendo a problemática do ponto de vista da saúde pública, propõe-se um programa de atendimento ao professor, cujo objetivo é o esclarecimento da escola com relação ao seu papel de co-construtora do processo de letramento da criança, devolvendo-lhe a responsabilidade pelo sucesso e/ou fracasso da alfabetização.

  1. KELEMBAGAAN DAN STRATEGI PENINGKATAN DAYA SAING KOMODITAS CABAI KAPUPATEN GARUT

    Directory of Open Access Journals (Sweden)

    Silmi Tsurayya

    2015-03-01

    Full Text Available The objectives of this study were to identify supply chains, analyze the institutions, formulate strategies for competitiveness enhancement, design competitiveness enhancement model, and determine the main strategies in competitiveness enhancement of chili pepper in Garut District. This study used primary data (observations, interviews, and questionnaires and secondary data (literature study. The data were processed and analyzed by Descriptive Analysis, SWOT Analysis, the House Model, and Pairwise Comparison. The results of this study showed that: 1 there were 6 supply chain structures in chili pepper distribution; 2 the major institutional sectors contributed to competitiveness enhancement of chili pepper including public sector, voluntary sector, and private sector; 3 SWOT Analysis obtained 15 alternative strategies; 4 the House Model as competitiveness enhancement model had 3 pillars consisting of products, human resource, and institutional and marketing; 5 the main strategies in competitiveness enhancement of chili pepper included Increase in the number of productions, Market expansion, and Partnership Strengthening and development. The managerial implications of the study suggest: 1 land expansion and plant arrangement pattern to ensure continuity of production quantities; 2 Optimization of the role of Agribusiness Sub-Terminal as the marketing institution; and 3 Maximization in the government’s role in facilitating farmer groups with associations or corporations.Keywords: institutional, the house model, competitiveness, chili, SWOTABSTRAKPenelitian ini bertujuan mengidentifikasi rantai pasok, menganalisis kelembagaan, merumuskan strategi peningkatan daya saing, merancang model peningkatan daya saing, dan menentukan strategi utama dalam peningkatan daya saing  komoditas cabai di Kabupaten Garut. Data yang digunakan terdiri dari data primer (observasi, wawancara, dan kuesioner dan data sekunder (studi literatur. Metode pengolahan dan

  2. Promoção da saúde, qualidade de vida e iniquidade em saúde: reflexões para a saúde pública.

    Directory of Open Access Journals (Sweden)

    Aline Rodrigues de ALMEIDA

    2016-01-01

    Full Text Available A ideia de promover saúde tem se tornado uma energia fundamental no movimento de saúde coletiva, no qual saúde é um fenômeno social e marcado por iniquidades. Este trabalho teve como objetivo compreender as relações entre promoção da saúde e iniquidades de acesso e assistência em saúde, identificandoos entraves para uma prática equânime da saúde pública com ênfase à qualidade de vida. Os diferentes perfis de doença e suas mediações sociais ultrapassam os estudos de variação biológica e incorpora o foco na dimensão social das vulnerabilidades. Para promover saúde no Brasil, é indissociável do enfrentamento de uma realidade de iniquidades históricas de grandes proporções que impõem desafios cotidianos não apenas ao setor de saúde, mas a todos aqueles que constroem políticas públicas. A qualidade de vida depende da satisfação das necessidades básicas de todos os cidadãos, propondo uma gestão baseada na solidariedade social, uma visão holística dos problemas e a redução das iniquidades. A promoção da saúde em um país tão desigual como o Brasil propõe um desafio constante aos atores envolvidos no sistema de saúde. A compreensão das iniquidades em saúde para estabelecer uma assistência holística é um processo difícil, mas extremamente relevante para a saúde pública.

  3. WRKY Transcription Factors Involved in Activation of SA Biosynthesis Genes

    Directory of Open Access Journals (Sweden)

    Bol John F

    2011-05-01

    Full Text Available Abstract Background Increased defense against a variety of pathogens in plants is achieved through activation of a mechanism known as systemic acquired resistance (SAR. The broad-spectrum resistance brought about by SAR is mediated through salicylic acid (SA. An important step in SA biosynthesis in Arabidopsis is the conversion of chorismate to isochorismate through the action of isochorismate synthase, encoded by the ICS1 gene. Also AVRPPHB SUSCEPTIBLE 3 (PBS3 plays an important role in SA metabolism, as pbs3 mutants accumulate drastically reduced levels of SA-glucoside, a putative storage form of SA. Bioinformatics analysis previously performed by us identified WRKY28 and WRKY46 as possible regulators of ICS1 and PBS3. Results Expression studies with ICS1 promoter::β-glucuronidase (GUS genes in Arabidopsis thaliana protoplasts cotransfected with 35S::WRKY28 showed that over expression of WRKY28 resulted in a strong increase in GUS expression. Moreover, qRT-PCR analyses indicated that the endogenous ICS1 and PBS3 genes were highly expressed in protoplasts overexpressing WRKY28 or WRKY46, respectively. Electrophoretic mobility shift assays indentified potential WRKY28 binding sites in the ICS1 promoter, positioned -445 and -460 base pairs upstream of the transcription start site. Mutation of these sites in protoplast transactivation assays showed that these binding sites are functionally important for activation of the ICS1 promoter. Chromatin immunoprecipitation assays with haemagglutinin-epitope-tagged WRKY28 showed that the region of the ICS1 promoter containing the binding sites at -445 and -460 was highly enriched in the immunoprecipitated DNA. Conclusions The results obtained here confirm results from our multiple microarray co-expression analyses indicating that WRKY28 and WRKY46 are transcriptional activators of ICS1 and PBS3, respectively, and support this in silico screening as a powerful tool for identifying new components of stress

  4. La catalyse d'épuration des gaz d'échappement automobiles. Situation actuelle et nouvelles orientations Catalytic Automotive Exhaust Gas Depollution. Present Status and New Trends

    Directory of Open Access Journals (Sweden)

    Prigent M.

    2006-11-01

    Full Text Available Cet article passe en revue les différents systèmes catalytiques de post-traitement utilisés actuellement sur la plupart des automobiles pour limiter leurs rejets de polluants. Les systèmes sont différenciés par leur mode de fonctionnement, le type de moteur à dépolluer (deux-temps, quatre-temps, diesel ou essence ou par leur mode de réalisation. Les nouvelles orientations, prévues pour respecter les futures réglementations antipollution, sont également décrites. On montre que certains véhicules prototypes, équipés de moteurs à combustion interne, sont capables d'avoir des émissions très proches de zéro tout comme les véhicules électriques. A review is made of the various types of exhaust gas aftertreatment systems presently used on most vehicles to reduce pollutant emissions. The systems are differentiated by their mode of action, according to the engine type to be depolluted (two-stroke, four-stroke, diesel or spark-ignition, and by their type of make-up. The major developments foreseen in the future, in view of compliance with the new legislations, are described. It is shown that some prototype vehicles with internal combustion engines are able to emit pollutant quantities really close to zero, such as electric cars.

  5. Zitkala-Sa and the Problem of Regionalism: Nations, Narratives, and Critical Traditions

    Science.gov (United States)

    Totten, Gary

    2005-01-01

    Although Yankton Sioux writer Zitkala-Sa (Gertrude Bonnin, 1876-1938) was, as P. Jane Hafen notes, "virtually unknown for many decades," much critical work has appeared since Dexter Fisher's 1979 article,"Zitkala-Sa: Evolution of a Writer." Some critics desiring to bring Zitkala-Sa into the conversation about turn-of-the-century American women…

  6. Aspectos relevantes sobre tuberculose para profissionais de saúde

    Directory of Open Access Journals (Sweden)

    Alexandre Daronco

    2012-01-01

    Full Text Available A Tuberculose (TB é uma patologia infectocontagiosa com clínica ampla cujo agentecausador é o Mycobacterium tuberculosis (Bacilo de Koch, uma micobactéria aeróbia estrita. Apesar de tratar-se dedoença antiga, que acomete seres humanos há séculos, sendo uma importante causa de morte no mundo inteiro,diferentes pesquisas do Ministério da Saúde apontam números preocupantes no tocante a novos casos. Materiais eMétodos: O presente artigo de revisão procura, de forma objetiva e clara, explicitar os principais aspectos de interessepara profissionais de saúde no tocante a Tuberculose doença. O artigo divide-se em tópicos: Defi nição, Sintomatologia,Diagnóstico, Tratamento, Multirresistência, Profi laxia, Formas de Contágio e Formas de Prevenção. Foram utilizadasreferências atuais sobre o tema, incluindo Manuais, Guidelines e Artigos científicos diversos de bases de dados comoUp to Date e Science Direct. Discussão: Sinais e sintomas da doença aumentam o grau de suspeição da mesma, oque torna o pedido de exames para confirmação da infecção dentro de tempo hábil para instituição da terapêuticaadequada. Assim como diagnóstico e tratamento, medidas para evitar o contágio, em serviços de saúde, locaiscom aglomerações humanas e em residências, são de fundamental importância no combate a tuberculose. Osprofissionais de saúde devem atentar para possíveis casos de resistência aos fármacos e as indicações de profilaxia,pois tais variáveis são de extrema relevância no controle da disseminação da doença. Conclusão: Por tratar-se dedoença infecciosa que pode acometer todas as classes sociais, além de possuir formas diferentes de acometimento,o conhecimento básico acerca da Tuberculose é deveras imprescindível em serviços de saúde, desde a atençãoprimária até os centros de saúde com alta tecnologia.

  7. [Synergistion mechanism of exogenous Ca2+ to SA-induced resistance to Botrytis cinerea in tomato].

    Science.gov (United States)

    Li, Lin-lin; Li, Tian-lai; Jiang, Guo-bin; Jin, Hua; Zou, Ji-xiang

    2015-11-01

    In this study, we investigated the effect of exogenous calcium and salicylic acid (SA) on Botrytis cinerea resistance in tomato seedlings. We treated a tomato strain susceptible to Botrytis cinerea with foliar spraying of water, SA, SA+CaCl2 and SA+EGTA (Ca2+ chelating agent) for one to five days. During the treatment, leaves were collected to analyze the reactive oxygen species (ROS) content, phenylalanine ammonia lyase (PAL) activity, chintase and β-1,3-glucanase levels, and the expression of pathogenesis related protein 1, 2, 3 (PR1, PR2, PR3). Three days after infection, the disease index was 74.8 in control plants, and 46.9, 38.5 and 70.3 in SA, SA+Ca and SA+ EGTA treated plants, respectively. SA treatment significantly increased ROS leaf accumulation, and activities of PAL, chintase and β-1,3-glucanase. These values were further enhanced in SA+Ca treated plants, but decreased in SA+EGTA treated plants. Application of SA significantly increased the expression levels of PR1, PR2a and PR3b, which were further elevated by the combination treatment with Ca2+. These effects were counteracted by the combination treatment of SA and EGTA. The transcription levels of PR2b and PR3a were up-regulated by 1-2 folds, and PR1, 2a and 3b by 2-5 folds in SA- and SA+Ca-treated plants relative to control. These data suggested that application of Ca2+ could synergistically increase SA-induced resistance to B. cinerea. The resistance was associated with ROS accumulation, therefore the increase in resistance might be through ROS ability to increase the activity of defense-related enzymes and expression levels of PR1, PR2a and PR3b. PMID:26915208

  8. O gênero masculino e os cuidados de saúde: a experiência de homens de um centro de saúde

    OpenAIRE

    Daniele Natália Pacharone Bertolini; Janete Pessuto Simonetti

    2014-01-01

    Compreender como os homens de um Centro de Saúde se comportam quanto aos cuidados com a saúde. Estudo qualitativo, realizado em um Centro de Saúde Escola que selecionou por conveniência e entrevistou 15 indivíduos do gênero masculino, adultos e organizou os dados conforme o Discurso do Sujeito Coletivo. Emergiram quatro ideias centrais que retratam os motivos para procurar o serviço, problemas de saúde, atitudes diante desses problemas e participação nas atividades da unidade. Esses indivíduo...

  9. The interdisciplinarity experienced in the PET- Saúde program A interdisciplinaridade vivenciada no PET-Saúde

    Directory of Open Access Journals (Sweden)

    Sueli Moreira Pirolo

    2010-01-01

    Full Text Available Introduction: The incorporation of the oral health team in the Family Health Strategy (ESF, in 2000, enabled the adoption of a more active attitude of Primary Health Care in this field, in as much as oral health consists of an inseparable and integral part of the individual’s health. The interaction of health professionals becomes possible through policies like “PET-Saúde” which promotes the professional formation articulated with the ESF professionals as well as the process of integration of teaching, service and community in the perspective of interdisciplinarity. Objective: To report the experience of students during an interdisciplinary research. Description of the experience: This report was experienced in “PET-Saúde” of the Faculty of Medicine of Marília, at the “Man’s Health” subproject aiming at elaborating and validating a data collection instrument through Delphi Technique in order to help the health care team to detect early dental problems because of the damaged oral health pattern of the age group between 35 and 44 in Brazil. The members of this study are: medical and nursing students, a dentist preceptor and a nursing tutor. For the educational activities, the active methodology of teaching-learning was used. Conclusion: The reflexive actions, the moments for discussions provided the development of scientific investigation. The approximation of the process of validation through Delphi Technique also allowed the expansion of multidisciplinary knowledge on oral health. This experience made it possible to qualify the academic-professional formation on the interdisciplinary approach, and it’s important to strengthen the interaction among professionals and the articulation of health actions.Introdução: A incorporação da equipe de saúde bucal na Estratégia de Saúde da Família (ESF, em 2000, possibilitou a adoção de uma postura mais ativa de atenção primária nesta área, visto que a saúde bucal consiste

  10. Mga Kuwento-Kuwento ng Baliw: Lihis na Pagkilos sa Mga Maikling-Kuwentong Tagalog

    OpenAIRE

    Diana Ziganay; Ma. Trinidad Crisanto

    1990-01-01

    Ang sulating ito ay nalikha upang magbigay ng isang pagsusuri at pagtatalakay sa pagbuo ng konsepto ng abnormalidad o kakaibang kilos o pananaw buhat sa mga piling uri ng panitikang Pilipinong naisulat sa wikang Ingles noong ika-1900 hanggang 1945. Pag-uukulan ng pansin dito ang panahon at kalagayang binanggit, ang mga suliraning binanggit, ang maga suliranin ng pagbuo ng panitikang Pilipino sa Ingles, at ang daloy ng kaisipan ng mga manunulat na may kaugnayan sa pag-unawa ng konsepto ng abno...

  11. Characterization of the interaction between the cohesin subunits Rad21 and SA1/2.

    Directory of Open Access Journals (Sweden)

    Nenggang Zhang

    Full Text Available The cohesin complex is responsible for the fidelity of chromosomal segregation during mitosis. It consists of four core subunits, namely Rad21/Mcd1/Scc1, Smc1, Smc3, and one of the yeast Scc3 orthologs SA1 or SA2. Sister chromatid cohesion is generated during DNA replication and maintained until the onset of anaphase. Among the many proposed models of the cohesin complex, the 'core' cohesin subunits Smc1, Smc3, and Rad21 are almost universally displayed as tripartite ring. However, other than its supportive role in the cohesin ring, little is known about the fourth core subunit SA1/SA2. To gain deeper insight into the function of SA1/SA2 in the cohesin complex, we have mapped the interactive regions of SA2 and Rad21 in vitro and ex vivo. Whereas SA2 interacts with Rad21 through a broad region (301-750 aa, Rad21 binds to SA proteins through two SA-binding motifs on Rad21, namely N-terminal (NT and middle part (MP SA-binding motif, located at 60-81 aa of the N-terminus and 383-392 aa of the MP of Rad21, respectively. The MP SA-binding motif is a 10 amino acid, α-helical motif. Deletion of these 10 amino acids or mutation of three conserved amino acids (L(385, F(389, and T(390 in this α-helical motif significantly hinders Rad21 from physically interacting with SA1/2. Besides the MP SA-binding motif, the NT SA-binding motif is also important for SA1/2 interaction. Although mutations on both SA-binding motifs disrupt Rad21-SA1/2 interaction, they had no apparent effect on the Smc1-Smc3-Rad21 interaction. However, the Rad21-Rad21 dimerization was reduced by the mutations, indicating potential involvement of the two SA-binding motifs in the formation of the two-ring handcuff for chromosomal cohesion. Furthermore, mutant Rad21 proteins failed to significantly rescue precocious chromosome separation caused by depletion of endogenous Rad21 in mitotic cells, further indicating the physiological significance of the two SA-binding motifs of Rad21.

  12. Design and manufacturing of JT-60SA vacuum vessel

    International Nuclear Information System (INIS)

    JT-60 is planned to be upgraded to JT-60SA tokamak machine with fully superconducting coils, which is a project of the JA-EU satellite tokamak program under both Broader Approach program and Japanese domestic program. The JT-60SA vacuum vessel (VV) has a D-shape poloidal cross section and a toroidal configuration with 10o facet segmented in toroidal direction. The material of the VV is 316L stainless steel with low cobalt content of o upper half of the VV have been performed to study the manufacturing procedure. After the confirmation of the quality of the mock-up, manufacturing of the actual VV started in November 2009.

  13. Konflikter mellan aktivt religiösa elever och sekulariserade

    OpenAIRE

    Andersson, Bo

    2002-01-01

    Man kan inte säga att en konflikt mellan religiösa elever och sekulariserade är svårare än en vanlig konflikt. En konflikt är en konflikt som alltid måste lösas. Religionen är en ingrediens i konflikten. Ofta ligger svårigheten i att avgöra om det är en kulturell eller en religiös konflikt.

  14. Saúl Sánchez: un artista de ciudad

    Directory of Open Access Journals (Sweden)

    Jaime Cerón

    2010-04-01

    Full Text Available El artículo aborda la relación entre el arte y la ciudad, tomando como base de análisis el conjunto de la obra del artista bogotano Saúl Sánchez, particularmente sus pinturas relacionadas con manifestaciones urbanas, como el grafiti. De la mano de sus obras se vislumbran las proximidades y distancias entre el arte y las prácticas culturales urbanas.

  15. Why SA Can Beat the Exponential Explosion in Heuristic Search

    Institute of Scientific and Technical Information of China (English)

    1990-01-01

    In tree(or graph)search,most algorithms mainly use the local heuristic information of each individual node.But in he statistical heuristic search algorithms the global information about subtrees is usesd effecively so that the computational complexity is greatly reduced.In this paper the problem of how the global information can be extracted from the local one is discussed.Some features of SA are also concerned.

  16. Using SA508/533 for the HTGR Vessel Material

    Energy Technology Data Exchange (ETDEWEB)

    Larry Demick

    2012-06-01

    This paper examines the influence of High Temperature Gas-cooled Reactor (HTGR) module power rating and normal operating temperatures on the use of SA508/533 material for the HTGR vessel system with emphasis on the calculated times at elevated temperatures approaching or exceeding ASME Code Service Limits (Levels B&C) to which the reactor pressure vessel could be exposed during postulated pressurized and depressurized conduction cooldown events over its design lifetime.

  17. Eventos de massa, desastres e Saúde Pública

    Directory of Open Access Journals (Sweden)

    Camilla Figueiredo de Castro

    2014-09-01

    Full Text Available O Brasil tem sediado eventos de massa (EM e seus participantes estão sujeitos a riscos à saúde. Objetivou-se sistematizar as principais relações, de interesse da Saúde Pública, entre eventos de massa e ocorrência de desastres. Foram realizadas três estratégias metodológicas: revisão da literatura de EM, com busca sistemática, sistematização das principais informações sobre EM e seleção e sistematização das Referências que tratavam do tema desastre em suas palavras-chave, título ou Resumo. Foram selecionadas 28 Referências sobre EM, a maioria artigo científico, revisão de literatura, de 2012 e de natureza esportiva. Os principais assuntos abordados foram sistemas de vigilância e planejamento dos EM. Evidenciou-se a pouca informação analítica sobre os EM, bem como a importância de eventos não transmissíveis para a ocorrência de desastres, com destaque aos relacionados à multidão. O risco de desastres deve ser considerado no planejamento dos EM, para aumentar a capacidade de resposta considerando áreas estratégicas como: emergência médica, vigilância de doenças transmissíveis e vetores, segurança alimentar e dos serviços de saúde, saúde ambiental e laboratório. Ressalta-se a importância de pesquisas analíticas e de registro das experiências relacionadas aos EM, para a redução de risco de desastres.

  18. Equity Valuation Research Nestlé S.A.

    OpenAIRE

    Pereira, Sebastião d'Orey Colares

    2016-01-01

    This dissertation focuses on the Equity Valuation of Nestlé S.A., the world's biggest food company. In a period of economic unpredictability, Nestlé has been able to continue its trend of sustainable growth, even facing challenges such as the currency volatility, which is particularly relevant to a multinational Swiss company that reports in its national currency, the Swiss Franc. The main objective is to provide an investment recommendation, based on the estimated equity value...

  19. Equity valuation of Altri, SGPS, S.A.

    OpenAIRE

    Valério, Francisco Manuel Jorge do Nascimento

    2014-01-01

    The purpose of this thesis was to make a valuation of the company Altri, SGPS, S.A., a Portuguese company, which is listed on the Euronext Lisbon stock exchange and a member of its main index, the PSI-20, and operates in the pulp industry. To perform the company valuation, the different valuation methodologies were analysed, and taking into consideration the advantages and limitations of each. To this specific case the most appropriate methods were chosen. The company’s hist...

  20. Equity valuation : DIA – Distribuidora Internacional de Alimentacion, SA

    OpenAIRE

    Alves, André Rodrigues

    2016-01-01

    The purpose of this Master thesis is to demonstrate a plausible and effective valuation for DIA, SA. This is a very well-known Spanish retailer, mainly focused in grocery and domestic products. The performed valuation aims to evaluate the company in the 1st January, 2016. In order to complete this Thesis, all the materials and subjects learned during this master program played a fundamental role, especially “Firm Valuation”, whose topics matched exactly with the contents applied here. I...

  1. Understanding SaPI1 specific packaging determinants

    OpenAIRE

    Bento, Joana Caetano

    2014-01-01

    Tese de doutoramento Programa Doutoral em Engenharia Biomédica Staphylococcus aureus encodes numerous virulence factors that allow it to cause a wide variety of infections. S. aureus is, in fact, one of the leading causes of nosocomial and community acquired infections. Many of the toxin and antibiotic resistance genes in S. aureus reside on mobile genetic elements, that includes mobile gene cassettes, prophage, transposons, and pathogenicity islands like the SaPIs. Members ...

  2. O impacto da homofobia na saúde do adolescente

    Directory of Open Access Journals (Sweden)

    Taison Regis Penariol Natarelli

    2015-12-01

    Full Text Available Resumo Objetivo: Objetivou-se conhecer os tipos de violência sofrida por adolescentes homossexuais e compreender a influência da homofobia na saúde dessa população. Métodos: Foram realizadas entrevistas, em profundidade, com nove adolescentes residentes em um município do interior de São Paulo que se autodeclararam homossexuais. Resultados: Os tipos de violência sofridos e referidos pelos adolescentes foram: física, verbal, psicológica e sexual. A homofobia provoca percepções negativas sobre si mesmo e a não adoção de hábitos de vida saudáveis relacionados aos cuidados com alimentação, prática de atividades físicas, padrão de sono e ideações suicidas. Foram relatadas situações de homofobia nos serviços de saúde. Conclusão: Adolescentes homossexuais são vulneráveis a diferentes tipos de violência. A dificuldade de acesso aos serviços de saúde é um fator concorrente ao aumento da vulnerabilidade. A contribuição deste estudo reside na problematização de tópicos que podem auxiliar na construção do cuidado integral dos adolescentes homossexuais.

  3. Saúde, este obscuro objeto de desejo

    Directory of Open Access Journals (Sweden)

    Fernando Lefèvre

    1997-07-01

    Full Text Available Exploram-se no presente ensaio as relações entre saúde e desejo, envolvendo um dado querer denominado "saúde" e as formas que este querer adquire no contexto do viver contemporâneo. Aponta-se ao final para uma situação radical no que toca à saúde, vítima de um processo irreversível de expansão, que acaba por inviabilizar qualquer tentativa de defini-la, levando a uma perda total de sentido, no contexto de um universo humano tentendo à completa robotização.The present essay explores the relations between health and desire involving a given yearning named "health" and the forms that such feeling acquires in the contemporaneous context of living. It ultimately points to a radical situation in terms of health, victim of a irreversible process of expansion that eventually makes any attempt of definition not viable, leading to a total loss of meaning within a human universe tending to complete robotization.

  4. O PET-Saúde no contexto do Núcleo de Apoio à Saúde da Família: contribuições para a reorientação das práticas de saúde.

    Directory of Open Access Journals (Sweden)

    Vladimir Andrei Rodrigues ARCE

    2015-08-01

    Full Text Available Este artigo tem como objetivo apresentar e discutir as repercussões do PET-Saúde nas práticas de saúde dos profissionais que atuam em um Núcleo de Apoio à Saúde da Família da cidade de Salvador e que participaram como preceptores do projeto. A experiência construída pela Universidade Federal da Bahia foi estruturada a partir de oficinas de qualificação do grupo, encontros de planejamento e execução de ações de educação em saúde. O projeto, que estabeleceu como eixo central o enfrentamento da violência no âmbito escolar por meio de ações educativas orientadas pela Promoção da Saúde, permitiu a inserção de novas práticas na realidade do trabalho dos profissionais, como a análise da situação de saúde e a adoção de uma perspectiva dialógica e participativa de educação em saúde. Tais práticas potencializam a construção de uma identidade transformadora para o NASF e são fundamentais para o fortalecimento da Estratégia Saúde da Família e consequente consolidação de um modelo de atenção integral à saúde, orientado, sobretudo, pela perspectiva da Promoção da Saúde.

  5. A interdisciplinaridade vivenciada no PET-Saúde = The interdisciplinarity experienced in the PET- Saúde program

    Directory of Open Access Journals (Sweden)

    Assega, Mariana Lieka

    2010-01-01

    Conclusão: Os movimentos reflexivos, os espaços de diálogos propiciaram o desenvolvimento da investigação científica. Além disso, a aproximação do processo de validação pela Técnica Delphi, também permitiu ampliação do conhecimento multidisciplinar sobre saúde bucal. Esta vivência possibilitou qualificar a formação acadêmico-profissional na linha da interdisciplinaridade, sendo importante sua multiplicação para o fortalecimento da interação entre os profissionais e a articulação das ações de saúde

  6. Experimental Investigations on a Novel Chemical Looping Combustion Configuration Étude expérimentale d’une nouvelle configuration de combustion en boucle chimique

    Directory of Open Access Journals (Sweden)

    Yazdanpanah M.M.

    2011-04-01

    Full Text Available Chemical Looping Combustion (CLC is a promising novel combustion technology involving inherent separation of carbon dioxide with minimum energy penalty. An oxygen carrier is employed to continuously transfer oxygen from the air reactor to the fuel reactor where the oxygen is delivered to the fuel. Consequently, direct contact between the air and fuel is prevented. The resulting flue gas is CO2-rich, without N2 dilution. The reduced oxygen carrier is then transported back to the air reactor for re-oxidation purposes, hence forming a chemical loop. Various CLC configurations have already been developed and tested on laboratory scales. However, more investigations are required to achieve feasible CLC processes. Among the different points to address, control of the solid circulation rate between the two reactors is of the highest importance regarding its effect on achievement of an appropriate oxygen transfer rate and solid oxidation degrees. Moreover, minimization of gas leakage between the fuel and air reactors is another important issue to be considered. A novel CLC configuration is proposed where reactions are carried out in two interconnected bubbling fluidized beds. Solid circulation rate control is achieved independently of gas flow rate in the reactors through use of pneumatic non-mechanical valves (L-valves. Moreover, loopseals are employed to minimize gas leakage while transferring solids. Experimental results from operation of a 10 kWth equivalent cold prototype are presented in this paper. The effect of operating variables on the solid circulation rate, gas leakage between the two beds and the pressure balance on all of the process elements is studied. The results demonstrate stable solid circulation with efficient control of the solid flow rate and effective gas tightness of the system. La combustion en boucle chimique (CLC est une nouvelle technologie prometteuse qui implique la separation inherente du dioxyde de carbone avec une perte

  7. DAYA SAING DAN STRATEGI PENGEMBANGAN MINYAK SAWIT DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Jauhar Samudera Nayantakaningtyas

    2012-11-01

    Full Text Available ABSTRACTThe aims of this study were to analyze the competitiveness of Indonesian Crude palm oil CPO products in the international market and to analyze the strategy to improve the competitiveness of Indonesian CPO. The analysis methods used this research were descriptive qualitative methods. The tools used to analyze the competitiveness of palm oil is Revealed Comparative Advantages and Porter Diamond Theory, while the development of the strategy used to determine the SWOT method. Based on the analysis of Porter's Diamond System and revealed comparative advantages, this study concluded that the competitiveness of Indonesian CPO was pretty strong, but it still needed a strategy to strengthen its competitiveness especially on derivative products. Some of the routine strategies that need to be done every year, are the development of the CPO industry human resources through training and innovation activities, paying attention to national and international issues by improving government policies, downstream industrial development and palm oil value-added increase, enhance cooperation with manufacturers from other countries through promotions.Keywords: crude palm oil, competitiveness, strategy, analysis of porter's diamondABSTRAKTujuan penelitian ini adalah menganalisis daya saing produk Crude Palm Oil (CPO Indonesia di pasar internasional dan menganalisis strategi peningkatan daya saing CPO Indonesia. Metode pengolahan dan analisis data yang digunakan dalam penelitian ini adalah metode deskriptif kualitatif. Alat  yang digunakan untuk menganalisis daya saing minyak sawit  adalah Revealed Comparative Advantages dan Teori Berlian Porter, sedangkan untuk mengetahui strategi pengembangan digunakan metode SWOT. Hasil analisis Sistem Berlian Porter dan revealed comparative advantages disimpulkan bahwa daya saing CPO Indonesia cukup kuat, namun masih diperlukan adanya strategi untuk memperkuat terutama pada produk turunan CPO. Strategi rutin yang harus

  8. Adapter les méthodes d’enquêtes à une agriculture principalement non marchande : un exemple en Nouvelle-Calédonie

    Directory of Open Access Journals (Sweden)

    Apithy Leïla

    2016-05-01

    Full Text Available Les activités agricoles (agriculture, élevage, pêche, chasse des ménages des tribus kanak échappent pour l’essentiel aux dispositifs statistiques de la Nouvelle-Calédonie, notamment en raison de la destination, souvent non marchande, des produits. Cet article présente la démarche et les acquis méthodologiques d’une enquête par sondage menée pour apprécier le poids réel de ces activités qui fondent un mode de vie rural. Il apporte des éléments très concrets pour enrichir les méthodologies d’enquêtes agricoles, en particulier dans des régions où le non-marchand est important. Les différentes étapes du processus sont détaillées : de la formulation de la problématique au traitement des données et à la valorisation des résultats. Les options prises pour adapter l’ensemble de l’enquête à la complexité locale permettent d’expliciter le rôle crucial joué par ces activités dans l’alimentation, d’évaluer les pratiques de commercialisation de certains produits et d’alimenter la réflexion sur les fonctions sociales et symboliques des activités agricoles, de pêche, de chasse et de cueillette.

  9. O Direito à Saúde no Sistema Prisional

    Directory of Open Access Journals (Sweden)

    Gabrielle Jacobi KOLLING

    2013-04-01

    Full Text Available O direito à saúde é objeto de constante análise e, a cada momento, visualiza-se a necessidade de enfrentar diferentes interfaces desse direito fundamental. A complexidade inerente ao sistema social, e, por conseguinte, ao da saúde também, demanda-nos romper com a classificação de cidadãos de primeira e de segunda classe; isso não é republicano, tampouco democrático. A lógica dos desumanizados e excluídos (esquecidos e negligenciados deve ser cambiada pela lógica da inclusão. A análise enfocará a saúde no sistema prisional. Para isso, é condição de possibilidade analisarmos os condicionantes de saúde e os seus efeitos no panorama prisional-sanitário brasileiro. Observaremos, ainda, as ações governamentais para efetivar o direito à saúde no sistema prisional, em especial a Política Pública de Saúde “Plano Nacional de Saúde no Sistema Penitenciário”, que se apresenta como uma tentativa concreta de romper com a negligência do Estado em relação aos integrantes do sistema prisional, aos esquecidos, aos sem voz. ABSTRACT The right to health is matter of constant analysis and, at each moment the need to challenge the different interfaces of this basic right is visible. The innate complexity of the social system and, by consequence to the health system as well, demands that we break with the concept of first and second class citizens; this is not republican or even democratic. The de-humanized and excluded logic (forgotten and neglected must be traded for the inclusion logic. The analysis will focus the prison system’s health. For this is condition of possibility to analyze the health conditions and its effects in the Brazilian prison-sanitary scope. We will also observe the government’s actions to make the right to heath effective in the prison system, in special the Public Health Policy “Nacional Health Plan in the Prison System”, which is presented as a real attempt to break with the state’s negligence

  10. Des pôles de croissance vers des systèmes d’innovation territorialisés dans une « nouvelle » économie de marche : le cas de Gdansk, Pologne

    OpenAIRE

    Maria Lorek

    2013-01-01

    Depuis la libéralisation économique, les pôles de croissance construits sous la tutelle de l’État ont connu des transformations institutionnelles et organisationnelles majeures dans les pays centralement planifiés. Les nouvelles formes d’organisation industrielle, qui sont à l’origine de ces transformations, donnent la priorité aux logiques territoriales. Les économies locales, sous-estimées pendant l’économie centralement planifiée, sont devenues des espaces prioritaires d’application de la ...

  11. Note de lecture. À quoi ressemblera le travail demain ? Technologies numériques, nouvelles organisations et relations au travail, Sandra Enlart & Olivier Charbonnier, Dunod, Paris, 2013, (192 p.)

    OpenAIRE

    Granier, François

    2013-01-01

    International audience Internet, médias sociaux, réseaux sociaux, jeux vidéos, terminaux mobiles : comment ces nouvelles technologies bouleversent-elles notre façon de travailler ? Comment repenser les organisations, le travail, les compétences individuelles et collectives en cohérence avec les évolutions de la société. Ces mutations sont l’affaire de tous, pour les anticiper plutôt que de les subir…

  12. Level of Need for Cognition and Metacognitive Thinking among Undergraduate Kindergarten Female Students at King Sa'ud University in Sa'udi Arabia

    Science.gov (United States)

    Daghistani, Bulquees

    2015-01-01

    This study aims at examining the level of need for cognition and metacognitive thinking among undergraduate kindergarten female students in Education Faculty at King Sa'ud University in Sa'udi Arabia from their own perceptions. Results showed that the need for the cognition level was moderate, but metacognitive thinking level was high. In…

  13. Computational studies of H5N1 hemagglutinin binding with SA-α-2, 3-Gal and SA-α-2, 6-Gal

    International Nuclear Information System (INIS)

    For influenza H5N1 hemagglutinin, a switch from SA-α-2, 3-Gal to SA-α-2, 6-Gal receptor specificity is a critical step leading to the conversion from avian-to-human to human-to-human infection. Therefore, the understanding of the binding modes of SA-α-2, 3-Gal and SA-α-2, 6-Gal to H5N1 hemagglutinin will be very important for the examination of possible mutations needed for going from an avian to a human flu virus. Based on the available H5N1 hemagglutinin crystal structure, the binding profiles between H5N1 hemagglutinin and two saccharide ligands, SA-α-2, 3-Gal and SA-α-2, 6-Gal, were investigated by ab initio quantum mechanics, molecular docking, molecular mechanics, and molecular dynamics simulations. It was found that SA-α-2, 3-Gal has strong multiple hydrophobic and hydrogen bond interactions in its trans conformation with H5N1 hemagglutinin, whereas the SA-α-2, 6-Gal only shows weak interactions in a different conformation (cis type)

  14. Caso Ouro Fino Saúde Animal Caso Ouro Fino Saúde Animal Ouro Fino Saúde Animal case

    Directory of Open Access Journals (Sweden)

    Bernardo Hauch Ribeiro de Castro

    2012-04-01

    Full Text Available O Caso Ouro Fino Saúde Animal ilustra uma tomada de decisão, pelos executivos da empresa, sobre a entrada em um novo mercado, de vacinas para bovinos. Diante da necessidade de dar um passo maior em direção ao crescimento sustentável, a empresa não poderia deixar de entrar nesse segmento, que representava mais de metade do mercado brasileiro de produtos veterinários. No entanto, era um passo arriscado. A principal questão do caso é avaliar as alternativas de comprar vacinas de terceiros ou produzir internamente suas próprias vacinas. A empresa do caso é a Ouro Fino Saúde Animal, empresa brasileira de produtos veterinários, instalada no Estado de São Paulo, com faturamento de mais de R$ 100 milhões anuais. Os dois principais personagens deste caso são os diretores financeiro e industrial da empresa. A situação passa-se em 2005. Como instrumento de ensino, o caso foi concebido para o ensino de estratégia em cursos de pós-graduação em administração, levando os alunos a avaliar vantagens e desvantagens de cada uma das alternativas. Como objetivo secundário, o caso propicia alguns elementos para uma estimativa da viabilidade financeira da opção de implantar uma nova unidade produtiva e a possibilidade de refletir sobre uma decisão já tomada, de entrada no novo mercado. Por fim, o caso traz uma série de informações sobre o mercado brasileiro e sobre o mercado mundial de produtos veterinários. É possível, com base nestes dados, trabalhar questões ligadas à segmentação e posicionamento da empresa no setor, ficando a critério do professor este tipo de uso.El Caso Ouro Fino Saúde Animal ilustra una toma de decisiones por los ejecutivos de la empresa, a la entrada en un nuevo mercado de las vacunas para el ganado. Ante la necesidad de dar un paso importante hacia el crecimiento sostenible, Ouro Fino Saúde Animal no podía dejar de entrar, ya que representaba más de la mitad del mercado de productos veterinarios

  15. 认识SA8000更要关注ISO26000%Concerned on SA 8000, and Focused on ISO 26000 Further

    Institute of Scientific and Technical Information of China (English)

    张振明

    2006-01-01

    @@ 近年来,在我国形成来势凶猛的SA 8000运动浪潮,特别是2004年初,国内部分媒体的相关报道铺天盖地,各种收费培训班或专题讲座火爆异常,一时间人们谈及社会责任,言必称SA 8000,笔者同年6月参加在深圳举办的SA 8000专题讲座,授课人甚至称SA 8000是国际标准,似乎SA 8000就是社会责任的代名词.

  16. DAYA SAING PRODUK TURUNAN SUSU INDONESIA DI PASAR DUNIA

    Directory of Open Access Journals (Sweden)

    Lina Yanti

    2012-06-01

    Full Text Available ABSTRACTThis research purposes were (1 to measures the competitiveness of Indonesian milk derivative product in international market based on its comparative advantage, (2 to analyze the dynamics of Indonesian milk and also to analyze the commodity’s competitive position in the international market through its dynamic export product performance, (3 to analyze dominant factors that influencing Indonesian dairy export growth based on constant market share analysis. The analysis methods used to measure the competitiveness of Indonesian milk in this research are based on revealed comparative advantage analysis, Export product dynamic analysis (EPD, and constant market share analysis. The result from RCA showed that the Indonesian milk derivative products which are Milk not concentrated nor sweetened 1–6% fat (HS 040120, Milk and cream, concentrated or sweetened (HS 0402 and Buttermilk, curdled milk, cream, kephir, etc (HS 040390 do not have comparative advantage but for Milk and cream powder unsweetened > 1,5%  fat (HS 040221, Milk and cream nes sweetened or concentrated (HS 040299 and Cereal, flour, starch, milk preparations and products (HS19 have comparative advantage. The EPD found that all Indonesian milk derivative products are included in the Rising Star position. The result test using CMS analysis concluded that the most significant factor which affect the export growth for Indonesian HS 040390 and HS 0402 derivative products are the import growth effect, HS 19 is mainly dominated by commodity composition effect, and the export growth for the rest derivative products are dominated with the competitiveness effect. Therefore, it needs to be implemented efforts to enhance the competitiveness of dairy derived products IndonesiaKeywords: milk, competitiveness, revealed comparative advantage (RCA, export product dynamic (EPD, constant market share analysis (CMSAABSTRAKPenelitian ini bertujuan (1 menganalisis daya saing komoditas susu

  17. Karl Lachmann et sa méthode

    OpenAIRE

    Fornaro, Sotera

    2011-01-01

    Résumé : Cet article s’efforce de définir le profil intellectuel de Karl Lachmann, l’itinéraire parcouru pour arriver à sa « méthode », ses rapports avec la philologie classique antérieure (Heyne) et contemporaine (Hermann), ses prises de position sur la « question homérique ». Mais il décrit surtout le rôle de Lachmann dans l’institutionnalisation de la germanistique, la « science allemande » par excellence, dont la dignité scientifique et institutionnelle s’établit sur le modèle de l’Altert...

  18. SA8000基本知识解读

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    1SA8000的含义 社会责任国际标准体系(Social Accountability 8000 Intemational standard,简称SAS000)是一种基于国际劳工组织宪章(ILO宪章)、联合国儿童权利公约、世界人权宣言而制定的,以保护劳动环境和条件、劳工权利等为主要内容的管理标准体系。

  19. SA8000基础知识解读

    Institute of Scientific and Technical Information of China (English)

    黎友焕

    2004-01-01

    社会责任国际标准体系(Social Ac-countability 8000 International slandard,简称SA8000)是一种基于国际劳工组织宪章(ILO宪章),联台国儿童权利公约,世界人权宣言而制定的.以保护劳动环境和条件、劳工权利等为主要内容的管理标准体系。

  20. Future developments in the Atomic Energy Corporation of SA

    International Nuclear Information System (INIS)

    The Atomic Energy Corporation of S.A. (AEC) has been forced, by significant changes in its external environment, to redirect many of its areas of focus. Promising developments in the AEC are highlighted. The AEC considers its efforts to develop an alternative cost-effective enrichment technology as a strategic programme of utmost importance. A brief survey is given of some of the significant future developments being undertaken within the AEC. All these developments should be seen to foster more economic nuclear power and technology for the future needs of South Africa and to advance the AEC on its drive towards commercialisation. 5 figs., 1 tab., 2 refs

  1. The rebranding of Electrica Soluziona SA - a case study

    Directory of Open Access Journals (Sweden)

    Monica GOMOESCU

    2016-07-01

    Full Text Available This article intends to present the design and implementation stages of a rebranding campaign that took place in the Electrica Soluziona SA company. The rebranding targets a company that provides consultancy services and software solutions and that underwent a change of its main shareholders structure, as it was taken over by Indra Group. After being taken over by Indra, Electrica Soluziona has considerably enlarged its product portfolio and the market segments targeted. Thus, it was mandatory to define a complex rebranding campaign. The rebranding process was not determined only by the broadening of activity, but also by the change of visual identity elements, along with the desire of repositioning.

  2. Programa de Monitoreo Ambiental para Cementos Cienfuegos S.A

    OpenAIRE

    Mario A. Curbelo Hernández; José Luis Romero Cabrera; Henrry Ricardo Cabrera

    2012-01-01

    La presente investigación se realizó en las instalaciones de Cementos Cienfuegos S.A. Cuba, con el objetivo de diseñar e implementar un programa de monitoreo de las variables de concentración de polvo en aire, tasa de deposición y concentración de metales pesados, para la valoración de la calidad del aire a partir de índices establecidos en la norma NC ISO 111:2004. Este programa incluye también el monitoreo de los parámetr...

  3. Ambiente e saúde: visão de profissionais da saúde da família

    Directory of Open Access Journals (Sweden)

    Ana Flávia Quintão Fonseca

    2012-08-01

    Full Text Available A temática saúde e ambiente vem sendo amplamente discutida através de disciplinas tanto do campo da saúde quanto das ciências ambientais. No âmbito de uma visão ampliada de saúde, torna-se desejável que os profissionais desse campo de conhecimento apresentem um maior envolvimento na discussão acerca da temática saúde e ambiente. O objetivo deste trabalho é identificar e compreender as percepções, ideias e imagens de alguns profissionais da Saúde da Família sobre a articulação entre saúde e ambiente. A presente pesquisa foi realizada na perspectiva das Ciências Sociais sendo desenvolvida no contexto da abordagem qualitativa. Realizou-se a análise das informações obtidas de profissionais pertencentes a uma regional de Saúde de Belo Horizonte. Para a definição do número de participantes, foi utilizado o critério de saturação. Como técnica de análise das informações, utilizou-se a análise de conteúdo, desenvolvida na perspectiva da representação social. A coleta de informações foi realizada através de entrevistas semiestruturadas. A partir da análise das informações obtidas, foram apreendidas duas categorias de análise. Foi possível observar que, apesar da significativa percepção em relação à interação entre saúde e ambiente, essa percepção se mostra limitada e reducionista. A despeito de toda a complexidade do sistema de organização da Saúde da Família na atenção à saúde, a discussão sobre saúde e ambiente, como um saber necessário à prática ampliada da saúde, parece não se fazer presente de maneira abrangente e integrada com a discussão atual. Encontra-se, ainda, desvinculada de um enfoque ecossistêmico de saúde.La temática salud y ambiente ha sido ampliamente discutida en todas las disciplinas del campo de las ciencias de la salud y del medio ambiente. Dentro de una visión ampliada de la salud, es deseable que los profesionales en este campo del conocimiento tienen una

  4. Educação para a Saúde Sexual e Reprodutiva

    OpenAIRE

    Pinheiro, Maria Felícia C. Pereira Tavares

    2010-01-01

    Reflexão sobre a educação para a saúde sexual e reprodutiva, partindo dos oito Objectivos de Desenvolvimento do Milénio que têm por base a Conferência do Cairo. Assim a educação para a saúde sexual e reprodutiva surge como instrumento de promoção de saúde da mulher ao longo do ciclo vital. As questões relacionadas com a saúde reprodutiva atravessam várias formas de vigilância de saúde que ainda não se constituem como universais para todas as mulheres gerando desigualdades de saúde. A formação...

  5. A SA-Based Wireless Seismic Stress Monitoring System for Concrete Structures

    OpenAIRE

    Hou, S.; Yu, Y; Zhang, H. B.; Mao, X Q; Ou, J. P.

    2013-01-01

    A PZT-based smart aggregate (SA) is capable of full process stress monitoring during earthquakes. A wired seismic monitoring system is prone to failure during earthquakes. Therefore, it is extremely necessary to use the wireless monitoring technique in the SA-based monitoring system. In this paper, the SA is integrated with the ZigBee wireless network which consists of a charge-to-voltage converter, a microprocessing unit, a wireless transmission unit, a base station, and a host computer. The...

  6. Implications of China's possible participation in the TiSA negotiations

    OpenAIRE

    TU, Xinquan; Zhou, Nianli

    2016-01-01

    Following the failure of the Doha Round, the Trade in Services Agreement (TiSA) negotiations originated, under the leadership of the United States, with the intention of developing new rules to promote further liberalization of services. While its prospects remain unclear, the TiSA has shown great ambition in the depth and breadth of liberalization for services trading and investment. China sincerely sought to join the TiSA negotiations simply because it is necessary in order to upgrade its i...

  7. Contribuições do PET-Saúde/Redes de Atenção Psicossocial à Saúde da Família

    Directory of Open Access Journals (Sweden)

    Larissa de Almeida Rézio

    2015-12-01

    Full Text Available O estudo objetivou analisar as contribuições do Programa de Educação pelo Trabalho para a Saúde – PET-Saúde/Redes de Atenção Psicossocial à Saúde - a uma unidade de Estratégia de Saúde da Família em Cuiabá, Mato Grosso, Brasil. Trata-se de um estudo descritivo, com abordagem qualitativa, utilizando entrevista com cinco profissionais de saúde e dois acadêmicos bolsistas e registros de atividades realizadas no serviço. À luz da análise de conteúdo temática, sistematizamos quatro subtemas: “articulação da rede”; “qualificação da assistência à saúde mental”, “melhora do conhecimento dos profissionais” e “superação de estigmas sobre o paciente em sofrimento psíquico”. Houve sensibilização dos profissionais e bolsistas sobre a importância do acompanhamento das pessoas com sofrimento mental na atenção básica, em articulação com serviços de saúde mental.

  8. O PET-Saúde no contexto do Núcleo de Apoio à Saúde da Família: contribuições para a reorientação das práticas de saúde.

    OpenAIRE

    Vladimir Andrei Rodrigues ARCE; de Oliveira, Elaine Cristina

    2015-01-01

    Este artigo tem como objetivo apresentar e discutir as repercussões do PET-Saúde nas práticas de saúde dos profissionais que atuam em um Núcleo de Apoio à Saúde da Família da cidade de Salvador e que participaram como preceptores do projeto. A experiência construída pela Universidade Federal da Bahia foi estruturada a partir de oficinas de qualificação do grupo, encontros de planejamento e execução de ações de educação em saúde. O projeto, que estabeleceu como eixo central o enfrentamento da ...

  9. Saúde Bucal autorreferida da população adulta brasileira: resultados da Pesquisa Nacional de Saúde 2013

    Directory of Open Access Journals (Sweden)

    Lucélia Silva Nico

    2016-02-01

    Full Text Available Resumo Os agravos relacionados à saúde bucal dos brasileiros representam importante problema de saúde pública devido à sua prevalência e magnitude na população. Inquéritos de base populacional são ferramentas essenciais para a eleição de grupos e demandas prioritários de atenção. O objetivo deste artigo foi descrever a situação de saúde bucal autorreferida da população brasileira, segundo fatores sociodemográficos. Realizou-se um estudo descritivo, utilizando os dados da Pesquisa Nacional de Saúde de 2013. Indicadores referentes às práticas de higiene e condições de saúde bucal foram analisados. Homens, idosos, pretos e pardos, indivíduos sem instrução e com nível fundamental incompleto, residentes na área rural e na região nordeste apresentaram as mais baixas frequências dos indicadores de higiene bucal adequada e de autopercepção da saúde bucal como boa ou muito boa. Com relação à perda dentária, a total afetou cerca de 16,0 milhões. Tanto a perda dentária total quanto a de 13 ou mais dentes foi mais frequente em mulheres, indivíduos com 60 anos e mais de idade, com baixa escolaridade, residentes na área rural. Conclui-se que os dados da Pesquisa Nacional de Saúde – PNS 2013 reforçam a necessidade de políticas e ações que minimizem as desigualdades em saúde bucal, garantindo acesso aos subgrupos populacionais mais vulneráveis de acordo com suas necessidades de saúde.

  10. Discursos sobre o papel e a representatividade de conferências municipais de saúde

    OpenAIRE

    Julio Strubing Müller Neto; Elizabeth Artmann

    2014-01-01

    A participação da sociedade na definição das políticas de saúde constitui um princípio orientador do sistema público de saúde no Brasil. Analisaram-se os discursos dos participantes sobre o papel e a representatividade de conferências municipais de saúde. O estudo foi realizado em cinco municípios de Mato Grosso, Brasil, no período 2009-2010. Foram entrevistados 30 atores sociais, entre conselheiros e gestores de saúde, planejadores, vereadores e representantes do Ministério Público. Os dados...

  11. The visualization of DHSI based on the relationship model of CL and SA

    Science.gov (United States)

    Wang, Haibo; Guo, Huijuan; Xue, Chengqi

    2013-03-01

    The source and cause of cognitive load (CL) and situation awareness (SA) in digital human-system interface (DHSI) is explained. Based on the analysis of cognitive procedure and the relation of CL and SA, The relationship model of CL and SA in DHSI is put forward. Using the association target and the relationship model of CL and SA, the method and strategy of information visualization of DHSI is presented which is based on the cognitive psychology. Selecting the Boeing 757 autopilot as the case, the comparison of design is shown.

  12. Cuidados em saúde entre portadores de diabetes mellitus autorreferido no Brasil, Pesquisa Nacional de Saúde, 2013

    Directory of Open Access Journals (Sweden)

    Deborah Carvalho Malta

    2015-12-01

    Full Text Available Resumo: Objetivo: Descrever medidas do cuidado assistencial destinadas ao paciente com diabetes mellitus autorreferido no Brasil. Métodos: Foram utilizados dados da Pesquisa Nacional de Saúde(2013, estudo transversal de base populacional, referentes ao cuidado em saúde com o diabetes mellitus autorreferido, quanto ao uso de serviços de saúde e acesso a medicamentos. Resultados: A prevalência de diabetes mellitus autorreferido foi de 6,2%, e 11,5% da população nunca fez uma glicemia na vida. Dos adultos que referiram diabetes mellitus , 80,2% tomaram medicamentos nas duas semanas anteriores à entrevista, 57,4% usaram o Programa Farmácia Popular, 73,2% receberam assistência médica e 47,1% realizaram o atendimento nas Unidades Básicas de Saúde. Em 65,2%, o médico que atendeu na última consulta era o mesmo das consultas anteriores, 95,3% dos pacientes conseguiram realizar os exames complementares solicitados e 83,3% conseguiram fazer as consultas com o médico especialista. A avaliação de pés e olhos foi relatada por 35,6 e 29,1% dos portadores de diabetes mellitus , respectivamente. Relataram internação hospitalar por causa do diabetes ou de alguma complicação 13,4% dos adultos, e outros 7,0% relataram limitações nas atividades diárias. Em geral, mulheres, assim como a população mais idosa, de maior escolaridade, brancos e residentes nas regiões Sul e Sudeste, tiveram maior prevalência da doença e maior acesso aos serviços, medicamentos e consultas. Discussão: Os cuidados aos portadores de diabetes foram recebidos de forma adequada, na maioria dos casos, o que é essencial para manter a qualidade de vida dos pacientes e prevenir desfechos mais graves.

  13. Design and trial manufacturing of JT-60SA vacuum vessel

    International Nuclear Information System (INIS)

    JT-60 is planned to be upgraded to a JT-60SA superconducting tokamak machine. This project is the JA-EU satellite tokamak program under both broader approach and Japanese domestic programs. The JT-60SA tokamak is composed of the following main components: vacuum vessel (VV), thermal shield, super-conducting coils (toroidal field coil, equilibrium field coil, and central solenoid), cryostat, and heating facilities. The VV has a D-shaped poloidal cross section and a double-wall structure to ensure high rigidity and toroidal one-turn resistance simultaneously. The material of the VV is 316L stainless steel with a low cobalt content of <0.05 wt%. Before the start of manufacturing the VV, fundamental welding R and D was performed to study the manufacturing procedures. The manufacturing procedures were successfully established with a trial manufacturing of 20 degree upper half of the VV. Based on the results, the actual VV manufacturing has started in November 2009. (author)

  14. Magnetic field measurements of JT-60SA CS model coil

    International Nuclear Information System (INIS)

    Highlights: • Magnetic fields of the JT-60SA CS model coil were measured. • While the coil current was held constant at 20 kA, magnetic fields varied slightly with several different long time constants. • We investigated coils consisting of CIC conductors and having long time constants. - Abstract: In a cold test of the JT-60SA CS model coil, which has a quad-pancake configuration consisting of a Nb3Sn cable-in-conduit (CIC) conductor, magnetic fields were measured using Hall sensors. For a holding coil current of 20 kA, measured magnetic fields varied slightly with long time constants in the range 17–571 s, which was much longer than the time constant derived from a measurement using a short straight sample. To validate the measurements, the magnetic fields of the model coil were calculated using a computational model representing the positions of Nb3Sn strands inside the CIC conductor. The calculated results were in good agreement with the measurements. Consequently, the validity of the magnetic field measurements was confirmed. Next, we investigated other coils consisting of CIC conductors and having long time constants. The only commonality among the coils was the use of CIC conductors. At present, there is no obvious way to prevent generation of such magnetic-field variations with long time constants

  15. Enredando lutas cotidianas: dispositivos de saúde pela cidade

    Directory of Open Access Journals (Sweden)

    Arielle Rocha de Oliveira Silva

    2009-12-01

    Full Text Available A partir das experiências de intervenções em serviços públicos de saúde e em outros setores da cidade, este trabalho afirma uma prática oficineira descentralizada capaz de compor na construção de redes sociais, servindo de instrumento de análise e possibilitando a invenção de modos de vida e afirmação de singularidades. As intervenções na cidade abrem caminhos para mudanças nos processos em curso e contribuem para a produção de saúde/cidadania por meio da potência conectiva das lutas. O enlace dessas temáticas visa ampliar o campo problemático da atenção psicossocial e fortalecer a luta antimanicomial no Espírito Santo, apostando em novas formas de atuação.

  16. Status of design and procurement activities in JT-60SA

    International Nuclear Information System (INIS)

    The JT-60SA experiment is one of the three projects to be undertaken in Japan as part of the Broader Approach Agreement, conducted jointly by Europe and Japan, and complementing the construction of ITER in Europe. It is a fully superconducting tokamak capable of confining break-even equivalent deuterium plasmas with equilibria covering high plasma shaping with a low aspect ratio at a maximum plasma current of Ip = 5.5 MA. In late 2007 the BA Parties, prompted by cost concerns, asked the JT-60SA Team to carry out a re-baselining effort with the purpose to fit in the original budget while aiming to retain the machine mission, performance, and experimental flexibility. Subsequently the Integrated Project Team has undertaken a machine re-optimization followed by engineering design activities aimed to reduce costs while maintaining the machine radius and plasma current. This effort led the Parties to the approval of the new design in late 2008 and hence final design and procurement activities have commenced. The paper will describe the process leading to the re-baselining, the resulting final design and technical solutions and the present status of procurement activities.

  17. Finite element analysis of (SA) mechanoreceptors in tactile sensing application

    Science.gov (United States)

    N, Syamimi; Yahud, S.

    2015-05-01

    This paper addresses the structural design of a fingertip model in order to analyse the sensory function of slow adapting (SA) mechanoreceptors by using the finite element analysis (FEA) method. A biologically inspired tactile sensor was designed to mimic a similar response of the human mechanoreceptors in the human glabrous skin. The simulation work was done by using COMSOL Multiphysics. The artificial skin was modelled as a solid square block of silicone elastomer with a semi cylinder protrusion on top. It was modelled as a nearly incompressible and linear hyperelastic material defined by Neo Hookean constitutive law. The sensing element on the other hand was modelled by using constantan alloy mimicking the SA1 receptor. Boundary loads of 1 N/m² to 4 N/m² with the increment of 1 N/m² were applied to the top surface of the protrusion in z and x-direction for normal and shear stress, respectively. The epidermal model base was constrained to maintain the same boundary conditions throughout all simulations. The changes of length experienced by the sensing element were calculated. The simulations result in terms of strain was identified. The simulated result was plotted in terms of sensing element strain against the boundary load and the graph should produce a linear response.

  18. Magnetic field measurements of JT-60SA CS model coil

    Energy Technology Data Exchange (ETDEWEB)

    Obana, Tetsuhiro, E-mail: obana.tetsuhiro@LHD.nifs.ac.jp [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Takahata, Kazuya; Hamaguchi, Shinji; Chikaraishi, Hirotaka; Mito, Toshiyuki; Imagawa, Shinsaku [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Kizu, Kaname; Murakami, Haruyuki; Natsume, Kyohei; Yoshida, Kiyoshi [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)

    2015-01-15

    Highlights: • Magnetic fields of the JT-60SA CS model coil were measured. • While the coil current was held constant at 20 kA, magnetic fields varied slightly with several different long time constants. • We investigated coils consisting of CIC conductors and having long time constants. - Abstract: In a cold test of the JT-60SA CS model coil, which has a quad-pancake configuration consisting of a Nb{sub 3}Sn cable-in-conduit (CIC) conductor, magnetic fields were measured using Hall sensors. For a holding coil current of 20 kA, measured magnetic fields varied slightly with long time constants in the range 17–571 s, which was much longer than the time constant derived from a measurement using a short straight sample. To validate the measurements, the magnetic fields of the model coil were calculated using a computational model representing the positions of Nb{sub 3}Sn strands inside the CIC conductor. The calculated results were in good agreement with the measurements. Consequently, the validity of the magnetic field measurements was confirmed. Next, we investigated other coils consisting of CIC conductors and having long time constants. The only commonality among the coils was the use of CIC conductors. At present, there is no obvious way to prevent generation of such magnetic-field variations with long time constants.

  19. Altera – Technical update, presented by Sascoholz SA

    CERN Multimedia

    FI Department

    2008-01-01

    Thursday 28 August 2008 From 9h00 to 12h00 (welcome at 08h45) in Room B (Main Building 61/1-009) SascoHolz SA cordially invites you to an informative and interesting technical update on the latest Altera FPGA developments. Introducing Altera’s Stratix IV Device Family 40-nm high-performance, high-end FPGAs with 8.5-Gbps transceiver option The Stratix IV FPGA family gives you the highest density, highest system performance, and the lowest power available in an FPGA, enabling innovation without compromise. Speaker Ole Horn, FAE Sascoholz Agenda Altera Stratix IV Device FamilyIntroduction Logic Fabric Architecture DSP Blocks Tri-Matrix Memory PLL and Clock Networks Design Security I/O Connectivity High-Speed Transceiver Low Power Consumption Language: English As a member of the globally active distribution group, Arrow Electronics, SascoHolz SA does more than just following the concepts of classic broadline distributors. In fact, we offer a depth of service throughou...

  20. La RSE : nouvelle forme de dé-marchandisation du monde ? CSR: a new way of de-marchanisation of the world?

    Directory of Open Access Journals (Sweden)

    Richard Sobel

    2010-12-01

    Full Text Available Le mouvement dit de « RSE » entend concilier l’actuel mode d’accumulation à dominante financière avec certaines exigences sociales et environnementales. Or, ce mouvement s’inscrit assez bien dans l’analyse historique et institutionnaliste que Karl Polanyi a faite des limites de la marchandisation du monde. En effet, ce mouvement consiste à revenir sur la trop forte marchandisation du rapport à la nature et au travail qu’aurait entraîné le développement d’un capitalisme financiarisé. En réaction, ce mouvement mobilise l’engagement volontaire des entreprises pour bâtir une nouvelle « grande transformation », c’est-à-dire une forme inédite d’articulation entre le juste et l’efficace visant à assurer la viabilité du capitalisme. Cela revient à élargir l’engagement économique à autre chose que la simple maximisation des intérêts individuels de court terme. Cet article vise à exploiter cette proximité entre le mouvement de la RSE et l’analyse polanyienne de la marchandisation, proximité selon nous fructueuse et qui n’a jamais fait l’objet d’une analyse systématique. L’enjeu est de déterminer dans quelle mesure la RSE constitue aujourd’hui une réponse pertinente à la nécessaire gestion collective de la fiction que constitue la marchandisation apparente de la monnaie, de la terre et du travail.The movement says about "CSR" tries to reconcile the current financial mode of accumulation with certain social and environmental requirements. This movement joins well enough in the historic and institutionnalist analysis which Karl Polanyi made of the limits of marchandisation of the world. Indeed, this movement consists in returning on excess strong marchandisation of the relationship with the nature and with the work which would have pulled the new capitalism. In reaction, this movement mobilizes the individual commitment to build a new "great transformation", that is new articulation

  1. As dissonâncias do sistema privado de saúde e a judicialização da saúde no Distrito Federal

    OpenAIRE

    Isabella Cristina Fernandes da SILVA

    2013-01-01

    RESUMO A saúde, bem maior constante da nossa Constituição Federal da República de 1988, é um tema que tem sido bastante discutido ultimamente. O compromisso com a qualidade de vida, juntamente com os avanços da tecnologia e a precariedade no atendimento público levaram ao surgimento de diversas operadoras de saúde. Com o aumento desse segmento, o estado viu a necessidade de regulamentar essa atividade, a fim de proteger a relação usuário-operadora de saúde. Nesse contexto, foi criado um c...

  2. Saúde Bucal autorreferida da população adulta brasileira: resultados da Pesquisa Nacional de Saúde 2013

    OpenAIRE

    Lucélia Silva Nico; Silvânia Suely Caribé de Araújo Andrade; Deborah Carvalho Malta; Gilberto Alfredo Pucca Júnior; Marco Aurelio Peres

    2016-01-01

    Resumo Os agravos relacionados à saúde bucal dos brasileiros representam importante problema de saúde pública devido à sua prevalência e magnitude na população. Inquéritos de base populacional são ferramentas essenciais para a eleição de grupos e demandas prioritários de atenção. O objetivo deste artigo foi descrever a situação de saúde bucal autorreferida da população brasileira, segundo fatores sociodemográficos. Realizou-se um estudo descritivo, utilizando os dados da Pesquisa Nacional de ...

  3. Hortas comunitárias como atividade promotora de saúde: uma experiência em Unidades Básicas de Saúde

    OpenAIRE

    Christiane Gasparini Araújo Costa; Mariana Tarricone Garcia; Silvana Maria Ribeiro; Marcia Fernanda de Sousa Salandini; Cláudia Maria Bógus

    2015-01-01

    ResumoA agricultura urbana e periurbana (AUP) vem sendo praticada em diferentes espaços, contribuindo para a melhoria da saúde nas comunidades e ambientes mais saudáveis. Objetivando identificar significados e repercussões da prática da AUP em Unidades Básicas de Saúde (UBS), enquanto uma atividade de Promoção da Saúde (PS), e em que medida sua dimensão terapêutica a caracteriza como uma atividade alinhada às práticas integrativas e complementares, foi realizado um estudo transversal com abor...

  4. ANALISIS DAN MODEL STRATEGI PENINGKATAN DAYA SAING PRODUK EDAMAME BEKU

    Directory of Open Access Journals (Sweden)

    Sandryas Alief Kurniasanti

    2015-03-01

    penelitian ini adalah untuk menganalisis daya saing dan merumuskan prioritas alternatif strategi peningkatan daya saing produk edamame beku di PT MT 27. Metode yang digunakan dalam penelitian ini adalah Revealed Comparative Advantage untuk mengetahui kinerja ekspor dari produk edamame beku di pasar dunia, kemudian menganalisis faktor persaingan dengan menggunakan Diamond Porter’s Theory. Alternatif strategi dihasilkan dari analisis SWOT dan ditentukan prioritasnya dengan menggunakan analytical hierarchy process dari satu narasumber ahli. Hasil penelitian menunjukkan bahwa prioritas alternatif strategi peningkatan daya saing produk edamame beku PT MT 27 secara berurutan meliputi: (1 diversifikasi pasar, (2 diversifikasi produk, (3 meningkatkan kerjasama luar negeri, (4 pengembangan divisi Research and Development, (5 mengembangkan program Corporate Social Responsibility, (6 pengelolaan keuangan secara baik dan benar, serta (7 mengembangkan areal pertanian yang berbasis rumah kaca untuk menghindari cuaca buruk karena beriklim tropis. Implikasi Manajerial dari penelitian ini adalah mengembangkan pasar yang sudah ada, dan mengembangkan jenis produk yang diproduksi untuk memenuhi selera pasar ekspor dan juga penghematan biaya produksi. Kata kunci: daya saing, edamame beku, Mitratani Dua Tujuh, strategi daya saing

  5. A participação do enfermeiro de saúde pública na saúde familiar

    Directory of Open Access Journals (Sweden)

    Zélia Sena Costa

    1986-09-01

    Full Text Available As autoras partem do pressuposto de que o avanço da epidemiologia tem demonstrado que muitas enfermidades estão associadas a determinadas estruturas sociais. Face a um enfoque científico, humanístico e personalizado, o Enfermeiro tem conquistado um papel de destaque junto à família, uma vez que este grupo social se constitui em uma via estratégica para utilização de parâmetros psicossocias tendo em vista a função básica de ajuda e apoio. Considerando que a contribuição do Enfermeiro de Saúde Pública é de vital importância para a melhoria do nível de saúde familiar, concluem que existe uma necessidade premente da aplicação adequada do Processo de Enfermagem a nível familiar, propondo a inserção da concepção - unidade familiar - como princípio básico da Assistência de Enfermagem.

  6. Diabetes: uma emergência de saúde pública e de políticas da saúde

    OpenAIRE

    Boavida, José Manuel

    2016-01-01

    Promovida pela Organização Mundial da Saúde (OMS), a comemoração do Dia Mundial da Saúde deste ano será sob o lema da diabetes. A diabetes constitui hoje um dos maiores desafios da saúde pública. Só reconhecida pelos organismos internacionais da saúde como epidemia nos finais do século XX, a diabetes está relacionada com a combinação de um conjunto de fatores genéticos, comportamentais, sociais e ainda da vida intrauterina. Pese embora toda a evolução científica dos últimos anos, a sua cura, ...

  7. Engineering feature in the design of JT-60SA

    International Nuclear Information System (INIS)

    The construction of the JT-60U modification (JT-60SA) is now being planned by both parties of Japan and EU as a part of the ITER Broader Approach. It means that a new function of the ITER satellite tokamak is clearly defined as a mission on the JT-60SA program, and it has a big impact on the engineering design of machine, plasma heating and current drive devices and power supplies. The magnetic coils and vacuum vessel were designed to ensure flexibility in the plasma shape (aspect ratio A 2.6-3.1). The NbTi superconductor will be adopted to generate the central magnetic field of 2.7 T at R = 3.0 m. A large flux swing capability of about 38 Wb is necessary to sustain an ITER-relevant high density plasma at fGW of about 0.85, 3.5 MA for 100 s, though about half of the plasma current will be driven by non-inductive current drive method. A new CS conductor was designed to generate 10 T maximum so as to sustain such plasma for 100 s. An optimization of neutron and radiation shielding was done on the vacuum vessel and cryostat structures under the neutron yield of about 2x1019/shot produced by the plasma heating systems (NBI and ECRF) of 41 MW, 100 s. The estimated nuclear heating values at the inboard and outboard legs of TF coil conductor using 1D code of THIDA-2 are 0.23 mW/cc and 0.15 mW/cc, respectively. The semi-closed vertical divertor with flatter dome was adopted for flexibility of plasma shaping. The mono-block type CFC divertor armor is being planned to withstand heat load of 10-20 MW/m2. Each of cryo-panels installed under the flatter dome and the outer baffle plate has a strong pumping capability of about 50 m3/s. A new AC power system combined with a power grid and the existing MG set was deigned to satisfy the total energy of 12.9 GJ for the heating systems of 41 MW, 100 s. This paper intends to clarify the latest design option of the JT-60SA. (author)

  8. O conceito de saúde The health's concept

    Directory of Open Access Journals (Sweden)

    Marco Segre

    1997-10-01

    Full Text Available Questiona-se a atual definição de saúde da Organização Mundial da Saúde: "situação de perfeito bem-estar físico, mental e social" da pessoa, considerada ultrapassada, primeiramente, por visar a uma perfeição inatingível, atentando-se as próprias características da personalidade. Menciona-se como principal sustentação dessa idéia, a renúncia necessária a parte da liberdade pulsional do homem, em troca da menor insegurança propiciada pelo convívio social. Discute-se a validade da distincão entre soma, psique e sociedade, esposando o conceito de homem "integrado", e registrando situações em que a interação entre os três aspectos citados é absolutamente cristalina. É revista a noção de qualidade de vida sob um vértice antipositivista. Essa priorização e proposta de resgate do subjetivismo, reverte a um questionamento da atual definição de saúde, toda ela embasada em avaliações externas, "objetivas", dessa situação.Objections to the present WHO (World Health Organization definition of HEALTH, as "the state of perfect physical, mental and social well-being", are expressed. It is considered to be anachronistic, first because it aims at perfection which is unaltainelle because of distict personality characteristics. As the main support for this idea, the necessary renunciation of part of man's drive to liberty in exchange for the lesser insecurity provided by social life (Freud, Castoriadis and Mc Dougall, is groted. The validity of distinguishing between "soma", "psyche" and "society" is questioned and the concept of the "integrated man", alluding to Pierre Marty and to Freud himself is adapted, and situations are recalled in which the interaction of the three aspects mentioned above is actually evident. Finally, the notion of the quality of life, in accordance with an antipositivistic taken from Bion, point of view, is discussed, and the concept that reality is that of each human being, is adapted. This

  9. 75 FR 6397 - AMC USA, Inc. v. International First Service S.A. a/k/a IFS S.A, its Agents, Affiliated, Related...

    Science.gov (United States)

    2010-02-09

    ... and Partner Companies, and International First Service USA, Inc. a/k/a IFS USA, Inc. d/b/a Global Wine....''); International First Service USA, Inc. a/ k/a IFS USA, Inc. (``IFS USA'') d/b/a/Global Wine Logistics USA Inc. a... AMC USA, Inc. v. International First Service S.A. a/k/a IFS S.A, its Agents, Affiliated, Related...

  10. Indutores de mudança na formação dos profissionais de saúde: pró-saúde e PET-SAÚDE

    Directory of Open Access Journals (Sweden)

    Isabel Cristina Luck Coelho de Holanda

    2012-12-01

    Full Text Available Na última década, a formação de profissionais de saúde tem sido reformulada no intuito de atender às necessidades de saúde das pessoas e não somente suas demandas. Políticas públicas de educação e saúde promovidas em parceria com o Ministério da Educação (MEC e o Ministério da Saúde (MS sinalizaram uma reforma curricular imprescindível nos cursos de graduação da área de saúde(1,2 .A formalização dessa mudança teve seu marco com a instituição das Diretrizes Curriculares Nacionais (DCN para os cursos de graduação no campo da saúde. Todos os instrumentos vigentes orientam a construção do perfil dos egressos por meio de um modelo acadêmico e profissional em que atitudes, habilidades e conteúdos almejem a formação generalista, humanista, crítica e reflexiva, com competência para a atuação em todos os níveis de atenção à saúde, embasando suas condutas nos rigores científico e ético(3-7.Não por acaso, todos os documentos ressaltam os mesmos campos de competência a serem desenvolvidos durante a formação dos diferentes profissionais da área: atenção à saúde, tomada de decisões, comunicação, liderança, educação permanente, administração e gerenciamento(3-7, pois a saúde, como um complexo campo de atuação, não consegue imprimir ações resolutivas através de uma única disciplina ou área do saber.A proposta preconizada pelo MEC e MS de produzir transformação nos processos de formação, trabalho e ampliação da cobertura dos serviços tem sido concretizada mediante programas indutores, como o Programa Nacional de Reorientação da Formação Profissional em Saúde (Pró-Saúde e o Programa de Educação pelo Trabalho para a Saúde (PET–Saúde(1,2.O Pró-Saúde, implementado no país desde 2005 através da divulgação de editais, pretende sintonizar a formação em saúde com as necessidades sociais, considerando as dimensões históricas, culturais e econômicas da população(8

  11. A música popular brasileira na construção do conhecimento em Saúde Pública: o tema processo de trabalho e saúde

    Directory of Open Access Journals (Sweden)

    José Augusto Pina

    2014-01-01

    Full Text Available Este estudo destaca temas relativos ao trabalho e à saúde na música popular brasileira, especialmente no samba. Tem como objetivo apresentar um corpo de conhecimentos sobre o tema processo de trabalho e saúde. Nas canções selecionadas foram identificadas categorias tomadas como ponto de partida para discussão com a literatura. Com o desenvolvimento do texto, percebe-se o manancial da canção popular para proporcionar conteúdos sobre múltiplas dimensões do processo de trabalho e do processo saúde-doença dos trabalhadores, inclusive a dimensão coletiva e histórica da luta pelo direito à saúde. Esta pesquisa resultou na valorização da música popular brasileira como uma forma de se entenderem as relações trabalho-saúde e de se desenvolver conhecimento em Saúde Coletiva.

  12. Educação Popular e Saúde e democracia no Brasil

    Directory of Open Access Journals (Sweden)

    Eduardo Navarro Stotz

    2014-12-01

    Full Text Available O ensaio se propõe a entender os limites, as possibilidades e os desafios do controle social do Sistema Único de Saúde à luz de uma reflexão sobre a democracia no Brasil com base nas referências da Educação Popular e Saúde.

  13. 77 FR 16155 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2012-03-20

    ... and Procedures (44 FR 11034, February 26, 1979); 3. Will not affect intrastate aviation in Alaska; and... de Aeronautica S.A. (EMBRAER) Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... directive (AD) for all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 airplanes. This...

  14. 76 FR 7511 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2011-02-10

    ... rule'' under the DOT Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will... Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes; and Model ERJ 190-100..., contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Technical Publications Section (PC 060),...

  15. 78 FR 66258 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2013-11-05

    ... Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); 3. Will not affect intrastate aviation... de Aeronautica S.A. (EMBRAER) Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... directive (AD) for certain Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135ER, - 135KE,...

  16. 76 FR 72855 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2011-11-28

    ... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or... de Aeronautica S.A. (EMBRAER) Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ] ACTION... all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 190 airplanes. This proposed AD...

  17. 75 FR 260 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2010-01-05

    ... Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic... de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes; and Model ERJ 190-100 STD, -100 LR, -100 IGW... Brasileira de Aeronautica S.A. (EMBRAER), Technical Publications Section (PC 060), Av. Brigadeiro Faria...

  18. 77 FR 36224 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2012-06-18

    ... 12866; 2. Is not a ``significant rule'' under the DOT Regulatory Policies and Procedures (44 FR 11034... de Aeronautica S.A. (EMBRAER) Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION... all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135 airplanes, and Model...

  19. Data of evolutionary structure change: 1O2SA-2FOHA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available entryIDChain>1O2SA SLNSG-----YHFCG >EEE ----- EE...ID>2FOH A 2FOHA SLQYRSGSSWAHTCG ...>EEEEEE EEE EEucture> ATOM 123 CA SER A 32 53....yIDChain>1O2SA PVVCS----GKLQG >EEEE ---- EEEE...LHCLVNGQYAVHG >EEEEEE EEEEEEe>

  20. Best Practices Case Study: S&A Homes, East Liberty, PIttsburgh, PA

    Energy Technology Data Exchange (ETDEWEB)

    None

    2010-12-01

    S&A Homes worked with Building America's IBACOS and architects Pfaffmann & Associates and Moss Associates to design energy-efficient homes for urban in-fill lots. This is a new market for S&A Homes, which builds over 500 homes a year using suburban designs.

  1. Intersetorialidade na política de saúde do idoso

    Directory of Open Access Journals (Sweden)

    Grossi, Patricia Krieger

    2006-01-01

    Full Text Available Este artigo versa sobre a intersetorialidade na política de saúde do idoso. Apresenta uma discussão referente à conceituação e à construção da intersetorialidade. Aborda a saúde do idoso nos aspectos conceituais, legais e no enfrentamento de problemas concretos

  2. Software reference for SaTool - a Tool for Structural Analysis of Automated Systems

    DEFF Research Database (Denmark)

    Lorentzen, Torsten; Blanke, Mogens

    2004-01-01

    This software reference details the functions of SaTool – a tool for structural analysis of technical systems. SaTool is intended used as part of an industrial systems design cycle. Structural analysis is a graph-based technique where principal relations between variables express the system...

  3. MENDORONG PASAR MODAL EFISIEN DAN BERDAYA SAING GLOBAL

    Directory of Open Access Journals (Sweden)

    Satia Nur Maharani

    2006-01-01

    Full Text Available Globalisasi semakin memperpendek jarak dan waktu. Kemampuannya mampu  merubah wajah planet bumi menjadi” just a small village “ melalui peningkatan ilmu pengetahuan dan teknologi. Perubahan tersebut bertransformasi pula pada  sistem ekonomi. Modal berdiri sendiri tanpa identitas dan siapa saja berhak untuk berinvestasi tanpa batas melalui sebuah mekanisme antar negara dan benua. Salah satu lintasan modal untuk meraih keuntungan adalah melalui mekanisme pasar modal. Pasar modal manakah yang diminati oleh arus modal masuk adalah pasar modal yang mampu memberikan jamuan terbaik berupa keuntungan yang tinggi dengan resiko yang optimal. Maka untuk mencapai pelayan yang maksimal bagi masyarakat pemodal , pasar modal harus efisien dan berdaya saing global. Maka keterbukaan informasi, peningkatan teknologi, efisiensi biaya penegakan hukum, partisipasi masyarakat dan pemerintah, inovasi produk mutlak untuk dievaluasi dan ditingkatkan

  4. Saúde mental: reconstruindo saberes em enfermagem

    Directory of Open Access Journals (Sweden)

    Francisca Bezerra de Oliveira

    2003-02-01

    Full Text Available O manicômio, apesar de criticado, reformado ou mesmo negado, ainda é uma prática preponderante no cuidado às pessoas com transtornos mentais. Tal prática tem como princípio básico o isolamento do doente mental, contrariando todas as possibilidades de assistência centrada num humanismo ético. Este ensaio procura interpretar a institucionalização do asilo, da psiquiatria, da doença mental e o processo da reforma psiquiátrica, buscando contribuir para as reflexões acerca da desinstitucionalização e dos saberes e práticas de enfermagem em saúde mental.

  5. Saúde bucal no Brasil Oral health in Brazil

    OpenAIRE

    Vitor Gomes Pinto

    1983-01-01

    Apresenta-se um retrato sobre a saúde bucal no Brasil, com ênfase em informações relativas à situação econômica e epidemiológica, prevenção da cárie dental, recursos humanos, montante de gastos financeiros e estrutura de prestação de serviços. O país mostra quadro típico de uma área em desenvolvimento, com elevada incidência de problemas, crescente oferta de cirurgiões-dentistas e difícil acesso aos serviços ofertados mormente face a barreiras de ordem econômica. Visando expandir cuidados odo...

  6. A interface entre Saúde Pública e Cibercultura

    OpenAIRE

    Eduardo Jorge Sant Ana Honorato

    2014-01-01

    Este artigo, de caráter opinativo, propõe uma reflexão sobre como está a relação entre a cibercultura e a saúde pública e sua utilização como meio de pesquisa, e não apenas como instrumento. Cibercultura seria então uma nova forma de relação entre sujeitos. É justamente "através" e "pelas" relações sociais que os indivíduos adquirem habilidades técnicas e comunicação. Mudam-se as formas relacionais, os meios, mas os fins permanecem os mesmos: o de estarem em contato com outros humanos. Nas úl...

  7. Biodiversidade, biotecnologia e saúde Biodiversity biotechnology and health

    OpenAIRE

    Garcia, Eloi S.

    1995-01-01

    Este artigo apresenta a importância da biodiversidade, da biotecnologia a da saúde e discute vários aspectos dos problemas biológicos, ambientais e o dilema ético, relacionados com a expansão e a exploração dos recursos naturais em razão das quais espécies de plantas e animais têm sido extintas. Por outro lado, o conhecimento da biodiversidade tem possibilitado a identificação e a utilização de novos recursos naturais para a melhoria da vida do homem neste planeta. É importante que nossos pes...

  8. Teaching Computer System-DMT DESIGN(SA.1

    Directory of Open Access Journals (Sweden)

    A. O. Shteynberg

    2012-01-01

    Full Text Available Тhe paper introduces the training computer system of sub- agential type based on a didactic multidimensional technology. The methodology bases incorporate the systematic activity approach, some elements of artificial intelligence theory, and the instrumental didactic theory and technology developed by Scientific Experimental Laboratory at Bashkirsky State Pedagogical University. The above training system – Didactic Multidimensional Technology Design of Sub-Agential Type (DMT_DESIGN (SA.1 – has been developed for raising teachers’ technological competence and creativity regarding both the general and vocational education. Its training structure is specified by invariant socio-cultural and anthropological bases; logically semantic modeling of course materials is provided. The research data can be used by people, engaged in developing educational information technologies; practicing teachers; and post-graduates conducting research and implementing the findings. 

  9. Editorial challenges of the Revista de Saúde Pública.

    Science.gov (United States)

    Antunes, José Leopoldo Ferreira; França Júnior, Ivan; de Andrade, Maria Teresinha Dias; Barata, Rita de Cássia Barradas; Monteiro, Carlos Augusto

    2015-07-01

    The editors of the Revista de Saúde Pública describe the journal's editorial profile and discuss the challenges of scientific publication in the area. A historical overview of almost 50 years of the journal is reported, with the temporal projection of their bibliometric indicators. Qualitative and quantitative parameters of its editorial profile and indexes are also reported. Budget constraints and the actions being taken to address them are discussed. The difficulty in allocating reviewers for manuscripts submitted to the editorial process is also discussed; an issue that affects scientific publication in many areas of knowledge. In particular, we sought to reflect on the proposal of measures to boost the editorial process by alleviating the shortage of reviewers and their possible harmful consequences for the editorial process. PMID:26132238

  10. Trudnoća u bolesnica sa sustavnim eritemskim lupusom

    OpenAIRE

    Anić, Felina; Novak, Srđan

    2012-01-01

    Sustavni eritemski lupus (SLE) kronična je upalna autoimuna bolest. Najčešće obolijevaju žene fertilne dobi, pa se međusoban utjecaj trudnoće i sustavnog eritemskog lupusa nameće kao značajan klinički i terapijski problem. Hormonski i imuni utjecaji koji se događaju u normalnoj trudnoći različito se reflektiraju na patogenetske mehanizme, tako da tijekom trudnoće može doći do pogoršanja osnovne bolesti, koje se prvenstveno manifestira u vidu kožnih i zglobnih manifestacija. U bolesnica sa SLE...

  11. 美国SA8000标准介绍

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    20世纪末期,欧洲、美国和澳大利亚都先后出现了一些关于“企业社会责任”的多边组织,并逐步形成了一些评价体系和认证制度。SA8000(Social Accoutability 8000的英文简称)是其中最有名的标准之一。企业社会责任是指企业在赚取利润的同时,主动承担对环境、社会和利益相关者的

  12. 企业社会责任与SA8000

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    国际市场正逐渐认可的一种新兴的标准体系——SA8000(Social Accoutability 8000,社会责任标准8000),社会责任国际(Social Accountability International,简称SAI)是SA8000标准(即社会责任标准)的制订和执行机构,其前身为1997年成立的美国经济优先认可委员会(CEPAA),总都设在美国纽约,2001年该组织更改为现名。这个全球首个对企业进行道德规范的标准自1997年问世以来,受到了公众极大的关注,如同ISO9000、ISO14000、HACCP等标准体系,已成为国际市场的“通行证”。尽管国内对这个标准还有不同意见,但是通过规范的制度化的约束机制来推动企业社会责任建设,是一个必然的趋势。海尔集团首席执行官张瑞敏说;“责任和利润不是博弈关系。人们对百年老店做过调查,他们都倡导社会责任第一,利益、利润第二。”(以下中译文仅供参考)

  13. An efficient hybrid evolutionary optimization algorithm based on PSO and SA for clustering

    Institute of Scientific and Technical Information of China (English)

    Taher NIKNAM; Babak AMIRI; Javad OLAMAEI; Ali AREFI

    2009-01-01

    The K-means algorithm is one of the most popular techniques in clustering. Nevertheless, the performance of the Kmeans algorithm depends highly on initial cluster centers and converges to local minima. This paper proposes a hybrid evolutionary programming based clustering algorithm, called PSO-SA, by combining particle swarm optimization (PSO) and simulated annealing (SA). The basic idea is to search around the global solution by SA and to increase the information exchange among particles using a mutation operator to escape local optima. Three datasets, Iris, Wisconsin Breast Cancer, and Riplcy's Glass, have been considered to show the effectiveness of the proposed clustering algorithm in providing optimal clusters. The simulation results show that the PSO-SA clustering algorithm not only has a better response but also converges more quickly than the K-means, PSO, and SA algorithms.

  14. Bangalore, ville des nouvelles technologies

    Directory of Open Access Journals (Sweden)

    Clarisse Didelon

    2003-06-01

    Full Text Available Bangalore est devenue la Silicon Valley de l’Inde. Une partie de ses habitants y vit à l’occidentale mais le reste de la population souffre de la croissance spectaculaire de la ville. Face à l’insuffisance des infrastructures, Bangalore devient de moins en moins attractive pour les entreprises internationales.

  15. Une nouvelle génération féministe au sein de l’islam traditionaliste : Une exception indonésienne ?

    Directory of Open Access Journals (Sweden)

    Andrée Feillard

    2012-01-01

    Full Text Available Le militantisme en faveur du droit des femmes a plus d’un siècle d’histoire en Indonésie, mais la chute du Président Soeharto en 1998 a accéléré la compétition entre deux courants, avec d’un côté les partisans d’une islamisation du droit et de l’autre ceux qui s’y opposent fermement, un courant qui comprend notamment les féministes islamiques issues du milieu de l’islam traditionaliste. Le discours islamiste touche les questions de moralité, du corps et du rôle public de la femme indonésienne. Parmi les débats récents, symboles des enjeux politiques et idéologiques, nous analysons celui concernant la loi contre la pornographie régulant la question de la décence vestimentaire au niveau national, ainsi que la campagne en faveur de la polygamie, une pratique encore récusée par la majorité des Indonésiens. Soutenues par de jeunes oulémas libéraux, les féministes indonésiennes ont créé un contre-discours basé sur de nouvelles interprétations coraniques, savamment argumentées. Leur éducation – elles sont souvent diplômées des universités islamiques d’État (UIN, IAIN –, leur confère la légitimité nécessaire à ce travail d’interprétation. Désormais, les femmes pieuses défendent leur propre cause et non plus celle des hommes. Nous suggérons que cette exception féministe islamique est due en partie à des conditions historiques particulières qui ont affaibli le mouvement féministe séculariste, en particulier la répression anticommuniste de 1965 et la perte de légitimité progressive des musulmans javanais auparavant hindo-bouddhistes, taxés par les musulmans pieux d’abanganisme (mauvais musulmans depuis le xixe siècle. Cependant, ce féminisme islamique « traditionaliste » a récemment provoqué une offensive en retour des conservateurs, sans doute encouragés par le décès d’Abdurrahman Wahid, protecteur des libéraux, le 30 décembre 2009.

  16. Qualidade de vida relacionada à saúde de filhos de profissionais da área de saúde

    Directory of Open Access Journals (Sweden)

    Silvia Maria Moussi Gamallo

    2012-12-01

    Full Text Available Neste estudo mensuramos a qualidade de vida relacionada à saúde (QVRS e a fadiga de filhos de profissionais da área da saúde, com idades entre 2 e 11 anos, e avaliamos os hábitos diários e o sono dessas crianças e dos respectivos pais. Foram incluídas no estudo crianças de uma escola pública. Dados demográficos e dados de hábitos diários foram colhidos. A QVRS, o sono e a fadiga foram mensurados por questionários. Participaram 249 pais - 63,5% referiram sono adequado e 47,4% acordavam cansados. A média da idade das crianças foi 5,6 anos - 62,2% assistiam televisão no quarto, 50% usavam computador (> 4 horas/dia e 27,8% faziam atividades físicas extracurriculares. O escore do sono foi de 45,8 ± 12,2. Os escores de QVRS foram mais elevados no aspecto físico e mais baixos no emocional. Detectamos que o sono de pior qualidade dos filhos e dos pais pode estar relacionado à pior QVRS dos filhos. Concluímos que os hábitos inadequados dos pais, bem como das crianças, estão relacionados a uma diminuição da QVRS dos filhos, especialmente no aspecto emocional.

  17. Dinamičke simulacije solarnih kombi-sustava sa sezonskim sorpcijskim spremnikom topline: Utjecaj konfiguracije kombi-sustava.

    OpenAIRE

    Hennaut, Samuel; Thomas, Sébastien; Davin, Elisabeth; Skrylnyk, Alexandre; Frere, Marc; Andre, Philippe

    2012-01-01

    Ovaj članak je fokusiran na dimenzioniranje solarnog kombi-sustava sa sezonskim adsorpcijskim spremnikom topline sa ciljem autonomnog solarnog grijanja prostora. Dvije konfiguracije kombi-sustava su simulirane, uključujući jedan ili dva toplinska spremnika. Utjecaj sezonskog skladištenja energije na dimenzioniranje spremnika je također diskutirano. Analiza je vršena simulacijom u programu TRNSYS. Rezultati analize pokazuju da je performansa sustava sa dva spremnika bolja (2 do 4% sa sezonskim...

  18. Une nouvelle branche d’industrie : l’art d’extraire la gélatine des os dans la première moitié du xixe siècle

    OpenAIRE

    Lieffroy, Céline

    2010-01-01

    L’histoire de la gélatine est traditionnellement marquée par un échec, celui de Jean-Pierre-Joseph d’Arcet (1777-1844) de créer un aliment nouveau. L’objet de ce travail est de revenir sur ce point de vue en montrant au contraire comment cette substance est devenue, au cours de la première moitié du XIXe siècle, l’objet d’une nouvelle branche d’industrie. Les travaux du chimiste industriel d’Arcet sur les procédés d’extraction comme son attention portée à l’adéquation des qualités de la produ...

  19. La nouvelle directive européenne en matière d’expérimentation animale et l’échelle des êtres sensibles. Du dualisme au gradualisme

    OpenAIRE

    Rémy, Catherine

    2011-01-01

    Au-delà d’une volonté de réduction des divergences entre pays européens, la nouvelle directive européenne en matière d’expérimentation animale attribue un statut spécifique aux primates non humains. Ce nouveau statut met en péril le geste de substitution qui se trouve au fondement de l’utilisation du "modèle animal". Par ailleurs, cette directive se traduit par l’instauration d’une échelle des êtres sensibles gradualiste qui actualise des tensions et débats récurrents au sein du monde de l’ex...

  20. La Nouvelle-Calédonie, un « point chaud » de la biodiversité mondiale gravement menacé par l’exploitation minière

    OpenAIRE

    Richer de Forges, Bertrand; Pascal, Michel

    2011-01-01

    Une synthèse des connaissances relatives aux caractéristiques des peuplements animaux et végétaux de la Nouvelle-Calédonie met en évidence leur exceptionnelle richesse spécifique et leur fort taux d’endémisme. Une originalité supplémentaire caractérise ces peuplements : le micro-endémisme manifesté par la majorité de leurs espèces. Ce micro-endémisme rend particulièrement vulnérable la biodiversité néo-calédonienne aux agressions et tout particulièrement à celles d’origine anthropique : explo...

  1. « Hommes fainéants et indolents, femmes dissolues… » Paresse et travail à Santa Fe de Bogota (Nouvelle Grenade), XVIIIe siècle

    OpenAIRE

    Lopez-Bejarano, Pilar

    2007-01-01

    Cette recherche explore, pour la ville de Santa Fe de Bogota (Nouvelle-Grenade), différents aspects de la problématique historique des rapports de travail et des jugements de paresse adressés à la population tout au long du XVIIIe siècle. L’étude propose ainsi une approche locale et urbaine des Réformes du XVIIIe siècle (Reformas Borbónicas), en articulant différentes échelles qui vont de la position générale des colonies dans l’empire ibérique, aux formes particulières de travail des habitan...

  2. Cartographie thématique des mangroves du littoral sud-ouest de Nouvelle-Calédonie = Thematic mapping of mangroves of the South West coasts of New Caledonia

    OpenAIRE

    Thollot, Pierre; Albert, Frédéric; Meaille, R

    1992-01-01

    Les mangroves du littoral sud-ouest de Nouvelle-Calédonie ont été cartographiées par traitement d'images satellitaires SPOT. Plusieurs axes de recherche ont été développés selon l'échelle de nos investigations. D'une part, les mangroves du littoral sud-ouest (entre Moindou et Goro) ont été identifiées, localisées selon trois niveaux de densité (clairsemée, faible et forte). D'autre part, la composition floristique de la mangrove de Prizbuer/Bouraké a été définie au cours d'une analyse thémati...

  3. Etude de la biologie générale, et plus particulièrement du régime alimentaire de Lethrinus nebulosus du lagon d'Ouvéa (Nouvelle Calédonie)

    OpenAIRE

    Egretaud, Charles

    1992-01-01

    Ce mémoire réalisé sur 1342 #L. nebulosus$ (Forskall), capturés à la ligne à main dans 129 stations du lagon d'Uvéa (Nouvelle Calédonie) a pour but de préciser un certain nombre de points de la biologie de ce poisson, et de son comportement alimentaire en particulier. La relation taille-poids ...., la distribution des classes de taille (75% des poissons sont compris entre 300 et 450mm), les variations de sex-ratio (prépondérance des femelles dans les classes de tailles supérieures), et la rép...

  4. Ta’zie (le théâtre religieux) vs Noruz (la nouvelle année et ses rituels): les enjeux de la politique du patrimoine immatériel de l’humanité en Iran

    OpenAIRE

    Bromberger, Christian

    2013-01-01

    En 2005, l’Iran a soumis à l’UNESCO deux dossiers de candidature de chefs d’œuvre du patrimoine immatériel, l’un sur le ta’zie ou shabikhâni (une forme de tragédie religieuse propre à l’islam chiite), le second sur les rituels de Noruz (la nouvelle année, qui coïncide avec l’équinoxe de printemps). L’Iran retira finalement la candidature du ta’zie et ne maintint que celle de Noruz qui fut rejetée par le jury de l’UNESCO au motif que le dossier était incomplet, ce qui suscita amertume et polém...

  5. Pascaline Gaborit (dir.), News Medinas : vers des villes nouvelles durables ? Expériences croisées au nord et au sud de la Méditerranée

    OpenAIRE

    Dugot, Philippe

    2015-01-01

    Qu’est-ce qu’une ville durable ? À quelle(s) échelle(s) l’envisager ? Peut-elle se construire ex nihilo ? N’est-elle pas une nouvelle utopie urbaine ? Le thème produit plus de questions qu’il n’apporte de réponses, n’en déplaise aux producteurs d’idées toutes faites et autres promoteurs de réalisations enkystées dans un organisme urbain bien plus vaste et aux interactions complexes. On doit d’autant se garder de la promotion de telle ou telle expérimentation que celles-ci sont souvent le prod...

  6. Vigilância ambiental em saúde e sua implantação no Sistema Único de Saúde

    Directory of Open Access Journals (Sweden)

    Christovam Barcellos

    2006-02-01

    Full Text Available A incorporação da vigilância ambiental no campo das políticas públicas de saúde é uma demanda relativamente recente no Brasil. Um dos principais desafios da vigilância ambiental em saúde é a definição do seu objeto e a especificidade de suas ações. O conceito ampliado de exposição, tratado não como um atributo da pessoa, mas do conjunto de relações complexas entre a sociedade e o ambiente, é central para a definição de indicadores e para a orientação da prática de vigilância ambiental. Entre as dificuldades encontradas para sua efetivação no Sistema Único de Saúde estão a necessidade de reestruturação das ações de vigilância em saúde e a formação de equipes multidisciplinares, com capacidade de diálogo com outros setores, além da construção de sistemas de informação capazes de auxiliar a análise de situações de saúde e a tomada de decisões. Nesse sentido, foi realizada uma revisão do objeto e conceitos da vigilância ambiental em saúde, bem como identificados os desafios para a sua implantação no Sistema Único de Saúde.

  7. Diretrizes Curriculares na saúde e as mudanças nos modelos de saúde e de educação

    Directory of Open Access Journals (Sweden)

    Carlos Otávio Fiúza Moreira

    2015-12-01

    Full Text Available Artigo produzido a partir de pesquisa bibliográfica e de questões formuladas para uma conferência no módulo “Educação na Saúde II” do Mestrado Profissional da Rede Nordeste de Formação em Saúde da Família. O texto discute questões dos campos da saúde e da educação relacionadas à emergência de novos modelos de saúde e de formação; analisa também as Diretrizes Curriculares Nacionais (DCN de três cursos da área da saúde (Medicina, Enfermagem e Odontologia como expressão desses novos modelos para saúde e para a educação. Uma questão transversal ao artigo são as relações entre os campos da saúde e da educação. Para isto, lança‑se mão do conceito de campo, desenvolvido pelo sociólogo Pierre Bourdieu. Considera‑se, ainda, o desafio de transformar as DCN em currículos e programas, ferramentas ou dispositivos necessários para fazer a passagem do que está prescrito para os cenários de ensino e aprendizagem.

  8. Hortas comunitárias como atividade promotora de saúde: uma experiência em Unidades Básicas de Saúde

    Directory of Open Access Journals (Sweden)

    Christiane Gasparini Araújo Costa

    2015-10-01

    Full Text Available ResumoA agricultura urbana e periurbana (AUP vem sendo praticada em diferentes espaços, contribuindo para a melhoria da saúde nas comunidades e ambientes mais saudáveis. Objetivando identificar significados e repercussões da prática da AUP em Unidades Básicas de Saúde (UBS, enquanto uma atividade de Promoção da Saúde (PS, e em que medida sua dimensão terapêutica a caracteriza como uma atividade alinhada às práticas integrativas e complementares, foi realizado um estudo transversal com abordagem qualitativa no município de Embu das Artes, SP. Da análise, emergiram as seguintes categorias: concepção de saúde, resultados na saúde, resgate de práticas e hábitos tradicionais e reorientação dos serviços de saúde. Identificou-se a estreita ligação entre a prática das hortas e as diretrizes e campos de ação da PS como: criação de ambientes saudáveis, reforço da ação comunitária, desenvolvimento de habilidades pessoais, estímulo à autonomia e empoderamento e demandas por reorientação dos serviços. As atividades de horta instituídas nas UBS se mostraram uma estratégia de implementação das práticas integrativas e complementares (PIC. Conclui-se que as atividades de cultivo nas hortas comunitárias mostram-se como práticas promotoras da saúde que integram elementos fundamentais das PIC.

  9. Avaliação do Programa de Educação pelo Trabalho para Saúde - PET-Saúde/Vigilância em Saúde pelos seus atores

    OpenAIRE

    Liziane Maahs Flores; Ana Luiza Trindade; Daiane Rodrigues de Loreto; Beatriz Unfer; Marinel Mór Dall’Agnol

    2015-01-01

    O PET-Saúde/VS da Universidade Federal de Santa Maria, Rio Grande do Sul, Brasil, surgiu para realizar ações de vigilância emergenciais às vítimas do desastre em casa noturna de Santa Maria e a análise situacional em saúde do município. Entendendo que a avaliação é essencial para o planejamento, a implementação e o funcionamento de qualquer programa, elaborou-se um questionário para avaliar o PET-Saúde/VS por sua equipe. As perguntas tratavam da contribuição do programa para a formação acadêm...

  10. 78 FR 47778 - Verizon Business Networks Services, Inc. Senior Analysts-Sales Impletmentation (SA-SI) Birmingham...

    Science.gov (United States)

    2013-08-06

    ... Impletmentation (SA-SI) Birmingham, Alabama; Verizon Business Networks Services, Inc. Senior Analysts-Sales Impletmentation (SA-SI) Service Program Delivery Division San Francisco, California; Verizon Business Networks Services, Inc.Senior Analysts-Sales Impletmentation (SA-SI) Alpharetta, Georgia: Amended...

  11. Mga Lente sa Likod ng Lente: Isang Panimulang Pag-aaral ng Ilang Litratong Kuha ni Xander Angeles

    Directory of Open Access Journals (Sweden)

    Moreal Nagarit Camba

    2011-12-01

    Full Text Available Ang pangalang Xander Angeles ay kilala bilang isa sa mga in-demand napangalan sa mundo ng fashion at advertisement sa Pilipinas. Kakabit ngpangalang ito ang samut-saring lokal at internasyunal na parangal; idagdag pa rito ang isang advertising company, isang modelling agency, at isang fashion and photography school.

  12. STRATEGI PENINGKATAN DAYA SAING RUMAH POTONG AYAM PT XYZ

    Directory of Open Access Journals (Sweden)

    Arli Arli

    2012-07-01

    chicken-based food company in Indonesia.Keywords:  competitiveness, global value chain, poultry slaughterhouse, PT XYZABSTRAKTujuan penelitian ini adalah (1 menganalisis peran aktor-aktor di dalam rantai nilai Rumah Potong Ayam (RPA PT XYZ  yang berpengaruh terhadap daya saingnya, (2 menganalisis para pemain kunci dalam stakeholders RPA PT XYZ , (3 menganalisis faktor-faktor internal dan eksternal (IE yang berpengaruh terhadap daya saing RPA PT XYZ , (4 memformulasikan tujuan dan sasaran jangka panjang strategik untuk meningkatkan daya saing RPA PT XYZ , (5 menganalisis alternatif dan prioritas strategi untuk meningkatkan daya saing RPA PT XYZ . Metode yang digunakan adalah analisis deskriptif. Analisis yang digunakan adalah global value chain, analisis stakeholder, internal factor evaluation, external factor evaluation, matriks IE, SWOT, dan quantitative strategic planning matrix. Hasil dari analisis global value chain, analisis stakeholders, analisis internal dan eksternal, dan visi-misi perusahaan, tujuan jangka panjang adalah (a menyediakan nilai tambah bagi pelanggan, (b memaksimalkan laba dari hasil operasi bisnis, (c meningkatkan kesejahteraan stakeholders, (d melakukan kegiatan sustainable business. Hasil matriks IE dan analisis SWOT, strategi untuk mencapai sasaran dan tujuan jangka panjang strategik adalah (a meningkatkan efektivitas dan efisiensi manajemen rantai pasok; (b mengimplementasikan evaluasi kinerja untuk pegawai dan partner bisnis; (c memperkuat  citra sebagai perusahaan domestik penghasil makanan olahan berbasis daging ayam berkualitas tinggi di Indonesia; (d meningkatkan kegiatan penelitian dan pengembangan; (e membangun aliansi strategik dengan pemasok ayam hidup eksternal; (f melakukan sosialisasi mengenai pentingnya konsumsi protein hewani kepada masyarakat Indonesia. Tiga strategi prioritas dari analisis QSPM adalah meningkatkan efektivitas dan efisiensi rantai pasok, mengimplementasikan evaluasi kinerja untuk pegawai dan partner bisnis, dan

  13. Improvement in Mechanical Properties of SA508 Gr.1a Piping Material by Modifying Microstructure

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jin Weon; Choi, Myung Rak [Chosun Univ., Gwangju (Korea, Republic of); Oh, Young Jin; Park, Heung Bae; Kim, Kyung Su [KEPCO E-C, Yongin (Korea, Republic of)

    2014-10-15

    It is attempted to apply LBB concept to the design of secondary piping systems, such as main-steam line and feed-water line. But, for obtaining sufficient margin in LBB analysis for these piping systems, it is necessary to reduce the applied loads by improving structural design and to employ piping material with higher toughness and strength than existing piping materials such as SA106 Gr.C and SA106 Gr.B carbon steels. SA508 Gr.1a ferritic steel has been used for the reactor coolant system (RCS) piping in KSNP (Korea Nuclear Power Plant) and is known to have good toughness and strength as well as weld ability. Such characteristics provide a sufficient margin in the LBB analysis for RCS piping. Based on SA508 Gr.1a piping material, thus, this study attempts to obtain a further improved piping material by modifying microstructure of SA508 Gr.1a without change of chemical composition. In order to obtain a modified microstructure, thus, this study simply heat-treated again SA508 Gr.1a piping material at the same heat-treatment condition that had been employed in the fabrication of SA508 Gr.1a piping material. The microstructure is composed of the homogeneous mixture of fine-grained ferrite and bainite. This is different from that of as-received SA508 Gr.1a. This difference is associated with different size of object to be heat-treated. This shows that SA508 Gr.1a piping material has a microstructure with fine-grained ferrite and bainite mixture, which provides good toughness and strength, if it is properly heat-treated. Tensile and J-R tests were conducted using specimens machined form modified SA508 Gr.1a piping material given by heat-treated, and the results were compared with those tested from as-received SA508 Gr..1a piping material. At 316 .deg. C, however, both strength and elongation of modified SA508 Gr.1a are higher than those of as-received SA508 Gra.1a. The results of J-R tests showed that J-R curve of modified SA508 Gr.1a is almost the same as that of as

  14. A inserção da vigilância em saúde ambiental no sistema único de saúde

    Directory of Open Access Journals (Sweden)

    Edenilo Baltazar Barreira Filho

    2012-03-01

    Full Text Available A inserção das atividades de vigilância ambiental no SUS apresenta algumas características que se diferenciam das práticas de vigilância epidemiológica. Isto ocorre principalmente em decorrência de que muitos dados sobre a exposição aos fatores ambientais são obtidos fora do setor saúde e a adoção de ações que busquem controlar e/ou prevenir exigem, na grande maioria dos casos, uma compreensãoe articulação intra e intersetorial, pois o setor saúde não é capaz de, sozinho, dar respostas as questões de saúde ambiental.Nos últimos anos vem consolidando-se cada vez mais o campo da saúdeambiental, que compreende a área da saúde pública, afeita ao conhecimento científico, à formulação de políticas públicas e às correspondentes intervenções (ações relacionadas à interação entre a saúde humana e os fatores do meio ambiente natural e antrópico que a determinam, condicionam e influenciam, com vistas a melhorar a qualidade de vida do ser humano sob o ponto de vista dasustentabilidade(1.Conforme entendimento acordado no I Seminário da Política Nacional de Saúde Ambiental, realizado em outubro de 2005, e consolidado na primeira Conferência Nacional de Saúde Ambiental, realizada em dezembro de 2009, compreende-se como uma área de práticas intersetoriais e transdisciplinares voltadas aos reflexos, na saúde humana, das relações ecogeossociais do homem com o ambiente(1.Nesse sentido, o Ministério da Saúde vem implementando em todo o território nacional um Sistema de Vigilância em Saúde Ambiental (SINVISA, buscando o aprimoramento deste “modelo” de atuação e estabelecendo competências nas três esferas de gestão, com o objetivo de consolidar a prática da Saúde Ambiental dentro do SUS.A Instrução Normativa nº 1, de 7 de março de 2005, cria o SINVISA, estabelece a área de atuação, as competências para as três esferas de Gestão do SUS e define a Vigilância em Saúde Ambiental como sendo

  15. O gênero masculino e os cuidados de saúde: a experiência de homens de um centro de saúde

    Directory of Open Access Journals (Sweden)

    Daniele Natália Pacharone Bertolini

    2014-12-01

    Full Text Available Compreender como os homens de um Centro de Saúde se comportam quanto aos cuidados com a saúde. Estudo qualitativo, realizado em um Centro de Saúde Escola que selecionou por conveniência e entrevistou 15 indivíduos do gênero masculino, adultos e organizou os dados conforme o Discurso do Sujeito Coletivo. Emergiram quatro ideias centrais que retratam os motivos para procurar o serviço, problemas de saúde, atitudes diante desses problemas e participação nas atividades da unidade. Esses indivíduos são assíduos, se preocupam em seguir as recomendações recebidas e utilizam o atendimento individual, preferencialmente, por falta de tempo, mas demonstram interesse em participar de atividades em grupo. Isto deve ser utilizado pelo serviço como oportunidade de intensificar a participação deles em grupo específico já existente para homens, que oferece um espaço de acolhimento e escuta de problemas diversos, sendo uma forma de reintegração desses indivíduos junto ao serviço de saúde.

  16. Controle social do Sistema Único de Saúde: o que pensam os conselheiros municipais de saúde

    Directory of Open Access Journals (Sweden)

    Vera Dib Zambon

    2013-12-01

    Full Text Available Desafios estão presentes para a consolidação da participação da comunidade e este estudo objetiva analisar o controle social na perspectiva dos conselheiros municipais de saúde. Trata-se de estudo de abordagem qualitativa utilizando entrevistas semiestruturadas. Identificou-se que alguns conselheiros não reconhecem a participação social como diretriz do Sistema Único de Saúde. Apesar do reconhecimento dos conselhos como espaços deliberativos, identificam-se dificuldades como a centralização das decisões na gestão, a valorização do saber técnico e a não realização de conferências de saúde. Há limitações no efetivo exercício do papel de conselheiro, dificuldade de interlocução com as bases de representação e de acesso a informações. Aponta-se a necessidade de articulação dos conselheiros e capacitações. Conclui-se pela necessidade de valorização dos espaços colegiados instituídos no Pacto pela Saúde, para fortalecimento do controle social, com destaque à educação permanente em saúde.

  17. Preliminary treatment of bovine mastitis caused by Staphylococcus aureus, with trx-SA1, recombinant endolysin of S. aureus bacteriophage IME-SA1.

    Science.gov (United States)

    Fan, Jindai; Zeng, Zhiliang; Mai, Kaijie; Yang, Yu; Feng, Jiaqi; Bai, Yang; Sun, Baoli; Xie, Qingmei; Tong, Yigang; Ma, Jingyun

    2016-08-15

    Methicillin-resistant Staphylococcus aureus (MRSA) has become a great threat to human and animal health and there is an urgent need to develop novel antibacterial agents to control this pathogen. The objective of this study was to obtain an active recombinant endolysin from the novel bacteriophage (IME-SA1), and conduct an efficacy trial of its effectiveness against bovine mastitis. We isolated a phage that was virulent and specific for S. aureus with an optimal multiplicity of infection of 0.01. Electron microscopy revealed that IME-SA1 was a member of the family Myoviridae, with an isometric head (98nm) and a long contractile tail (200nm). Experimental lysis experiments indicated the phage had an incubation period of 20min with a burst size of 80. When host bacteria were in early exponential growth stages, a multiplicity of infection of 0.01 resulted in a complete bacterial lysis after 9h. The endolysin gene (804bp) was cloned into the pET-32a bacterial expression vector and recombinant endolysin Trx-SA1 was successfully obtained with molecular size of about 47kDa. Preliminary results of therapeutic trials in cow udders showed that Trx-SA1 could effectively control mild clinical mastitis caused by S. aureus. The endolysin Trx-SA1 might be an alternative treatment strategy for infections caused by S. aureus, including MRSA. PMID:27374909

  18. Complexidade em Saúde da Família e formação do futuro profissional de saúde

    Directory of Open Access Journals (Sweden)

    Rodrigo Otávio Moretti-Pires

    2009-09-01

    Full Text Available As características do Sistema Único de Saúde (SUS e da Estratégia de Saúde da Família (ESF os aproximam do pensamento complexo, termo que não se refere à adjetivação de fenômeno de aspectos múltiplos, e sim ao marco teórico e epistemológico. Indícios de inadequação da formação dos profissionais de saúde para a atuação em Saúde da Família levaram a proposta de levantar a formação desses profissionais para a abordagem ampliada de saúde implicada no SUS/ESF. Foram realizados grupos focais com acadêmicos de Enfermagem, Medicina e Odontologia da Universidade Federal do Amazonas, analisado sob a perspectiva hermenêutica dialética. Os dados apontaram para a formação reducionista/biomédica nas três profissões assim como o foco no trabalho individual, e não em equipe multiprofissional, quadro inadequado ao SUS/ESF, que preconiza atuação profissional focada na complexidade do entorno sócioeconômico e antropológico dos usuários do sistema.

  19. Condicionalidades em saúde do programa Bolsa Família – Brasil: uma análise a partir de profissionais da saúde

    Directory of Open Access Journals (Sweden)

    Alice Teles de Carvalho

    2014-12-01

    Full Text Available Este estudo apresenta a percepção de profissionais de equipes de Saúde da Família de municípios do Nordeste do Brasil acerca das mudanças na vida das famílias participantes do programa Bolsa Família, da relação destas com os serviços de saúde e do impacto na dinâmica de trabalho dos profissionais, a partir do acompanhamento das condicionalidades de saúde do programa Bolsa Família. As informações foram obtidas por meio de entrevistas semiestruturadas e encontros de grupo focal. Os profissionais acreditam que o programa ocasionou mudanças favoráveis na vida das famílias participantes, como a redução da pobreza, o aumento da frequência escolar das crianças e mudanças positivas na relação entre as famílias participantes e os serviços de saúde. No entanto, relataram dificuldades de caráter organizacional no acompanhamento das condicionalidades, sobretudo devido ao aumento da demanda de trabalho. É importante que as condicionalidades de saúde proporcionem oportunidades para a realização de ações que visem ao empoderamento e autonomia dos sujeitos quanto ao autocuidado e desenvolvimento da cidadania.

  20. Trabalho, saúde e regime contratual para pessoal de enfermagem: um foco psicosocial

    OpenAIRE

    Guerrero, Juan; PULIDO, GUILLERMO

    2011-01-01

    O cooperativismo associado tem sido o mecanismo predileto de flexibilização de trabalho no sistema de saúde colombiano. Contudo, apesar das múltiplas referências de seus efeitos negativos nas condições de trabalho, ainda não se realizou uma pesquisa específica sobre seus efeitos a saúde do pessoal de enfermagem. Esta pesquisa objetiva definir e comparar as condições de trabalho e saúde do pessoal auxiliar e profissional de enfermagem, segundo a modalidade contratual e outras condi...

  1. em saúde e doença mental

    Directory of Open Access Journals (Sweden)

    Neuza Maria de Fátima Guareschi

    2008-01-01

    Full Text Available This article aims at discussing social vulnerability from an experiment carried out with users of the Day-Hospital Program. This program, proposed by Sistema Único de Saúde, is a strategy directed towards another social agency of madness, distinct from the model of the hospice culture, with health practices that may lead to social exclusion and stigma. This study has been structured from a weekly activity developed in a Day-Hospital of a public general hospital in Rio Grande do Sul, through participative observations’. The group was constituted as a speech space in which users could talk about daily practices, sharing different ways of thinking and feeling the experience of psychic distress. Aiming at debating upon how the condition of social vulnerability has been produced in carriers of psychic distress, we have considered discursive practices of mental health public policies, from the Psychiatric Reform, as well as the notion of performativity in the production of mental health/disease. The forms these subjects think of and recognize both themselves and the world become visible through certain identity marks that constitute them as mentally ill. Even being a program situated in the field of the Psychiatric Reform, the Day-Hospital is still crossed by meanings from both the hospital-centered psychiatric discourse about madness and the medicamentous therapeutic practice, which have inscribed ways of subjects living mental health/disease with strict possibilities of subjectifying themselves out of this logic.

  2. SA BASED SOFTWARE DEPLOYMENT RELIABILITY ESTIMATION CONSIDERING COMPONENT DEPENDENCE

    Institute of Scientific and Technical Information of China (English)

    Su Xihong; Liu Hongwei; Wu Zhibo; Yang Xiaozong; Zuo Decheng

    2011-01-01

    Reliability is one of the most critical properties of software system.System deployment architecture is the allocation of system software components on host nodes.Software Architecture (SA)based software deployment models help to analyze reliability of different deployments.Though many approaches for architecture-based reliability estimation exist,little work has incorporated the influence of system deployment and hardware resources into reliability estimation.There are many factors influencing system deployment.By translating the multi-dimension factors into degree matrix of component dependence,we provide the definition of component dependence and propose a method of calculating system reliability of deployments.Additionally,the parameters that influence the optimal deployment may change during system execution.The existing software deployment architecture may be ill-suited for the given environment,and the system needs to be redeployed to improve reliability.An approximate algorithm,A*_D,to increase system reliability is presented.When the number of components and host nodes is relative large,experimental results show that this algorithm can obtain better deployment than stochastic and greedy algorithms.

  3. AUTOMATIZACIÓN DE OFICINAS S.A.

    Directory of Open Access Journals (Sweden)

    Luis Carlos Diaz Osorio

    1998-01-01

    Full Text Available El caso muestra la situación de Automatización de Oficinas S.A., una empresa de gran trayectoria nacional, orientada a la comercialización de muebles y equipos para oficina. A principios de la década pasada, comenzó a comercializar microcomputadoras y elementos de conectividad de redes, manejando grandes márgenes por ser monopolio, aprovechando los beneficios de importación que le otorgaba el ser exportador de muebles. En el momento en que se abren las importaciones, más de doscientas empresas entran a competir en el mercado de los microcomputadores, llegando incluso a manejar márgenes de hasta el 10%. Las ventas de la empresa han bajado a niveles alarmantes, incluso se cree que únicamente compran empresas allegadas a los directivos o personas que no conocen nada del tema de los computadores. La situación puntual es la toma de decisión de las estrategias para ser competitivos o decidir salir del mercado de los PC. La orientación que hemos decidido darle al caso es “fijación de precios”.

  4. A PARADIGMA FOGALMÃ NAK ALKALMAZÃ SA A MEZÅ GAZDASÃ GBAN

    OpenAIRE

    Meszaros, Sandor

    2006-01-01

    A paradigma fogalmát (a korábbi nyelvészetinél) szélesebb értelemben Thomas Samuel Kuhn amerikai fizikus és tudománytörténész vezette be „A tudományos forradalmak szerkezete†c., 1962-ben megjelent művében. Ezt a könyvet a XX. század legvitatottabb, ugyanakkor szűkebb szakterületén kívül is legismertebb tudományfilozófiai munkájának tartják. Nem véletlen, hogy magyar fordítása is jó néhány kiadásban megjelent. A szerző haláláig (1996) eltelt jó három évtized főként a szűkebb szakmán (tudom...

  5. Saúde bucal no Brasil Oral health in Brazil

    Directory of Open Access Journals (Sweden)

    Vitor Gomes Pinto

    1983-08-01

    Full Text Available Apresenta-se um retrato sobre a saúde bucal no Brasil, com ênfase em informações relativas à situação econômica e epidemiológica, prevenção da cárie dental, recursos humanos, montante de gastos financeiros e estrutura de prestação de serviços. O país mostra quadro típico de uma área em desenvolvimento, com elevada incidência de problemas, crescente oferta de cirurgiões-dentistas e difícil acesso aos serviços ofertados mormente face a barreiras de ordem econômica. Visando expandir cuidados odontológicos e reduzir a incidência dos principais problemas, propõe-se um programa de serviços básicos de âmbito nacional.The oral health situation in Brazil is described, with special emphasis on data relating to the economic and epidemiological situation, caries prevention, human resources, health expenditure and dental care structure. The country presents a picture typical of a developing area, with high disease rates, an increase in the offer of dentists and access to dental care hindered principally by economic barriers. A comprehensive program of basic services in odontology is proposed, with the objective of expanding dental care and reducing the incidence of more prevalent problems.

  6. PRODUCTIVITY AND QUALITY: A STRATEGY FOR THE SA DEFENCE FORCE

    Directory of Open Access Journals (Sweden)

    R. Eberlein

    2012-02-01

    Full Text Available In recent times the SA Defence Force (SADF has been bombarded with a variety of methods and approaches to the improvement of productivity, financial savings and, most recently, for quality of work life or quality assurance. Various approaches have included the concepts of Total Quality Management (TQM, Quality Circles (and variants in the guise of Triads and others, Methodology, Unit Management Systems, Cost Control Systems, Deterministic Productivity Accounting and the Iike. There have been many benefits to be found in these various approaches, each of which concentrates on certain aspects of productivity. That there have been great achievements in productivity in the SADF is a matter of record, a record which is reflected in a National Award for Productivity, a smaller more efficient SADF, and a reputation for submitting more recommendations for improvements than other departments in the Public Service. At a more personal level though, the writer has gained the impression that no or very little attempt has been made to integrate selected aspects of these approaches into an overall "productivity” strategy acceptable to the SADF. That there is a need for such an overall strategy is clear from the sentiments expressed recently by the members of the SADF's Productivity Co-ordination Committee when attempting to indicate the way ahead to even greater productivity in the SADF (Meeting, January 1991. In this paper a strategy for the improvement of productivity and the quality of work life which is acceptable to the SADF is proposed.

  7. Saúde sexual dos adolescentes segundo a Pesquisa Nacional de Saúde dos Escolares Sexual health of adolescents according to the National Survey of School Health

    OpenAIRE

    Deborah Carvalho Malta; Marta Angélica Iossi Silva; Flávia Carvalho Malta de Mello; Rosane Aparecida Monteiro; Denise Lopes Porto; Luciana Monteiro Vasconcelos Sardinha; Paula Carvalho de Freitas

    2011-01-01

    O objetivo deste estudo foi descrever as situações relacionadas à saúde sexual dos adolescentes, segundo a Pesquisa Nacional de Saúde do Escolar (PeNSE). Trata-se de um estudo transversal, realizado pelo Instituto Brasileiro de Geografia e Estatística (IBGE) em parceria com o Ministério da Saúde, que envolveu 60.973 escolares e 1.453 escolas públicas e privadas. A análise dos dados aponta que 30,5% (IC95% 29,9-31,2) dos adolescentes já tiveram relação sexual alguma vez na vida, sendo mais fre...

  8. A integração da Saúde Mental na Estratégia Saúde da Família

    OpenAIRE

    Carmen Lúcia Albuquerque de Santana

    2014-01-01

    Introdução A integração da saúde mental (SM) na atenção primária (AP) é a principal garantia de acesso da população às boas práticas em SM. Embora amplamente recomendada há décadas, existem poucos modelos de integração efetiva da SM na AP. Em 2008 o Ministério da Saúde do Brasil criou o Núcleo de Apoio à Saúde da Família (NASF), que passou a ser o responsável pela integração da SM na AP. O objetivo deste estudo é conhecer, a partir da ótica dos gerentes da AP, como se dá a integração da SM n...

  9. Fatores relacionados à saúde da mulher no puerpério e repercussões na saúde da criança

    OpenAIRE

    Raquel Dully Andrade; Jaqueline Silva Santos; Maria Ambrosina Cardoso Maia; Débora Falleiros de Mello

    2015-01-01

    Objetivo: Apresentar uma reflexão acerca de alguns fatores relacionados à saúde da mulher no período puerperal e suas repercussões sobre a saúde da criança. Métodos: Estudo teórico-reflexivo, baseado na literatura e na percepção das autoras, buscando discutir a atenção à saúde materno-infantil no puerpério. Resultados: O estudo ressaltou aspectos referentes aos temas: A indissociabilidade do cuidado à mãe e à criança no puepério; Desafios do aleitamento materno; Importância do planejamento fa...

  10. A promoção da saúde na percepção do docente de enfermagem: perspectivas para a saúde do trabalhador

    Directory of Open Access Journals (Sweden)

    Raquel Juliana de Oliveira Soares

    2012-04-01

    Full Text Available  IntroduçãoA discussão sobre promoção da saúde no contexto deste estudo vem ao encontro do novo paradigma no contexto da saúde do trabalhador1. O novo paradigma que custeia esta discussão são as ações de promoção da saúde diferentemente daquelas que trabalham a medicina do Trabalho e a saúde Ocupacional. Nesta perspectiva, ao longo da sua evolução, o conceito de Promoção da Saúde vem sofrendo modificações, tendo como pano de fundo os períodos históricos ao qual foram desenvolvidos. Historicamente, o trabalhador vem sendo sacrificado, em detrimento das políticas organizacionais que imperam em cada época. Desde a antiguidade, onde o trabalhador era tratado como escravo, a falta do reconhecimento daqueles que trocam/vendem seus esforços físicos e intelectuais para gerar um produto que proporciona lucro e conseqüentemente o crescimento do país é visível e infelizmente aceitável por muitos. Com o passar dos séculos, pouca coisa foi progredindo com relação aos trabalhadores. Pode-se dizer que o grande marco para o início do desenvolvimento de uma sistematização voltada para a saúde do trabalhador aconteceu na Inglaterra, com a Revolução Industrial e com a criação do primeiro serviço médico voltado para o trabalhador, dando origem assim a medicina do trabalho enquanto especialidade médica2. Porém o trabalhador ainda hoje sofre com grande demanda de trabalho e pouco reconhecimento. E com o docente de enfermagem não é diferente. O trabalho do professor não se restringe ao exercício de sua função dentro da sala de aula, exige atualização e preparo constantes para ser realizado de modo satisfatório. Dentro da sala de aula, além de lidar com os imprevistos que geram um desgaste psíquico e emocional, como recurso audiovisual solicitado não estar disponível, ar condicionado que nem sempre funciona, entre outros; o professor também tem de lidar com situações que levam a um desgaste físico, como

  11. Functional interplay between SA1 and TRF1 in telomeric DNA binding and DNA-DNA pairing.

    Science.gov (United States)

    Lin, Jiangguo; Countryman, Preston; Chen, Haijiang; Pan, Hai; Fan, Yanlin; Jiang, Yunyun; Kaur, Parminder; Miao, Wang; Gurgel, Gisele; You, Changjiang; Piehler, Jacob; Kad, Neil M; Riehn, Robert; Opresko, Patricia L; Smith, Susan; Tao, Yizhi Jane; Wang, Hong

    2016-07-27

    Proper chromosome alignment and segregation during mitosis depend on cohesion between sister chromatids. Cohesion is thought to occur through the entrapment of DNA within the tripartite ring (Smc1, Smc3 and Rad21) with enforcement from a fourth subunit (SA1/SA2). Surprisingly, cohesin rings do not play a major role in sister telomere cohesion. Instead, this role is replaced by SA1 and telomere binding proteins (TRF1 and TIN2). Neither the DNA binding property of SA1 nor this unique telomere cohesion mechanism is understood. Here, using single-molecule fluorescence imaging, we discover that SA1 displays two-state binding on DNA: searching by one-dimensional (1D) free diffusion versus recognition through subdiffusive sliding at telomeric regions. The AT-hook motif in SA1 plays dual roles in modulating non-specific DNA binding and subdiffusive dynamics over telomeric regions. TRF1 tethers SA1 within telomeric regions that SA1 transiently interacts with. SA1 and TRF1 together form longer DNA-DNA pairing tracts than with TRF1 alone, as revealed by atomic force microscopy imaging. These results suggest that at telomeres cohesion relies on the molecular interplay between TRF1 and SA1 to promote DNA-DNA pairing, while along chromosomal arms the core cohesin assembly might also depend on SA1 1D diffusion on DNA and sequence-specific DNA binding. PMID:27298259

  12. Pesquisa em saúde, política de saúde e eqüidade na América Latina

    Directory of Open Access Journals (Sweden)

    Alberto Pellegrini Filho

    2004-06-01

    Full Text Available O autor analisa as relações entre pesquisa de saúde, políticas de saúde e eqüidade na América Latina. Descreve novas tendências no modo de produção do conhecimento, que permitem maior integração entre as necessidades sociais e a pesquisa, facilitando o vínculo entre esta e o processo de definição de políticas. Analisa as manifestações das novas tendências na América Latina e finaliza com a descrição de algumas iniciativas promovidas pela OPAS no sentido de aproveitar as oportunidades abertas pelas novas tendências para a melhoria das condições de saúde na região. Busca defender a tese de que a informação e o conhecimento são bens públicos essenciais e que as iniqüidades de acesso a esses bens são importantes determinantes das iniqüidades em saúde. Para que as políticas de saúde e as políticas de pesquisa em saúde se integrem e se consolidem como políticas públicas voltadas a atender ao interesse público e à promoção da eqüidade, é necessário o fortalecimento do processo democrático de definição das mesmas, multiplicando os atores envolvidos, os espaços e oportunidades de interação entre eles e instrumentando sua participação com o acesso eqüitativo a informações e conhecimentos científicos pertinentes que permitam a defesa fundamentada de seus interesses.

  13. Cadeia de valor da saúde: um modelo para o sistema de saúde brasileiro Healthcare value chain: a model for the Brazilian healthcare system

    Directory of Open Access Journals (Sweden)

    Marcelo Caldeira Pedroso

    2012-10-01

    Full Text Available Este artigo apresenta um modelo de cadeia de valor da saúde que representa, de maneira esquemática, o sistema de saúde do Brasil. O modelo proposto tem como intuito apresentar uma adequação à realidade brasileira, bem como abrangência e flexibilidade para utilização em atividades acadêmicas e análises do setor de saúde do Brasil. O modelo coloca ênfase em três componentes: principais atividades dessa cadeia, agrupadas em elos verticais e horizontais; missão de cada um desses elos; e principais fluxos da cadeia. A cadeia proposta é formada por seis elos verticais e três horizontais, perfazendo um total de nove: desenvolvimento de conhecimento em saúde; fornecimento de produtos e tecnologias; serviços de saúde; intermediação financeira; financiamento da saúde; consumo de saúde; regulação; distribuição de produtos de saúde; e serviços de apoio e complementares. A análise da cadeia proposta pode ser realizada por meio de quatro fluxos: inovação e conhecimento; produtos e serviços; financeiro; e de informação.This article presents a model of the healthcare value chain which consists of a schematic representation of the Brazilian healthcare system. The proposed model is adapted for the Brazilian reality and has the scope and flexibility for use in academic activities and analysis of the healthcare sector in Brazil. It places emphasis on three components: the main activities of the value chain, grouped in vertical and horizontal links; the mission of each link and the main value chain flows. The proposed model consists of six vertical and three horizontal links, amounting to nine. These are: knowledge development; supply of products and technologies; healthcare services; financial intermediation; healthcare financing; healthcare consumption; regulation; distribution of healthcare products; and complementary and support services. Four flows can be used to analyze the value chain: knowledge and innovation; products and

  14. Stress ocupacional em profissionais de saúde e seus efeitos a nível individual (saúde psicológica) e organizacional (comprometimento afectivo)

    OpenAIRE

    Pinheiro, Sandra Angelina da Costa

    2011-01-01

    Dissertação de mestrado integrado em Psicologia (área de especialização em Psicologia do Trabalho, das Organizações e Recursos Humanos) Os efeitos negativos do stresse na saúde e bem-estar têm sido estudados em vários grupos de profissionais, todavia, existem razões especiais como referem Quick, Murphy & Hurrel (1992) e Melo, Gomes & Cruz (1997) para constituir os profissionais da saúde como um grupo particularmente afectado pelo stress. O objectivo desta dissertação é o estud...

  15. 马兰士 SA-13S2 SACD/CD播放机

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    SA-13S2内部的规划十分整齐,所使用的激光读取模组是新开发的SACDM-10.有厚达2mm的钢板作为机箱底座.再加上新开发的SACDM-10激光读取机构。光碟的读出精度有很大的提升,同时还减轻噪音辐射。SA-13S2采用了马兰士公司独家开发的HDAM模组,同样配备了马兰士SACD播放机SA-7S1采用的著名的第二代HDAM(High Definition Amplifier Module)SA2放大模组。

  16. SA-MAC:Self-Stabilizing Adaptive MAC Protocol for Wireless Sensor Networks

    Institute of Scientific and Technical Information of China (English)

    波澄; 韩君泽; 李向阳; 王昱; 肖波

    2014-01-01

    A common method of prolonging the lifetime of wireless sensor networks is to use low power duty cycling protocol. Existing protocols consist of two categories: sender-initiated and receiver-initiated. In this paper, we present SA-MAC, a self-stabilizing adaptive MAC protocol for wireless sensor networks. SA-MAC dynamically adjusts the transmission time-slot, waking up time-slot, and packet detection pattern according to current network working condition, such as packet length and wake-up patterns of neighboring nodes. In the long run, every sensor node will find its own transmission phase so that the network will enter a stable stage when the network load and qualities are static. We conduct extensive experiments to evaluate the energy consumption, packet reception rate of SA-MAC in real sensor networking systems. Our results indicate that SA-MAC outperforms other existing protocols.

  17. Psicologia da saúde nos cuidados primários

    OpenAIRE

    Teixeira, José A. Carvalho

    1994-01-01

    Começa-se por definir o que é a Psicologia da Saúde e por delimitar o seu campo em relação a psicossomática. Seguidamente apresentam-se algumas das potencialidades da intervenção psicológica nos cuidados primários, quer em relação a saúde pública quer em relação a Medicina familiar, que parecem relevantes para a promoção da saúde. Em particular, identificamse áreas nas quais será produtiva a colaboração entre médicos e psicólogos na perspectiva da saúde comunitária. ...

  18. Gemini surfactants affect the structure, stability, and activity of ribonuclease Sa.

    Science.gov (United States)

    Amiri, Razieh; Bordbar, Abdol-Khalegh; Laurents, Douglas V

    2014-09-11

    Gemini surfactants have important advantages, e.g., low micromolar CMCs and slow millisecond monomer ↔ micelle kinetics, for membrane mimetics and for delivering nucleic acids for gene therapy or RNA silencing. However, as a prerequisite, it is important to characterize interactions occurring between Gemini surfactants and proteins. Here NMR and CD spectroscopies are employed to investigate the interactions of cationic Gemini surfactants with RNase Sa, a negatively charged ribonuclease. We find that RNase Sa binds Gemini surfactant monomers and micelles at pH values above 4 to form aggregates. Below pH 4, where the protein is positively charged, these aggregates dissolve and interactions are undetectable. Thermal denaturation experiments show that surfactant lowers RNase Sa's conformational stability, suggesting that surfactant binds the protein's denatured state preferentially. Finally, Gemini surfactants were found to bind RNA, leading to the formation of large complexes. Interestingly, Gemini surfactant binding did not prevent RNase Sa from cleaving RNA. PMID:25133582

  19. Breve olhar sobre o estado da saúde em Portugal

    OpenAIRE

    Cortes, Maria

    2016-01-01

    O estado de saúde da população reflete, não só a capacidade de resposta e qualidade do setor da saúde, mas também o progresso que se verifica na sociedade em termos económicos e sociais. Tendo uma natureza cumulativa e intersetorial, a saúde resulta de um conjunto de determinantes sociais (por exemplo, educação, rendimento, etc.) e não apenas do investimento na prestação de cuidados de saúde. Neste artigo analisa-se brevemente o percurso do planeamento estratégico em Portugal, assim como algu...

  20. Data of evolutionary structure change: 1A4SA-2ONNF [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A4SA-2ONNF 1A4S 2ONN A F AQLVDSMPSASTGSVVVTDDLNYWGGRRIKSKDGATTEP...KVMEMSAK-TVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQREIMPQFLEEVVKRTKAIVVG...ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEA...HHHHH ------ EEE EEEEEE HHHHHHHH EEEE HHHHHHHHHH EEE GGG EEE GGG EEEEEEEEE -- ... 2ONN F 2ONNF

  1. Desenvolvimento da especialidade saúde e trabalho, no departamento de enfermagem do Hospital Virtual Brasileiro

    Directory of Open Access Journals (Sweden)

    Nascimento Regina Helena do

    2003-01-01

    Full Text Available O objetivo deste estudo é criar uma página na internet, sobre a especialidade Saúde e Trabalho, no Departamento de Enfermagem do Hospital Virtual Brasileiro. A estrutura da página está dividida nos seguintes temas: Sistema Único de Saúde (SUS; SUS x Norma Operacional de Saúde do Trabalhador (NOST; Breve histórico da organização do trabalho; Qualidade de vida; Eventos e links sobre o tema. Foi utilizada a metodologia de navegação e programação HTML (hyper text markup language para o desenvolvimento das páginas WWW, revisão bibliográfica dos últimos anos, através de bibliotecas e da própria internet; além da revisão por especialistas na área de Saúde e Trabalho.

  2. Effect of salicylic acid (SA) on delaying fruit senescence of Huang Kum pear

    Institute of Scientific and Technical Information of China (English)

    ZHANG Yuxing; DU Guoqiang; WANG Guoying; ZHANG Jianghong; Hassan Imran

    2007-01-01

    This experiment was undertaken to explore the effect of salicylic acid (SA) at different concentrations on regulating fruit senescence ofHuang Kum pear.Through dipping fruits and fruit discs for a series of hours in SA solution,enzyme activities and physiological characteristics of Huang Kum pear were determined.The results revealed that SA enhanced the activity of superoxide dismutase (SOD) and peroxidase (POD) enzymes at 0.02 mmol/L and at 0.002 mmol/L with the treatment of dipping fruit discs for 4 h and 12 h,respectively.The malondialdehyde (MDA) contents were reduced at 0.002 mmol/L for 12 h,and water loss ratio was decreased at 0.5 mmol/L after 48 h of treatment.It was concluded that SA at lower concentrations could delay the senescence of Huang Kum pear fruit.

  3. Nouvelles approches en theorie du champ moyen dynamique: le cas du pouvoir thermoelectrique et celui de l'effet orbital d'un champ magnetique

    Science.gov (United States)

    Arsenault, Louis-Francois

    , cette approche donne une bonne representation de S lorsque le systeme devient coherent. Les calculs montrent aussi que la formule Kelvin est precise lorsque la fonction spectrale des electrons devient incoherente, soit a plus haute temperature. Dans la limite Kelvin, S est essentiellement l'entropie par particule, tel que propose il y a longtemps. Nos resultats demontrent ainsi que la vision purement entropique de S est la bonne dans le regime incoherent, alors que dans le regime coherent, l'approche a frequence infinie est meilleure. Nous avons utilise une methode a la fine pointe, soit le Monte-Carlo quantique en temps continu pour resoudre la DMFT. Pour permettre une exploration rapide du diagramme de phase, nous avons du developper une nouvelle version de la methode des perturbations iterees pour qu'elle soit applicable aussi a forte interaction au-dela de la valeur critique de la transition de Mott. Un autre sujet a aussi ete aborde. L'effet orbital du champ magnetique dans les systemes electroniques fortement correles est une question tres importante et peu developpee. Cela est d'autant plus essentiel depuis la decouverte des oscillations quantiques dans les supraconducteurs a haute temperature (haut- Tc). Par desir de developper une methode la moins biaisee possible, nous avons derive la DMFT lorsqu'un champ se couplant a l'operateur energie cinetique par la substitution de Peierls est present. Ce type d'approche est necessaire pour comprendre entre autres l'effet de la physique de Mott sur des phenomenes tels que les oscillations quantiques. Nous avons obtenu un resultat tres important en demontrant rigoureusement que la relation d'auto-coherence de la DMFT et le systeme intermediaire d'impurete quantique restent les memes. L'effet du champ peut etre contenu dans la fonction de Green locale, ce qui constitue la grande difference avec le cas habituel. Ceci permet de continuer a utiliser les solutionneurs d'impuretes standards, qui sont de plus en plus puissants

  4. 出口企业应关注SA8000标准认证

    Institute of Scientific and Technical Information of China (English)

    李志军

    2004-01-01

    @@ 一、SA8000标准的宗旨与主要内容 SA8000标准(Social Accountability 8000)是根据国际劳工组织(ILO)公约、联合国儿童权利公约及世界人权宣言制定的,其宗旨是为了保护劳工基本权益.

  5. A vision of Smart Grid deployment at ENERGA-OPERATOR SA

    OpenAIRE

    Sławomir Noske; Adam Babś; Krzysztof Madajewski

    2012-01-01

    ENERGA-OPERATOR SA as a power distribution system operator is working on preparing its network for current and future challenges facing the energy sector. The strategy will be based on a smart grid development plan to be carried out by ENERGA-OPERATOR SA. The article describes key elements of the smart grid implementation vision which is the first stage of the work on the smart grid development roadmap.

  6. Planos privados de assistência à saúde: cobertura populacional no Brasil

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Pinto

    2004-01-01

    Full Text Available Foram utilizados o Cadastro de Beneficiários da Agência Nacional de Saúde Suplementar (ANS e a Pesquisa Nacional por Amostra de Domicílios (PNAD/IBGE para descrever o perfil da cobertura dos serviços por planos privados de saúde. Apesar da regulação pela ANS, não se deve perder de vista que o acesso, a utilização e a cobertura populacional em planos de saúde precisam ser periodicamente monitorados, principalmente na região Sudeste, que concentra 70% da população coberta por planos de saúde. Também são necessários estudos mais detalhados sobre as capitais brasileiras, que constituem grandes centros de concentração de clientela; e investigações para os subgrupos etários que mais utilizam os serviços de saúde: crianças menores de 5 anos, mulheres em idade fértil e idosos. Os resultados do estudo indicam que, no Sistema de Saúde Brasileiro, os planos privados de assistência à saúde se configuram como mais um fator de geração de desigualdades sociais no acesso e na utilização de serviços de saúde, pois cobrem apenas uma parcela específica da população brasileira: pessoas de maior renda familiar, de cor branca, com maior nível de escolaridade, inseridas em determinados ramos de atividade do mercado de trabalho, moradores das capitais/regiões metropolitanas.

  7. Sur la route du Boson des idées de Brout, Englert et Higgs à la naissance d'une nouvelle particule

    CERN Document Server

    Badaud, Frédérique; Madar, Romain; Orloff, Jean; Bernet, Lison

    2015-01-01

    Ce carnet décrit la formidable aventure technique et humaine qui a abouti à la découverte du boson de Higgs. Cette aventure, racontée par quatre physiciens qui travaillent depuis des années au sein de cette fourmilière de dix mille techniciens et chercheurs du monde entier basée au CERN de Genève, révèle une vaste coopération humaine et un voyage fantastique dans la pensée. L’ouvrage s’inscrit dans la volonté de vulgariser cette découverte qui n’est qu’une étape du programme scientifique de l’accélérateur de particules situé à cent mètres sous terre entre la Suisse et la France. Particularité : une mascotte présente presque sur toutes les doubles-pages interpelle et accompagne le lecteur dans sa lecture.

  8. A finitude humana e a saúde pública Human finitude and public health

    Directory of Open Access Journals (Sweden)

    Sergio Rego

    2006-08-01

    Full Text Available A morte é uma questão implícita na prática e na formação dos profissionais da saúde. Há, todavia, uma tendência dos profissionais de saúde de restringir sua discussão aos aspectos meramente técnicos, seja na assistência à saúde, seja nas ações de saúde pública. Este artigo analisa a importância da adoção do cuidado de qualidade no fim de vida como norteador das práticas assistenciais e a necessidade de que o campo da Saúde Pública tome esses cuidados como objeto de reflexão e de pesquisas. Por fim, aponta-se para aspectos relevantes para a formação de profissionais de saúde para que sejam respeitadores das diferenças e comprometidos com o diálogo.Death is an implicit subject in both health practice and health professionals' training. There is a tendency by health professionals to reduce this analysis merely to technical aspects. This paper analyzes the importance of adopting quality care at the end of life as a guide for public health care. We highlight relevant aspects for training health professionals to respect moral differences and to be prepared to discuss their own points of view.

  9. Kakaibang Halimuyak: Iba't Ibang Imahe ng Pangangapital sa Balintawak

    Directory of Open Access Journals (Sweden)

    Mariah Amour C. Miranda

    2015-06-01

    Full Text Available Ginagalugad ng sanaysay na ito ang isang pangunahing lugar na nadaraanan mula Norte patungong Maynila—ang Balintawak. Nagsisilbing manibela ng pagsusuri ang kontemporaneong pananaw sa lunan bilang pugad ng mga anyong may magkakasalungat na kahulugan. Binibigyang-pansin ng sanaysay ang iba't ibang imahe ng pagbebenta na matatagpuan sa Balintawak: ang billboard ng kumpanyang Bench na siyang pinakamalaki, ang mismong palengke, at ang mga lakong paninda sa tabing-kalsada. Sa pamamagitan nito, maipapakita ng sanaysay kung paano madadalumat ang Balintawak bilang isang panlipunang texto na sumasalamin sa mga magkakaibang pangangapital sa naturang lunan. This essay explores the space of Balintawak—a focal point of urban travel from northern Luzon to Manila. Using the contemporary view on space as a site of structures with contradictory meanings, the study seeks to understand how various images of market activities in Balintawak create meaningful representations. These images include the gigantic billboard of Bench, the central market itself, and flea markets in the area. The essay shows how Balintawak as a social text serves as a trading center of different forms of capital.

  10. Biodiversidade, biotecnologia e saúde Biodiversity biotechnology and health

    Directory of Open Access Journals (Sweden)

    Eloi S. Garcia

    1995-09-01

    Full Text Available Este artigo apresenta a importância da biodiversidade, da biotecnologia a da saúde e discute vários aspectos dos problemas biológicos, ambientais e o dilema ético, relacionados com a expansão e a exploração dos recursos naturais em razão das quais espécies de plantas e animais têm sido extintas. Por outro lado, o conhecimento da biodiversidade tem possibilitado a identificação e a utilização de novos recursos naturais para a melhoria da vida do homem neste planeta. É importante que nossos pesquisadores se envolvam na luta pela preservação do ecossistema tropical. Os programas de exploração da biodiversidade devem estar baseados em sólidos conhecimentos científicos e favorecer ecológica e economicamente a sociedade.This article presents the significance of biodiversity, biotechnology and health and discusses many aspects of biological and environmental problems as well as the ethical dilemma related to expansion and exploitation of natural resources, which promoted a decline in biological diversity. In addition, knowledge of biodiversity has allowed for identification and use of new natural resources, useful for improving the quality of human life on Earth. It is important that our researchers engage themselves in the fight for preservation of the tropical ecosystem. Programs to exploit biodiversity must be based on solid scientific knowledge and favour society both ecologically and economically.

  11. GERDAU S.A.: a empresa brasileira mais internacionalizada

    Directory of Open Access Journals (Sweden)

    EVA STAL

    2007-07-01

    Full Text Available Muitas empresas dos países em desenvolvimento não se consideram aptas a explorar outrosmercados devido à distância tecnológica entre as empresas globais e os seus padrões locais. Oartigo mostra que existe espaço para a inovação empresarial oriunda de países emdesenvolvimento, e ela é um dos principais fatores responsáveis pelo sucesso de suasempresas na conquista do mercado mundial. Descreve o processo de expansão internacionalda Gerdau S.A., que começou com exportações e evoluiu para a aquisição de empresassiderúrgicas na América Latina, América do Norte e Europa, num total de 32 usinas em 10países, sendo 21 no exterior, que empregam mais de 32 mil funcionários. Hoje, a empresapossui valor de mercado estimado em 10 bilhões de dólares e 111.000 acionistas. Analisa-sesua estratégia de internacionalização à luz das teorias econômicas, comportamentais eestratégicas e verifica-se que a trajetória internacional pode ser explicada por aspectoscaracterísticos de cada uma dessas teorias. Um traço importante na cultura da empresa é atransferência de seu modelo de negócios, estrutura, valores e tecnologia para as empresasadquiridas, sem deixar de considerar as necessárias adaptações às culturas locais.

  12. Produção e citação em Saúde Coletiva: um olhar a partir dos periódicos Cadernos de Saúde Pública e Revista de Saúde Pública Output and citation in Public Health: a perspective based on the journals Cadernos de Saúde Pública and Revista de Saúde Pública

    Directory of Open Access Journals (Sweden)

    Leandro Carvalho

    2007-12-01

    Full Text Available O presente trabalho é um estudo bibliométrico comparativo entre as duas principais revistas científicas da área da Saúde Coletiva publicadas no Brasil: Cadernos de Saúde Pública (CSP e Revista de Saúde Pública (RSP. Foram analisados 24 fascículos de cada periódico, publicados entre 1996 e 2003, construindo uma amostra de 819 artigos (496 de CSP e 323 de RSP. Os seguintes elementos dos artigos foram identificados e analisados: área temática do artigo e padrão de citações de publicações (artigos em periódicos, livros e/ou capítulos de livro, teses/dissertações, documentos de Internet, "literatura cinzenta" e outros tipos de publicações. Os dados encontrados mostram que a maioria dos artigos publicados é da subárea "epidemiologia". O padrão de citação identificado nas revistas foi de citações a artigos em periódico em maior número, seguidas das citações a livros e/ou capítulos de livro. Artigos na subárea "ciências sociais em saúde" publicados em CSP apresentam características distintas, com maior número de citações a livros e capítulos. Os autores argumentam que as informações são relevantes na caracterização da produção da área, com desdobramentos importantes no plano da avaliação acadêmico-científica da Saúde Coletiva no país.This is a comparative bibliometric study of the two main scientific journals in the Public Health field in Brazil: Cadernos de Saúde Pública (CSP and Revista de Saúde Pública (RSP. Twenty-four issues of each periodical were analyzed, published from 1996 to 2003, comprising a sample of 819 articles (496 from CSP and 323 from RSP. The following elements in the articles were identified and analyzed: thematic area of the article and citation pattern of publications (articles in periodicals, books and/or book chapters, theses/dissertations, Internet documents, "gray" literature, and other types of publications. The resulting data showed that the majority of the

  13. Acupuntura e promoção de saúde: possibilidades no serviço público de saúde

    Directory of Open Access Journals (Sweden)

    Maria Elisa Rizzi Cintra

    2010-03-01

    Full Text Available O presente estudo objetivou analisar as possíveis contribuições da Acupuntura aplicada nos serviços públicos de saúde do município de São Paulo para a Promoção da Saúde. Foi utilizada a abordagem qualitativa de pesquisa, com uso de entrevistas em profundidade. Os resultados apontam que a Acupuntura praticada nos serviços públicos permite um trânsito interdisciplinar integrando a percepção do indivíduo sobre si mesmo e seu contexto, possibilitando mudanças nas causas primárias das doenças. Assim, o contato com a Acupuntura praticada nos serviços de saúde da rede municipal de São Paulo mostra-se passível de contribuir para o desenvolvimento de ações de Promoção de Saúde.

  14. Significados e sentidos das práticas de saúde: a ontologia fundamental e a reconstrução do cuidado em saúde

    Directory of Open Access Journals (Sweden)

    Tatiana de Vasconcellos Anéas

    2011-09-01

    Full Text Available O cuidado em saúde tem sido um tema abordado atualmente por autores da Saúde Coletiva. Essas práticas e estudos refletem dois modos aparentemente antagônicos de se conceber o cuidado, ora baseado na instrumentalidade, com ênfase nos procedimentos e nas intervenções técnicas, ora com foco na relação de encontro entre profissionais e usuários dos serviços de saúde. A partir de uma leitura crítica desse conjunto de estudos, procura-se não opor os dois grupos identificados, mas articulá-los em sua complementaridade por meio da ontologia fundamental de Martin Heidegger. Em Ser e Tempo, Heidegger desconstrói a ontologia tradicional para reconstruir uma nova ontologia que busque os fundamentos da existência humana. Um retorno aos fundamentos mostra-se essencial para uma reconstrução das práticas de saúde e do cuidado.

  15. Challenges of SA 8000 standard implantation: social responsibility at PETROBRAS LUBNOR; Os desafios da implantacao da Norma SA 8000: responsabilidade social na PETROBRAS LUBNOR

    Energy Technology Data Exchange (ETDEWEB)

    Abreu, Monica Cavalcanti Sa de [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Fac. de Economia, Administracao, Atuaria e Contabilidade. Dept. de Administracao de Empresas; Leal Neto, Antenor Gomes de Barros [PETROBRAS S.A., Fortaleza, CE (Brazil). Lubrificantes e Derivados de Petroleo do Nordeste (LUBNOR)

    2004-07-01

    This paper presents the developing steps during the establishment of Social Accountability SA 8000 standards in LUBNOR - a PETROBRAS refining plant at Ceara. The SA 8000 standards have been incorporated to Quality, Environmental, Health and Safety Integrated Management System in accordance with ISO 9001, ISO 14001 and OHSAS 18001. In order to implement the social accountability, the company established a work group task with a mission of communicating, maintaining and promoting some actions with all employees of the Refinery. The biggest challenge of implementing this standard is concerned with the compromise of the supply chain (consisting of suppliers and sub suppliers of products and services), the supervision of the labor task and the adequacy of the management system with the embodying of SA 8000 requisites. New demands were generated, for example: the election of the employee's representative; the celebration of a term of compromise with suppliers; the development of a follow up plan to figure out the supplier's performance; and, the monitoring of extra time worked. The establishment of SA 8000 is a way to stand out the effort at LUBNOR in order to improve the working environment conditions and to consolidate an administration committed with sustainable development and human being improvement. (author)

  16. Tumor imaging with 2 sigma-receptor ligands, F-18-FE-SA5845 and C-11-SA4503 : A feasibility study

    NARCIS (Netherlands)

    van Waarde, A; Buursma, AR; Hospers, GAP; Kawamura, K; Kobayashi, T; Ishii, K; Oda, K; Ishiwata, K; Vaalburg, W; Elsinga, PH

    2004-01-01

    Our objective was to study 2 radioligands for visualization of sigma-receptors with PET. Methods: Two radioligands--sigma(1)-selective C-11-1-(3,4-dimethoxyphenethyl)-4-(3-phenylpropyl)piperazine (C-11-SA4503) and nonsubtype-selective 1-(4-2'-F-18-fluoroethoxy-3-methoxyphenethyl)-4-(3-(4-fluoropheny

  17. A agência nacional de saúde suplementar - ANS: onze anos de regulação dos planos de saúde

    Directory of Open Access Journals (Sweden)

    Rachel Torres Salvatori

    2012-09-01

    Full Text Available Trata-se de um trabalho com objetivo de apresentar os principais resultados alcançados pela regulação dos planos de saúde exercida pela Agência Nacional de Saúde Suplementar, autarquia instituída para promover o equilíbrio das relações entre operadoras e consumidores, tornando o mercado de planos de saúde mais efi ciente. Como avanços mais significativos oriundos da regulação do setor podem ser citados: as barreiras à entrada e à saída das operadoras no mercado, a ampliação das coberturas assistenciais contratuais, o monitoramento e o controle dos reajustes, a indução a práticas de promoção da saúde e à qualifi cação do setor, e a possibilidade da portabilidade de carências. Como desafios a serem enfrentados, podem ser apontados: o monitoramento da qualidade da assistência prestada, a renúncia fiscal, a existência dos cartões de desconto, a operação de empresas como operadoras de planos de saúde sem o registro na ANS e a adoção de alguns mecanismos nocivos de regulação assistencial pelas operadoras de planos de saúde. ----- The National Agency of Supplementary Health – ANS: eleven years in regulating health insurance plans ----- ABSTRACT ----- This study aims to present the main results achieved in the regulation of health insurance plans through the National Agency of Supplementary Health, an agency set up to promote a balance in the relationship between health insurance plans and their consumers, making the health insurance market more efficient. As examples of the important progress achieved in regulating the sector, the authors emphasize: greater control of the infl ow and outfl ow of service operators in the market; the widening of contractual coverage; monitoring and control of readjustments; encouragement of health promotion practices and increased training in the sector; grace period flexibility. Examples of regulatory gaps however, include: problems monitoring the quality of the care provided

  18. Homens e saúde na pauta da Saúde Coletiva Men and health as targets of the Public Health

    Directory of Open Access Journals (Sweden)

    Lília Blima Schraiber

    2005-03-01

    Full Text Available Apresenta-se a temática "homens e saúde" como questão contemporânea da Saúde Coletiva e produto da interface entre as ciências humanas e a saúde: o caráter social do adoecimento; a perspectiva de gênero como forma particular da relação saúde-sociedade; e a promoção da saúde como conceituação positiva Elabora-se a temática em torno de três eixos de aproximação, sob a perspectiva dos exercícios das masculinidades: saúde sexual e reprodutiva; violência e gênero e morbi-mortalidade em homens. São apontadas as contribuições que estes eixos produzem como esforço empírico para realizar a categoria gênero, ao tempo em que revelam novas problemáticas para a área de saúde: a paternidade, o exercício interativo da sexualidade, a violência interpessoal no âmbito da vida privada, a hiper-masculinidade na violência entre homens, o cuidado de si e o cuidar em saúde para os homens. Estas contribuições permitirão não apenas inserir as masculinidades como questão de saúde, mas renovar as formas de tratamento de homens e mulheres no campo da saúde.It shows the thematic "men and health" as a contemporary matter of the Public Health and interface product among human sciences and health: the social view of illness; the gender perspective as a particular form of the relation health-society and the health promotion while positive means of health. It elaborates the thematic around three approach axises, conformed in the relation between men and health from the perspective of exercises of the masculinity: sexual and reproductive health; violence and gender, and morbid-mortality in men. The contributions that these axises produce are mentioned as empiric effort to accomplish the category gender, the time in which they reveal health new problems to the health's area: the paternity, the interactive exercise of the sexuality, the interpersonal violence in life closet scope, the hipper-masculinity in the violence among men, the

  19. Servir la Couronne: Les faux-pas du comte de Baños, vice-roi de la Nouvelle-Espagne (1660-1664

    Directory of Open Access Journals (Sweden)

    Ragon, Pierre

    2010-06-01

    Full Text Available Not available.

    A los pocos días de su llegada, el conde de Baños se enfrentó con los habitantes de su Virreinato: le culparon de ser arrogante, despectivo y de llevarse el dinero del rey. Tal concierto de quejas y denuncias en contra de un personaje tan eminente era algo bastante excepcional aunque, sí, no lo era su conducta ¿Cómo explicarlo? Entre la necesaria mano dura que exigiría un contexto difícil y el temperamento peculiar del mismo virrey, aquí se explora una tercera hipótesis, haciendo hincapié en el estatuto peculiar de la familia aristocrática a la que pertenecía y su trayectoria propia. [fr] Peu de temps après son arrivée, le comte de Baños vit se dégrader ses relations avec les habitants de la vice-royauté qu’il administrait: on l’accusa d’être arrogant, méprisant et de voler l’argent du roi. Une telle série d’attaques contre un personnage aussi haut placé était assez exceptionnelle même si ses écarts de conduite n’avaient rien d’inhabituel. Comment expliquer ce paradoxe? On a jusque-là évoqué les difficultés du moment qui exigeaient que le gouvernant se montrât ferme ainsi que le tempérament du vice-roi. Ici, une troisième hypothèse est explorée à partir de la prise en compte du caractère particulier de son statut au sein de l’aristocratie espagnole et de la trajectoire de sa famille.

  20. La nouvelle Afrique du Sud à la plage ! Usages et fréquentation de trois plages de la péninsule du Cap

    Directory of Open Access Journals (Sweden)

    Hélène Frogneux

    2010-09-01

    Full Text Available Le Cap est souvent considéré comme étant la plus européenne des villes sud-africaines. Sa situation littorale a contribué à en faire à la fois un port majeur et une destination balnéaire prisée, tant par les Sud-Africains que par les visiteurs étrangers. Comme tous les espaces publics, les plages tombaient, sous l’apartheid, sous le coup des lois de ségrégations. Elles sont aujourd’hui théoriquement ouvertes à tous. Mais le décalage entre déségrégation institutionnelle et déségrégation dans les faits est important. Les plages capetoniennes donnent donc un aperçu des grandes tendances à l’œuvre en Afrique du Sud à l’aube de la Coupe du Monde 2010.According to all, Cape Town is the most European of South-African cities. Due to its coastal situation Cape Town is both a major port and an appreciated seaside destination, both by the South-Africans and by the foreign tourists. As was every public space, beaches were segregated under apartheid. Nowadays they are theoretically open to everyone, without distinction of race. But there is a gap between institutional desegregation and the desegregation de facto. Capetonian beaches reflect the mutations and the changes going on at the dawn of the 2010 World Cup.

  1. Éthique des médias sociaux et economie de la participation: Vers une nouvelle approche editoriale? Une étude comparative

    Directory of Open Access Journals (Sweden)

    Laurent Fonnet

    2009-01-01

    Full Text Available Dans leur consommation des contenus numériques, les utilisateurs ne sont plus passifs. Ils prennent directement part à la conversation médiatique, qui n’est plus l’apanage des seuls professionnels. Ils deviennent ainsi une force à part entière, productive et critique, surtout à l’égard des professionnels de l’information, lesquels voient leur rôle transformé par l’émergence des médias sociaux. Un processus de co-création peut alors s’instaurer dans la fabrication du contenu. Illustré par la comparaison de trois sites français, Agoravox, Rue89 et LePost.fr, le phénomène encore émergent est ici analysé, à partir de la littérature et sous divers angles, notamment éthique. Dans cette étude exploratoire, les auteurs analysent d’une part les transformations du métier de journaliste: quelle est sa place en effet lorsque les médias deviennent relationnels? Peut-il être encore celui qui concoure à la circulation des idées? D’autre part, ils étudient, puis limitent, les implications éditoriales et éthiques de ce soi-disant journalisme “revenu aux sources”. Ils constatent notamment l’homogénéisation des approches au niveau international; “l’exception française” identifiée ne pourrait donc être que l’illustration d’une phase de transition, avant qu’un paradigme plus proche de celui étudié aux États-Unis ou dans les États nordiques ne s’impose.

  2. Concepção de enfermeiros de uma rede pública de saúde sobre Educação para a Saúde

    Directory of Open Access Journals (Sweden)

    Gisele Coscrato

    2013-06-01

    Full Text Available Estudo qualitativo que objetivou conhecer as concepções de 12 enfermeiros assistenciais, que compõem a rede pública de saúde de um município do interior paulista, sobre Educação para a Saúde, e propor ação educativa. Utilizou-se da metodologia da pesquisa-ação. A coleta dos dados ocorreu no segundo semestre de 2009, nas unidades públicas de saúde desse município. Foram usadas as técnicas de observação participante e entrevistas individuais. A análise e interpretação dos dados foi feita por categorização, fundamentada na teoria de Paulo Freire. Como resultados, revelou-se o reducionismo da Educação para a Saúde na abordagem pedagógica que envolvia a transmissão de conhecimentos, contemplando uma tendência biologicista da formação acadêmica. Porém, nos círculos de discussão, presumiu-se o despertar de uma consciência política relacionada à temática e à promoção da saúde. Concluindo, apreendeu-se a necessidade de mudanças na formação, e de viabilizar novos modos de produção de ciência, na busca pela transformação social.

  3. Suporte social, promoção de saúde e saúde bucal na população idosa no Brasil

    Directory of Open Access Journals (Sweden)

    Silvânia Suely Caribé de Araújo

    2006-06-01

    Full Text Available O crescente envelhecimento da população mundial, inclusive no Brasil, ressalta a importância de medidas para se lidar com esta situação. No Brasil, a maioria dos idosos é do sexo feminino; vive em domicílios multigeracionais; é referência econômica nos mesmos; possui baixo nível socioeconômico; portadora de, pelo menos, uma doença crônica; independente para realização das atividades da vida diária; não possui dentes, e busca atenção em saúde no SUS. Os idosos brasileiros expostos a situações de vulnerabilidade social estão sujeitos à interferência direta dos determinantes sociais no processo saúde-doença. O Suporte Social inclui políticas e redes de apoio social, que atuam como agente de integração do idoso na sociedade, minimizando os riscos de exclusão social e, conseqüentemente, de danos à sua saúde por meio de medidas de Promoção de Saúde. Este artigo aborda o Suporte Social e alguns de seus aspectos, tais como: tipo e local de residência, transporte e suporte financeiro; em idosos brasileiros e sua relação com a Promoção de Saúde.

  4. Ensino da saúde coletiva na Faculdade de Medicina do ABC: alguns apontamentos sobre os desafios da Saúde Coletiva na formação médica

    OpenAIRE

    Nivaldo Carneiro Junior

    2015-01-01

    Introdução: A saúde coletiva, campo de saberes e práticas sobre o processo saúde‑doença‑cuidado, leva às graduações em saúde questões teórico‑metodológicas e tecnologias de intervenções ao exercício profissional. Historicamente, posiciona‑se à margem do projeto político‑pedagógico da formação em saúde, particularmente médica, de modelo biologizante e hospitalocêntrico. De acordo com a Constituição de 1988, Saúde é um Direito Social e o Sistema de Saúde, público e universal. Surgem formulações...

  5. Produção bibliográfica brasileira da Saúde Bucal Coletiva em periódicos da saúde coletiva e da odontologia

    OpenAIRE

    Roger Keller Celeste; Cristine Maria Warmling

    2014-01-01

    O objetivo do presente estudo é descrever as características da produção científica no campo da saúde bucal coletiva em periódicos de saúde coletiva e de odontologia de âmbito nacional. Utilizou-se a base de resumos e citações Scopus, selecionando 8 periódicos de saúde coletiva e 10 de odontologia, de 1947 a 2011. Para identificação dos artigos, foi realizada estratégia de busca com palavras sobre saúde bucal na saúde coletiva e palavras de saúde coletiva na odontologia. As temáticas foram es...

  6. Institutos de pesquisa em saúde Health research institutes

    Directory of Open Access Journals (Sweden)

    Erney Plessmann Camargo

    2004-06-01

    Full Text Available Ao fim do século 19, em seguida aos avanços na assepsia cirúrgica e no esclarecimento do papel de microorganismos como causadores de moléstias infecciosas, foram criados em escala mundial "institutos de pesquisa com os objetivos de conduzir pesquisa sobre as causas, prevenção e tratamento de homens e animais e de desenvolver produtos preventivos e curativos como vacinas e antitoxinas". Para atingir esses objetivos os institutos recrutaram os melhores cientistas disponíveis em todos os lugares. Este foi um período fulgurante para a pesquisa sublinhado por inúmeras descobertas sobre as doenças infecciosas. Passada essa fase, os institutos entraram em depressão e até mesmo insolvência. Muitos se recuperaram, alguns não. Muitos ainda sofrem de uma "crise de identidade". Neste ensaio analisamos o destino dos institutos de pesquisa em saúde no Brasil, as causas de seu sucesso e eventuais fracassos e as medidas possíveis de ajudá-los a contornar suas presentes dificuldades.By the end of the 19th century, after the advances in surgical asepsis and the understanding of the role of microorganisms in the etiology of many infectious diseases, research institutes in the public health area were created worldwide with the objectives of undertaking "scientific research into the causes, prevention and treatment of disease in man and animals and to prepare and supply protective and curative materials such as vaccines and antitoxins". To pursue these objectives the institutes hired the best scientists from everywhere. This was an exhilarating period for research in which discoveries proliferated. After that, institutes got into depression and even insolvency. Most recovered, many not. Many are still suffering from an "identity crisis". In this paper we analyze the fate of the health research institutes in Brazil, the causes of their success and eventual failures and the possible ways to get out of their current difficulties.

  7. Marimuthu Munien V BMW Financial Services (SA (PTY LTD Unreported

    Directory of Open Access Journals (Sweden)

    C van Heerden

    2009-12-01

    Full Text Available Section 129(1(a read with section 130(1 and 130(3 of the National Credit Act 34 of 2005 (the NCA provides that, as a required procedure before debt enforcement, a credit provider must draw the default to the consumer's notice in writing and propose that the consumer refer the credit agreement to a debt counsellor, alternative dispute resolution agent, consumer court or ombud with jurisdiction, with the intent that the parties resolve any dispute under the agreement or develop and agree on a plan to bring the payments under the agreement up to date. Even though section 129(1(a is silent as to the method by which the default should be brought to the consumer's notice, section 130(1(a provides clarity by requiring the section 129(1(a notice to be delivered. It appears that a credit provider who fails to comply with the provisions of section 129(1(a prior to debt enforcement by means of litigation will be in a procedural predicament as the credit provider will not possess a complete cause of action thus, for instance, rendering the summons excipiable. The crucial question thus appears to be whether or not in a given situation one may say that there was proper compliance with section 129(1(a as this directly affects the existence or absence of a complete and proper cause of action. A number of factors has to be considered in order to address this question, the most important being if the section 129(1(a notice was duly 'delivered'. In this regard two questions are especially relevant:a When exactly can it be said that a section 129(1(a notice was 'delivered' for purposes of the NCA?b Is it necessary for such notice to be received by the consumer in order to constitute proper compliance with the delivery requirement pertaining to section 129(1(a?The above questions were decided on in a recent judgment, Marimuthu Munien v BMW Financial Services (SA (Pty Ltd Case no 16103/08 (KZD (unreported. This article will analyse section 129(1(a of the NCA by inter

  8. Direito à saúde: um convite à reflexão

    Directory of Open Access Journals (Sweden)

    Vera Maria Ribeiro Nogueira

    2004-06-01

    Full Text Available As alterações e rupturas que vêm ocorrendo na sociedade contemporânea em relação ao direito à saúde como valor universal, consoantes às orientações das agências multilaterais veiculadas especialmente a partir dos anos 90, constitui-se o foco central do presente estudo. A partir da gênese dos direitos sociais e do resgate da interdependência entre os aspectos sociais e econômicos na conformação da cidadania social nos países capitalistas democráticos, apresenta os dois paradigmas que delimitam o encaminhamento da atenção à saúde no início do século XXI. O paradigma da cidadania plena, no qual o direito à saúde é um valor universal, e o da cidadania social restrita, em que o direito à saúde é orientado pelo critério da eficiência e racionalidade econômica. Essas proposições alinham-se ao paradigma da economia da saúde, que defende a focalização dos recursos para atenuar as condições de miserabilidade, reduz o papel do Estado, sugere a alocação de recursos para a saúde aliada à proteção social e coloca o mercado como o regulador privilegiado das ações de saúde.

  9. Percepção de gerentes sobre a assistência à saúde coletiva

    Directory of Open Access Journals (Sweden)

    Helena Eri Shimizu

    2002-02-01

    Full Text Available Este estudo tem como objetivo conhecer a percepção de gestores e gerentes dos serviços de saúde sobre a assistência à saúde coletiva no contexto do Sistema Único de Saúde (SUS no Distrito Federal (DF. Trata-se de uma pesquisa qualitativa realizada por meio de entrevistas semi-estruturadas com gestores e gerentes da Regional Norte de Saúde do Distrito Federal. Conclui-se que a implantação dos princípios do SUS ainda é um desafio a ser enfrentado, tanto pela comunidade como pelos profissionais de saúde, que precisam unir esforços para encontrar estratégias que redirecionem a assistência à saúde coletiva.

  10. Saúde bucal do adolescente: necessidades odontológicas levantadas pelos agentes comunitários de saúde - doi: 10.5020/18061230.2012.p131

    OpenAIRE

    Carlos Roberto Silveira Correa; Maria Vieira de Lima Saintrain; Anya Pimentel Gomes Fernandes Vieira

    2012-01-01

    Apresentar dados epidemiológicos relativos à saúde bucal de adolescentes, obtidos com a utilização do Indicador Comunitário em Saúde Bucal (ICSB) e levantados pelos Agentes Comunitários de Saúde (ACS) em um município do Estado do Ceará, Brasil. Métodos: Estudo transversal, realizado em Guaiúba-CE, Brasil, entre julho/2007 e fevereiro/2008. Agentes comunitários de saúde (ACS) utilizaram ICSB para coletar dados. O ICSB averigua capacidade mastigatória (número de dentes); necessidade de tratamen...

  11. Natural Science and Technology Terminology in the Sesotho sa Leboa Monolingual Dictionary

    Directory of Open Access Journals (Sweden)

    W.M. Mojapelo

    2011-10-01

    Full Text Available

    Abstract: The main purpose of this article is to make a comparative analysis of the structural and the lexical differences between coinage and transliteration, as methods for the acquisition of foreign natural sci-ence and technology lexical items, which are meant for inclusion in the Sesotho sa Leboa comprehensive monolingual dictionary, Pukuntšutlhaloši ya Sesotho sa Leboa. With the exception of the multilingual glossaries ('dictionaries' as they are called, which are compiled by the National Language Service of the Department of Arts and Culture, the Sesotho sa Leboa National Lexicography Unit does not at present have any monolin-gual dictionary specializing in specific subjects like natural science and technology. As a start, the Lexicogra-phy Unit decided to include this specialized terminology in the second edition of its comprehensive monolin-gual dictionary. The main purpose for lemmatizing the natural science and technology terminology is to give these lexical items comprehensive definitions in Sesotho sa Leboa, instead of 'a one word translation defini-tion' as is the case in the bilingual and multilingual dictionaries.

    Keywords: TRANSLITERATION, COINAGE, COINED LEXICAL ITEM, LOAN WORD, ADOPTIVE, FOREIGN WORD, LEXICOGRAPHY, SOTHOIZED WORD, INDIGENOUS WORD, NATURAL SCIENCE, TECHNOLOGY, COMPOUND WORD, AMBIGUITY

    Opsomming: Natuurwetenskaplike en tegnologiese terminologie in die Sesotho sa Leboa eentalige woordeboek. Die hoofdoel van hierdie artikel is om 'n ver-gelykende ontleding te maak van die strukturele en die leksikale verskille tussen nuutskepping en transliterasie as metodes vir die verwerwing van vreemde natuurwetenskaplike en tegnologiese leksikale items wat bedoel is vir insluiting in die Sesotho sa Leboa omvattende eentalige woorde-boek Pukuntšutlhaloši ya Sesotho sa Leboa. Met die uitsondering van die meertalige woordelyste ("woordeboeke" soos hulle genoem word wat deur die Nasionale Taaldiens van die

  12. Ang Kasaysayan at Panitikan sa Pagbuo ng Bayan: Rebyu ng Nobelang The Feet of Juan Bacnang ni F. Sionil Jose

    OpenAIRE

    Moreal Nagarit Camba

    2013-01-01

    Mababasa sa The Feet of Juan Bacnang (2011), ang pinakabagong nobela ni F. (Francisco) Sionil Jose o Frankie sa kanyang mga kaibigan, ang mahigpit na ugnayan ng manunulat at ng kanyang bayan. Siya ang nagsisilbing zeitgeist ng maraming panahon; ang espiritu at boses ng nakaraan at kasalukuyan, isang manunulat na kumakatha ng mga akdang sumasalamin sa mayamang karanasan at kasaysayan ng kultura at lahing pinag-usbungan. Kung saan ang kanyang nobelang Juan Bacnang, katulad ng iba pa niyang naun...

  13. Uma experiência em comunicação e saúde

    Directory of Open Access Journals (Sweden)

    Marina Ruiz de Matos

    2009-12-01

    Full Text Available Este trabalho refere-se à experiência desenvolvida no município de Guarulhos, sob o patrocínio do Ministério da Saúde, com o objetivo de envolver radiocomunicadores no processo educativo em saúde. Organizaram-se oficinas de trabalho com a participação de funcionários dos serviços municipais de saúde e de radialistas das rádios comunitárias das mesmas áreas de abrangência, para reflexão, discussão e elaboração de ações conjuntas sobre temas de saúde. Desenvolveu-se metodologia que articulou, além de textos acadêmicos, outros tipos de linguagem como pintura, música, radionovela, poesia etc., na abordagem dos assuntos. A avaliação final constou de um questionário preenchido pelos participantes e a análise das respostas indicou tratar-se de uma metodologia compatível com os objetivos de alcançar envolvimento e desenvolver parcerias entre comunicadores, serviços de saúde e comunidade.

  14. Helicobacter pylori stool antigen test (HpSA) for the diagnosis of gastric infection

    International Nuclear Information System (INIS)

    To determine the accuracy of Helicobacter pylori Stool Antigen test (HpSA), compared with endoscopic histopathology for the diagnosis of gastric Helicobecter pylori infection. A total of 50 patients underwent endoscopy for gastric antral mucosal tissue biopsy for histopathology of H.pylori and advised for HpSA. Patient's information including age, gender, past history, presenting signs and symptoms, results of HpSA and histopathology were recorded. Sensitivity analysis was performed to calculate sensitivity, specificity, and predictive values of HpSA. Among 50 patients, 48% males and 52% females (M: F 1: 1.08), a total of 27 (54%) were true positive while 20 (40%) were true negative. Two patients were false negative and only one was false positive. Sensitivity of HpSA was, therefore, 93.1%, specificity 95% and positive and negative predictive values were 96.42% and 90.9% respectively. Helicobacter pylori stool antigen was an accurate and reliable test for the diagnosis of gastric H. pylori infection. (author)

  15. A segunda crítica social da Saúde de Ivan Illich

    Directory of Open Access Journals (Sweden)

    Roberto Passos Nogueira

    2003-02-01

    Full Text Available Na Nêmesis da Medicina, Ivan Illich expôs os elementos essenciais da sua primeira crítica da saúde, afirmando que a ampla industrialização da saúde e medicalização da vida na sociedade moderna faz aparecer diversas formas de iatrogênese ou danos à saúde, como resultado da perda da capacidade de ação autônoma das pessoas perante a enfermidade, a dor e o envelhecimento. Na segunda crítica social da saúde, Illich trata do surgimento de uma nova iatrogênese social, a iatrogênese do corpo, que resulta de uma espécie de obsessão com a saúde corporal e com sua produção através de atividades físicas, dietas etc. em aparente condição de autonomia. Trata-se de um consumismo do corpo saudável, que responde menos à ação dos médicos e mais às informações difundidas pelos meios de comunicação e pelos agentes terapêuticos não-oficiais.

  16. Antibody-dependent enhancement of dengue virus infection is inhibited by SA-17, a doxorubicin derivative.

    Science.gov (United States)

    Ayala-Nuñez, Nilda V; Jarupathirun, Patsaporn; Kaptein, Suzanne J F; Neyts, Johan; Smit, Jolanda M

    2013-10-01

    Antibody-dependent enhancement (ADE) is thought to play a critical role in the exacerbation of dengue virus (DENV)-induced disease during a heterologous re-infection. Despite ADE's clinical impact, only a few antiviral compounds have been assessed for their anti-ADE activity. We reported earlier that SA-17, a doxorubicin derivative, efficiently inhibits the in vitro infection of DENV and yellow fever virus. Here we explored SA-17's mechanism of inhibition and investigated if the compound is active against ADE of DENV infection. Since enhanced infectivity stimulated by antibodies has been observed with standard and immature DENV, both types of virions were included in the study. We observed that SA-17 (i) inhibits DENV infection by preventing binding/entry to the cell and (ii) interferes with antibody-mediated infection of both standard and immature DENV2. SA-17 markedly reduced the infectivity of DENV2 in ADE conditions, with IC50s ranging from 0.26 to 2.89μM. The compound exerted its activity when added before, during, and after antibody-opsonization of standard and immature virus. Thus, molecules with the characteristics of SA-17 may be attractive antiviral agents since they can be used both to block DENV2 entry during primary and secondary infection and to inhibit ADE of standard and immature virus. PMID:23994499

  17. Discursos sobre o papel e a representatividade de conferências municipais de saúde

    Directory of Open Access Journals (Sweden)

    Julio Strubing Müller Neto

    2014-01-01

    Full Text Available A participação da sociedade na definição das políticas de saúde constitui um princípio orientador do sistema público de saúde no Brasil. Analisaram-se os discursos dos participantes sobre o papel e a representatividade de conferências municipais de saúde. O estudo foi realizado em cinco municípios de Mato Grosso, Brasil, no período 2009-2010. Foram entrevistados 30 atores sociais, entre conselheiros e gestores de saúde, planejadores, vereadores e representantes do Ministério Público. Os dados foram analisados com o auxílio do software Qualiquantisoft para elaboração do discurso do sujeito coletivo. Os discursos encontrados refletem um consenso sobre a importância da conferência municipal de saúde, mesmo no caso daqueles que questionam a efetividade de suas decisões no planejamento e na gestão. Observaram-se discursos resultantes de interpretações de tradições teóricas distintas. Conclui-se que os discursos do sujeito coletivo apresentam argumentos complementares, mas também conflitantes, que buscam maior ressonância e influência na esfera pública sanitária e sobre o sistema político e o poder administrativo.

  18. Sampling and sensitivity analyses tools (SaSAT for computational modelling

    Directory of Open Access Journals (Sweden)

    Wilson David P

    2008-02-01

    Full Text Available Abstract SaSAT (Sampling and Sensitivity Analysis Tools is a user-friendly software package for applying uncertainty and sensitivity analyses to mathematical and computational models of arbitrary complexity and context. The toolbox is built in Matlab®, a numerical mathematical software package, and utilises algorithms contained in the Matlab® Statistics Toolbox. However, Matlab® is not required to use SaSAT as the software package is provided as an executable file with all the necessary supplementary files. The SaSAT package is also designed to work seamlessly with Microsoft Excel but no functionality is forfeited if that software is not available. A comprehensive suite of tools is provided to enable the following tasks to be easily performed: efficient and equitable sampling of parameter space by various methodologies; calculation of correlation coefficients; regression analysis; factor prioritisation; and graphical output of results, including response surfaces, tornado plots, and scatterplots. Use of SaSAT is exemplified by application to a simple epidemic model. To our knowledge, a number of the methods available in SaSAT for performing sensitivity analyses have not previously been used in epidemiological modelling and their usefulness in this context is demonstrated.

  19. Boneca Gertrudes: identidade feminina e práticas educativas em Saúde

    Directory of Open Access Journals (Sweden)

    Cláudia Maria Bógus

    1999-02-01

    Full Text Available A implantação, em 1984, do Programa de Assistência Integral à Saúde da Mulher, ao incorporar a questão da identidade feminina - procurando ver a mulher em relação ao seu corpo e à sua sexualidade e de que forma estas representações se relacionavam com o significado social da maternidade - tornou fundamental repensar a prática dos serviços de saúde realizada até então. Com o objetivo de auxiliar a atuação educativa dos profissionais de saúde, foi elaborado, na época, um instrumento pedagógico: a Boneca Gertrudes. Esta pesquisa, realizada nos anos de 1995 e 1996, verificou a abrangência deste instrumento pedagógico, considerando sua diversidade de usos nas práticas educativas em saúde e, principalmente, se esta abrangência de usos deve-se ao recurso pedagógico constituinte da Boneca Gertrudes: expressão da metodologia dialógica e concretização do corpo feminino. A investigação pretende contribuir para a discussão da elaboração de novos recursos facilitadores para o trabalho educativo em saúde, que abordem questões de gênero.

  20. Necessidades em saúde: questões importantes para o trabalho da enfermagem

    Directory of Open Access Journals (Sweden)

    Edir Nei Teixeira Mandu

    1999-03-01

    Full Text Available A construção de novos parâmetros e práticas em saúde e enfermagem, no sentido do efetivo exercício de direitos sociais, é um desafio posto na atualidade. Este trabalho é uma contribuição ao enfrentamento desse desafio. Olhando para o saber da enfermagem, reflete-se sobre um dado modo de interpretação das necessidades em saúde. A partir de uma discussão acerca das necessidades humanas e de sua relação com o trabalho em saúde, submete-se à crítica a interpretação das necessidades humanas/em saúde presente na teoria de Wanda de Aguiar Horta. Destaca-se na análise a importância da autonomia/autovalorização humana e a interpretação de necessidades a partir da consideração aos sujeitos que recebem-fazem saúde e ao contexto social.

  1. Comparison of finite element analysis of a piping tee using NASTRAN and CORTES/SA

    Science.gov (United States)

    Quezon, A. J.; Everstine, G. C.

    1980-01-01

    A comparison of finite element analyses of a piping tee was made using NASTRAN and CORTES/SA, a modified version of SAP3 having a special purpose input processor for generating geometries for a wide variety of tee joints. Four finite element models were subjected in force, moment, and pressure loadings. Flexibility factors and principal stresses were computed for each model and compared with results obtained experimentally by Combustion Engineering, Inc. Results from the NASTRAN analyses were in good agreement with experimental results for all loadings except internal pressure. The CORTES/SA analyses gave good results for the internal pressure loading, but poorer results for out of plane bending moments or forces resulting in out of plane bending. Two of the basic load cases in CORTES/SA were found to contain errors that could not be easily corrected. COST COMPARison of NASTRAN and CORTES/SA showed NASTRAN to be less expensive to two than CORTES/SA for identical meshes.

  2. 保险企业,你了解SA8000吗?

    Institute of Scientific and Technical Information of China (English)

    吴慧

    2006-01-01

    SA8000是企业社会责任标准(Social Accoutability 8000)的简称。SA8000是继ISI9000、ISO14000之后出现的又一个涉及体系的重要的国际性认证标准。SA8000认证就是依据该标准的要求审查、评价组织是否与保护人类权益的基本标准相符。尽管SA8000标准不是ISO标准。但由于它得到代表全球广泛利益的公司和组织的支持,加上公众和消费者对全球社会责任的压力,SA8000认证得到高度的认可。

  3. Comportamentos de saúde oral numa amostra de adolescentes de áreas rurais e urbanas

    OpenAIRE

    Teixeira, Patrícia Daniela de Figueiredo

    2012-01-01

    A saúde oral é, inquestionavelmente,um bem essencial para a qualidade e saúde geral do indivíduo. Actuar nos comportamentos dos indivíduos perante a saúde é o ponto de partida para diminuir a prevalência de cárie, quer em áreas rurais quer em áreas urbanas, minimizando as diferenças entre as zonas de residência. O objectivo deste estudo foi caracterizar os comportamentos de saúde oral numa amostra de adolescentes que residem em áreas rurais e urbanas, bem como determinar a prevalência de sela...

  4. Naissance d’une nouvelle élite ottomane. Formation et trajectoires des médecins diplômés de Beyrouth à la fin du xixe siècle

    Directory of Open Access Journals (Sweden)

    Chantal Verdeil

    2012-01-01

    Full Text Available À la fin du xixe siècle, deux facultés de médecine ouvrent à Beyrouth, la première en 1867, au sein du Syrian Protestant College, la seconde en 1883 à l’Université Saint-Joseph. Ces deux facultés ont en commun d’être des institutions étrangères installées dans l’empire ottoman et de poursuivre une œuvre missionnaire. De leur fondation jusqu’à 1914, elles ont formé plusieurs centaines de médecins qui appartiennent aux « couches nouvelles » de la société ottomane. Nés dans le bilad al-Shâm ou en Asie Mineure, leurs diplômés sont issus de milieux proches des missionnaires. Leur parcours professionnel les conduit souvent à se déplacer à l’intérieur de l’Empire ottoman. Durant leur carrière, ils profitent pleinement du développement des services sanitaires de l’Empire et de la pénétration des missions et des entreprises étrangères en quête de médecins formés selon des normes occidentales.

  5. Comunicação e marketing em saúde : o caso Giga

    OpenAIRE

    Pereira, Carolina Maria Netto de Almeida Alves

    2013-01-01

    As estratégias de comunicação e marketing têm vindo a ganhar cada vez mais importância nas pequenas, médias e grandes empresas independentemente do seu core business, e os serviços de saúde não são excepção. Derivando de todos os processos de transformação no mundo da saúde, não só o público interno das instituições hospitalares se reajusta às actuais mudanças, como o público utente carece de novas necessidades face aos profissionais de saúde e condições físicas ao seu dispo...

  6. A construção coletiva da Biblioteca Virtual em Saúde

    Directory of Open Access Journals (Sweden)

    Abel Laerte Packer

    2005-08-01

    Full Text Available Retoma-se a origem da Biblioteca Virtual em Saúde (BVS como produto da evolução do programa de cooperação técnica em informação científica em saúde na América Latina e no Caribe. Analisa-se sua conformação tecnológica como produto da reestruturação da comunicação científica promovida pela internet, destacando o aprimoramento conceitual e operacional do modelo de gestão coletiva de informação e conhecimento no espaço virtual e os desafios de promover o acesso e uso democráticos da informação e do conhecimento atualizado nos processos que envolvem a saúde coletiva e individual.

  7. Bacharel em Saúde Coletiva: um Elo que faltava na Rede

    Directory of Open Access Journals (Sweden)

    Antônio José Costa CARDOSO

    2013-11-01

    Full Text Available O desafio deste último texto é, sem outras referências, fazer “emergir” um (incerto Discurso do Sujeito Coletivo – aqui referido ao conjunto de autores que assina esse número especial da Tempus Actas em Saúde Coletiva, a partir de um diálogo que se pretende articulador das ideias dos diversos autores que trataram da criação dos bacharelados, mercado de trabalho e carreira, identidade e regulamentação da profissão, campos de prática e estágio em Saúde Coletiva, tomando o texto-base Graduação em Saúde Coletiva: conquistas e passos para além do sanitarismo, de Jairnilson Silva Paim e Isabela Cardoso Pinto, como ponto de partida.

  8. Controle social: um desafio para o conselheiro de saúde

    OpenAIRE

    Tatiane Oliveira de Souza; Jair Magalhães da Silva; Samara Souza da Nóbrega; Jocinei Ferreira Constâncio

    2012-01-01

    Objetivou-se analisar o perfil dos Conselheiros de Saúde do Município de Jequié-BA e identificar seu conhecimento acerca da função. Pesquisa descritiva, exploratória e qualitativa, realizada com dez Conselheiros de Saúde, atuantes em 2008. A análise dos dados foi feita segundo a técnica do Discurso do Sujeito Coletivo, emergindo as seguintes categorias: importância de atuar como Conselheiro de Saúde; função do Conselheiro e falta de capacitação para a função. Os resultados mostram que eles co...

  9. Participação: uma aposta para cuidar dos cuidadores da saúde

    OpenAIRE

    Muñoz Sánchez, Alba Idaly; Castro Silva, Eliana

    2011-01-01

    O setor da saúde não escapa dos efeitos próprios do modelo econômico globalizante que contribui para a geração das atuais condições de precariedade e flexibilização no trabalho nesse setor. Objetivo: identificar como se desenvolve o princípio de participação e empoderamento da promoção da saúde nos locais de trabalho, no caso de instituições de saúde. Métodos: estudo de caso, descritivo e transversal, realizado em três hospitais de terceiro nível de atenção de Bogotá, com o aval ...

  10. Grating Ti:Sa laser: Rydberg & auto-ionizing state spectroscopy

    Science.gov (United States)

    Teigelhoefer, Andrea; Bricault, Pierre; Lassen, Jens; Neu, Walter; Wendt, Klaus

    2009-05-01

    TRIUMF's Isotope Separator and Accelerator facility (ISAC) provides intense radioactive isotope beams (RIB) for nuclear and particle physics experiments. Resonant laser ionization is well suited as an on-line ion source for RIB production due to its efficiency and element selectivity. TRIUMF's Laser Ion Source (TRI LIS) uses BRF tuned Ti:Sa lasers with GHz linewidth and 10kHz rep. rate. Continuous wavelength scanning of these lasers is involved. A grating tuned Ti:Sa laser was built to allow for high resolution continuous wavelength scans (10nm/h) thus allowing for systematic studies of high lying atomic energy levels and the development of efficient RIS schemes. This grating tuned Ti:Sa laser system will be presented.

  11. Implicit Volatility versus Statistical Volatility: an Exercise Using Options and Telemar S.A. Stock

    Directory of Open Access Journals (Sweden)

    Marcelo Savino Portugal

    2004-06-01

    Full Text Available The main goal this article was to find the best way of making forecast about future volatility using implicit or statistic forecast. The work is based on Telemar S.A. shares data from 21/09/1998 to 21/10/2002 and Telemar S.A. shares data from 2/10/2000 to 21/10/2002. The implicit volatility was obtained using back-out procedure from the Black-Scholes model. The statistics forecasts were obtained using weighted moving average models, GARCH, EGARCH and FIGARCH models. The Wald statistic shows that EGARCH and FIGARCH models are efficient and are not biased forecasts for Telemar S.A. absolute variation between t and t + 1. The volatility evaluation during the maturity time of an option, rejects the hypothesis that implicit volatility is the best forecast to future volatility and the Wald statistic show that FIGARCH model is an efficient and not biased forecast.

  12. Electro-generation of TGA by Ni-mSA-mCS bipolar membrane

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Ni-mSA-mCS bipolar membrane (BM) was prepared by sodium alginate (SA) and chitosan (CS), which were modified by Ca2+and glutaraldehyde as linking reagents, respectively. mSA-mCS membrane was characterized by FTIR, SEM, TG and used as a separator in the electrolysis cell to produce thioglycolic acid (TGA). The experiment results show that TGA was prepared effectively by electro-reduction of dithiodiglycolic acid (DTDGA) with the mixture of TGA and DTDGA in the cathodic chamber. The current efficiency was up to 66.7% at the room temperature (25 ℃) during the current density of 10 mA/cm2. Compared with the traditional metal reduction method, the electro-reduction technology saves the zinc powder and eliminates the pollution to environment.

  13. SA-DBSCAN:一种自适应基于密度聚类算法%SA-DBSCAN:A self-adaptive density-based clustering algorithm

    Institute of Scientific and Technical Information of China (English)

    夏鲁宁; 荆继武

    2009-01-01

    DBSCAN是一种经典的基于密度聚类算法,能够自动确定簇的数量,对任意形状的簇都能有效处理.DBSCAN算法需要人为确定Eps和minPts 2个参数,导致聚类过程需人工干预才能进行.在DBSCAN的基础上提出了SA-DBSCAN聚类算法,通过分析数据集统计特性来自动确定Eps和minPts参数,从而避免了聚类过程的人工干预,实现聚类过程的全自动化.实验表明,SA-DBSCAN能够选择合理的Eps和minPts参数并得到较高准确度的聚类结果.

  14. Velhice, incapacidade e cuidado na saúde pública

    Directory of Open Access Journals (Sweden)

    Karla Cristina Giacomin

    2015-12-01

    Full Text Available Resumo O envelhecimento populacional modifica profundamente o escopo de atuação da saúde coletiva, altera o perfil de morbimortalidade e aumenta a demanda por cuidados crônicos. Na população idosa, a incapacidade serve como indicador de saúde e balizador de ações e políticas. Esta pesquisa de abordagem qualitativa, fundamentada na antropologia interpretativa e na perspectiva êmica, tem por objetivo compreender a forma de pensar e agir dos idosos diante da “velhice com incapacidade” e suas relações com a saúde pública. Foram realizadas entrevistas individuais no domicílio, com roteiro semiestruturado, junto a 57 idosos residentes na cidade, inclusive participantes da coorte de Bambuí. A metodologia de Signos, Significados e Ações orientou a coleta e a análise dos dados, possibilitando a investigação antropológica das representações e comportamentos concretos associados à incapacidade na velhice na cultura local. Emergiram da análise duas categorias acerca das relações entre velhice, incapacidade e cuidado na saúde pública: experiências de cuidado na velhice com incapacidade; o medo da falta de cuidados. Os resultados revelam que a saúde pública precisa rever seus conceitos sobre incapacidade na velhice e incorporar a dimensão funcional da saúde e o cuidado à velhice com incapacidade na agenda.

  15. Justiça social e equidade em saúde: uma abordagem centrada nos funcionamentos

    Directory of Open Access Journals (Sweden)

    Carlos Dimas Ribeiro

    2015-12-01

    Full Text Available Trata-se de um ensaio de natureza teórica que objetiva defender uma concepção de justiça social voltada aos funcionamentos dos indivíduos, articulando a discussão da justiça com o debate sobre equidade em saúde. Na introdução, são discutidas as circunstâncias da justiça, abordando a questão da escassez dos recursos no campo da saúde. No primeiro item, analisa-se a noção da equidade em saúde, apresentando os principais enfoques abordados, em particular o conceito de equidade em saúde proposto por Margaret Whitehead, amplamente utilizado na saúde coletiva. No segundo item, apresenta-se, brevemente, a Abordagem das Capacitações desenvolvida por Amartya Sen e Martha Nussbaum, que recuperam a noção aristotélica de funcionamento. Ao final, critica-se essa abordagem e defende-se a Perspectiva dos Funcionamentos (PF, proposta por Maria Clara Dias, aplicada ao campo da saúde. Dessa forma, os concernidos da justiça são sistemas funcionais e o que se quer igualar para propósitos de justiça é a integridade funcional dos seres vivos. São apresentadas algumas vantagens dessa perspectiva, considerada aquela que melhor preenche os requisitos de uma concepção de justiça extensiva a todos no Brasil.

  16. Saúde mental e trabalho: os problemas que persistem Mental health and work: persistent issues

    Directory of Open Access Journals (Sweden)

    Leny Sato

    2005-12-01

    Full Text Available Este artigo toma por objeto a Saúde Mental e Trabalho como uma subárea do campo da Saúde do Trabalhador. Parte da constatação de que os problemas de saúde mental e trabalho, já identificados em meados da década de 1980, persistem. Após retomar a taxonomia de tais problemas, busca evidenciar algumas de suas expressões atuais a partir da assistência e da vigilância em saúde do trabalhador, bem como pela perspectiva de alguns sindicatos mais atentos à questão. Para tal, toma como ponto de partida o Centro de Referência em Saúde do Trabalhador (CRST de Campinas. Por fim, pontua algumas características do trabalho no contexto atual para compreender as motivações dessa persistência.This article focuses on Mental Health and Work as a subarea of the Workers’ Health field. Its starting point is the observation that the problems of mental health related to work identified in the mid 80’s still persist. After exposing the taxonomy of these problems, the paper searches to explain some of their current expressions from the assistance and the surveillance in workers’ health as well as from the point of view of some trade unions more attentive to this issue. In order to do that, the Centro de Referência em Saúde do Trabalhador (CRST of Campinas is taken as a reference. Finally, it points out to some characteristics of work in the present context to understand the reasons of this persistence.

  17. Promoção de Saúde e a Funcionalidade Humana

    Directory of Open Access Journals (Sweden)

    Ana Cristhina de Oliveira Brasil

    2013-03-01

    Full Text Available Para a elaboração de políticas públicas de saúde no Brasil, dois aspectos devem ser levados em consideração, a saber, a transição demográfica e a transição epidemiológica. Cada vez mais, observa-se um aumento no número de pessoas idosas convivendo com inúmeras incapacidades e, ainda, um perfil epidemiológico. A Pesquisa Nacional por Amostra de Domicílios (PNAD 1998-2003 indica uma distribuição de doenças crônicas que, consequentemente, tem gerado um número expressivo de incapacidades. Essas pessoas com incapacidades necessitam dos serviços de saúde, e os utilizam quando conseguem ter acesso a eles. Contudo, os modelos vigentes de atenção à saúde do idoso ou à saúde das pessoas com deficiência são de alto custo e, em alguns aspectos, não se apresentam eficientes, demandando estratégias de prevenção e equipamentos de saúde destinados à manutenção ou recuperação da saúde de uma população mais envelhecida. Desse modo, a agenda de política pública do Brasil deveria priorizar a manutenção da funcionalidade dos idosos, com monitoramento das condições de saúde, ações preventivas específicas de saúde e educação, e cuidados buscando uma atenção multidimensional e integral, não necessariamente centrada na doença(1.A necessidade de se elaborar políticas e estratégias, em especial de promoção de saúde, com um olhar descentralizado da doença se justifica porque os problemas de saúde advêm não somente de doenças, mas de qualquer outra condição ou circunstância de saúde, tais como agravos, gravidez, envelhecimento, estresse, predisposição genética – todas classificadas pela CID-10, contudo, sem poder mensurar as mudanças de estado relativas à condição de saúde, e muito menos classificar para descrever o contexto em que esses problemas acontecem, o que dificulta e compromete o planejamento e a resolubilidade das ações e dos serviços em saúde, diferentemente dos dados por

  18. Caminhada e gastos com saúde em adultos usuários do sistema público de saúde brasileiro: estudo transversal retrospectivo

    Directory of Open Access Journals (Sweden)

    Bruna Camilo Turi

    2015-11-01

    Full Text Available A inatividade física é um dos maiores desafios à saúde pública devido à sua associação com doenças crônicas e ao impacto econômico sobre o sistema público de saúde. Entretanto, a prática de caminhada pode auxiliar a amenizar esses problemas. Objetivo Verificar se existem associações entre prática de caminhada no lazer, presença de fatores de risco e gastos relacionados ao uso de serviços de saúde em usuários do sistema público de saúde brasileiro. Metodologia A amostra foi composta por 963 adultos. A prática de caminhada foi avaliada a partir de questionário de Baecke. Gasto com tratamento/ano foi avaliado pela demanda por serviços registrados nos prontuários clínicos. Resultados Prática de caminhada como atividade física de lazer foi referida por 64,4% dos participantes. Os grupos de maior prática de caminhada apresentaram menores valores para idade, IMC, CC e gastos com medicamentos. Indivíduos inseridos na categoria de maior envolvimento apresentaram 41% menos chances de estarem inserido no grupo de maior gasto total (OR=0.59; IC95% 0.39-0.89. Conclusão Verificou-se que a prática de caminhada como atividade física de lazer foi a mais frequente para a maioria dos usuários do SUS, a qual foi associada a menores gastos com medicamentos e no total.

  19. Science4you, S.A. : From educational toys to software and hardware devices

    OpenAIRE

    Carreira, Pedro Manuel de Nóbrega Moita Coelho

    2014-01-01

    The thesis that is hereby presented in the form of a case study aims to address the challenges faced by the Portuguese company Science4you, S.A., upon creating a new product line focusing technology products, particularly tablets and smartphones. The thesis is divided into three parts: case study, literature review and teaching notes which can be used as an educational tool in undergraduate or graduate programs. Formed in 2008, Science4you, S.A. is a company dedicated to the de...

  20. Nanomateriais Manufaturados: novos desafios para a saúde pública

    OpenAIRE

    Louro, Henriqueta; Tavares, Ana; Vital, Nádia; Antunes, Susana; Lavinha, João; Silva, Maria João

    2013-01-01

    Os nanomateriais manufaturados (NMs), apresentam propriedades físico-químicas específicas que lhes conferem caraterísticas mecânicas, óticas, elétricas e magnéticas únicas e vantajosas para aplicações industriais e biomédicas. Contudo, o desenvolvimento exponencial das nanotecnologias contrasta com a ainda insuficiente avaliação de risco para a saúde humana e para o ambiente, conduzindo a preocupações, em termos de saúde pública. Este trabalho apresenta alguns dos contributos recentes da toxi...

  1. Gestão em segurança e saúde no trabalho

    OpenAIRE

    Pereira, Alcides do Couto

    2011-01-01

    Esta dissertação tem como objectivo a sensibilização para as questões da Higiene e Segurança no Trabalho, que proporcionem as correctas condições no local de trabalho, que protejam a Saúde dos colaboradores e trabalhadores de uma Empresa. Abordam-se os factores que podem afectar o ambiente do Trabalho e o Trabalhador, das doenças profissionais, e dos procedimentos a adoptar para eliminar ou reduzir os riscos profissionais e os respectivos problemas de saúde. Com o intuito de...

  2. Bacharel em Saúde Coletiva: um Elo que faltava na Rede

    OpenAIRE

    Antônio José Costa CARDOSO; Maria Fátima de SOUSA

    2013-01-01

    O desafio deste último texto é, sem outras referências, fazer “emergir” um (incerto) Discurso do Sujeito Coletivo – aqui referido ao conjunto de autores que assina esse número especial da Tempus Actas em Saúde Coletiva, a partir de um diálogo que se pretende articulador das ideias dos diversos autores que trataram da criação dos bacharelados, mercado de trabalho e carreira, identidade e regulamentação da profissão, campos de prática e estágio em Saúde Coletiva, tomando o texto-base Graduação ...

  3. Racismo e Saúde: um corpus crescente de evidência internacional

    OpenAIRE

    Williams, David R.; Naomi Priest

    2015-01-01

    Este artigo resenha um crescente corpus de investigação empírica, o qual indica que o racismo, em suas variantes institucional e interpessoal, persiste nas sociedades contemporâneas racializadas de todo o mundo, e pode ter impactos adversos importantes sobre a saúde. Após um breve apanhado das desigualdades étnico-raciais na saúde da população, em vários contextos nacionais, o artigo concentra-se na pesquisa empírica sobre a natureza e persistência do racismo e as múltiplas maneiras em que es...

  4. PREPARATION OF SA-Fe CATION EXCHANGE MEMBRANE AND IT'S APPLICATION IN ELECTRODIALYSIS FOR TREATING WASTEWATER

    Institute of Scientific and Technical Information of China (English)

    GENG Yamin; CHEN Zhen; ZHENG Xi; HUANG Xuehong; CHEN Riyao

    2006-01-01

    An insoluble SA-Fe membrane was prepared by being linked soluble sodium alginate with FeCl3. SEM was used to observe its surface structure. IR spectrum indicated that Fe3+ was linked with -COOH and -OH in SA membrane. As a cationic exchanging membrane in electrodialysis the membrane was applied in treating inorganic wastewater with high concentration of inorganic ammonia and azote. The results of experiment showed that it was well-selective to ammonia and azote. The percentage of the removal of ammonia and azote in wastewater was up to 80%.

  5. Psico-neuro-imunologia : Área de interesse em Psicologia da Saúde

    OpenAIRE

    Teixeira, José A. Carvalho

    1995-01-01

    A psiconeuro-imunologia estuda a interface entre comportamento, cérebro e imunidade. Nesta nota didáctica o Autor discute alguns aspectos psiconeuroimunológicos relevantes para a Psicologia da Saúde, especialmente relacionados com promoção da saúde e prevenção da doença. ABSTRACT: Psychoneuroimmunology is related to the interface between behavior, brain and immunity. The Author discuss some psychoneuroimmunological aspects as applied to health psychology, specifical...

  6. Risk Management and Nuclear Insurance Program within Societatea Nationala Nuclearelectrica S.A

    International Nuclear Information System (INIS)

    This paper shall present the Risk Management and associated nuclear insurance program developed within Societatea Nationala 'Nuclearelectrica' S.A, owner and operator of Units 1 and 2 Cernavoda NPP, the Nuclear Fuel Plant and in charge with commissioning of Units 3 and 4. From the risk management perspective, the main aspects that energy industry has to face due to global economic changes within a dynamic business environment are highlighted. In order to mitigate the operational and investment associated risks, Societatea Nationala 'Nuclearelectrica' S.A. successfully developed, implemented and maintained a coherent insurance program both on local and international insurance market. (authors)

  7. Problemi kod reparaturnog zavarivanja alatnog čelika sa duplex zaštitom

    OpenAIRE

    T. Muhič; J. Tušek; M. Pleterski; D. Bombač

    2009-01-01

    U radu su istraženi problemi kod laserskog zavarivanja alata za lijevanje u industriji tlačnog lijeva aluminija ili plastike. Za produženje života alata primjenjena su različita poboljšanja površine. Ovakva poboljšanja značajno smanjaju sposobnost materijala za zavarivanje. U radu se opisuje razvoj grešaka kod reparaturog zavarivanja alatnog čelika sa dupleks zaštitom. Nametnuta procedura nastoji smanjiti greške sa novom zavarivnom tehnikom. Proučeni su I efekti različitih parametra procesa i...

  8. Relationship Between LOX Activity, SA and JA Accumulation in Tobacco Leaves Under Water Stress

    Institute of Scientific and Technical Information of China (English)

    GONG Chang-rong; LI Yan-mei; YANG Li-jun

    2003-01-01

    The relationship between LOX (lipoxygenase) activity, SA (salicylic acid) and JA (jasmonic acid) accumulation was studied in the tobacco leaf under water stress. The result showed that LOX activity and JA content increased sirnutaneously with losing of water. NDGA(nordihydroguaiaretic), an inhibitor of LOX,inhibited simultaneously both the activity of LOX and the enhancement of JA level under the stress. Likewise,adding LOX to tobacco cell-free system led to the increase of JA content. It suggested that LOX could be a key enzyme in JA biosynthesis under water stress. SA inhibited the enhancement of JA level under the stress.

  9. MODELOVANJE DVOFAZNOG STRUJANJA U CEVIMA ORUĐA SA KOMBINOVANIM PUNJENJEM

    OpenAIRE

    Hristov P. Nebojša; Savić R. Slobodan

    2011-01-01

    U članku se opisuju procesi unutar cevi oruđa sa kombinovanim punjenjem u toku opaljenja sa ciljem da se poboljša vatrena moć postojećih i projektovanje novih oruđa. Simulacije procesa opaljenja pružaju mogućnost optimizacije barutnog punjenja. Analizom dobijenih rezultata birа se najbolja kombinacija ulazno-izlaznih parametara radi postizanja što veće početne brzine projektila, a da maksimalni pritisci barutnih gasova budu što niži unutar cevil.

  10. [SciELO Public Health: the performance of Cadernos de Saúde Pública and Revista de Saúde Pública].

    Science.gov (United States)

    Barata, Rita Barradas

    2007-12-01

    The aim of this paper was to analyze two Brazilian scientific journals included in the SciELO Library of Public Health, using a group of bibliometric indicators and scrutinizing the articles most viewed. Cadernos de Saúde Pública was accessed 3,743.59 times per month, with an average of 30.31 citations per article. The 50 articles most viewed (6.72 to 524.5 views) were mostly published in Portuguese (92%). 42% were theoretical essays, 20% surveys, and 16% descriptive studies. 42% used argumentative techniques, 34% quantitative techniques, 18% qualitative techniques, and 6% mathematical modeling. The most common themes were: health and work (50%), epidemiology (22%), and environmental health (8%). Revista de Saúde Pública was accessed 1,590.97 times per month, with an average of 26.27 citations per article. The 50 articles most viewed (7.33 and 56.50 views) were all published in Portuguese: 46% were surveys, 14% databases analysis, and 12% systematic reviews. Quantitative techniques were adopted in 66% of such articles, while mathematical modeling was the same as observed in Cadernos de Saúde Pública, as were qualitative techniques. The most common themes were health services organization (22%), nutrition (22%), health and work (18%), epidemiology (12%), and environmental health (12%).

  11. [SciELO Public Health: the performance of Cadernos de Saúde Pública and Revista de Saúde Pública].

    Science.gov (United States)

    Barata, Rita Barradas

    2007-12-01

    The aim of this paper was to analyze two Brazilian scientific journals included in the SciELO Library of Public Health, using a group of bibliometric indicators and scrutinizing the articles most viewed. Cadernos de Saúde Pública was accessed 3,743.59 times per month, with an average of 30.31 citations per article. The 50 articles most viewed (6.72 to 524.5 views) were mostly published in Portuguese (92%). 42% were theoretical essays, 20% surveys, and 16% descriptive studies. 42% used argumentative techniques, 34% quantitative techniques, 18% qualitative techniques, and 6% mathematical modeling. The most common themes were: health and work (50%), epidemiology (22%), and environmental health (8%). Revista de Saúde Pública was accessed 1,590.97 times per month, with an average of 26.27 citations per article. The 50 articles most viewed (7.33 and 56.50 views) were all published in Portuguese: 46% were surveys, 14% databases analysis, and 12% systematic reviews. Quantitative techniques were adopted in 66% of such articles, while mathematical modeling was the same as observed in Cadernos de Saúde Pública, as were qualitative techniques. The most common themes were health services organization (22%), nutrition (22%), health and work (18%), epidemiology (12%), and environmental health (12%). PMID:18157346

  12. O olhar das representações indigenas sobre a sua saúde e a interface com o subsistema de saúde indigena

    Directory of Open Access Journals (Sweden)

    Maria Elvira TOLEDO

    2013-12-01

    Full Text Available O movimento indígena acreano tem uma trajetória de mais de 20 anos, atuando em debates locais, regionais e nacionais sobre a política de saúde indígena; em mobilizações políticas para reivindicar direitos; participando das instâncias de controle social na saúde e atuando também na gestão de projetos com financiamento não governamental ou em parceira com o governo federal, através da administração terceirizada dos Distritos Sanitários Especiais Indígena (DSEIs. Apesar disso, na primeira década da implantação do Subsistema de Saúde Indígena, muitos obstáculos tiveram que ser enfrentados pelas associações indígenas para se apropriar dos meandros da política de participação e controle social e esforços foram investidos para melhorar sua participação neste setor.

  13. Letramento funcional em saúde: reflexões e conceitos sobre seu impacto na interação entre usuários, profissionais e sistema de saúde

    Directory of Open Access Journals (Sweden)

    Maria da Penha Baião Passamai

    2012-06-01

    Full Text Available Letramento funcional em saúde (LFS é o grau pelo qual os indivíduos têm a capacidade para obter, processar e entender informações básicas e serviços necessários para a tomada de decisões adequadas em saúde. O tema preocupa pesquisadores/profissionais da saúde/formuladores de políticas públicas. Sua natureza interdisciplinar, relacional e interacional indica que o LFS sofre a influência dos sistemas de saúde/educacional, mídia, família, ambiente de trabalho/comunidade/decisão política. Analisam-se conceitos de LFS versus interação usuários-profissionais-sistema de saúde, norteando-se pelas questões: Em que consiste o LFS? Em que medida interfere na comunicação entre usuários, profissionais e sistema de saúde? Quais são suas consequências na saúde pública? Medidas para elevação do LFS devem melhorar as competências individuais e serviços de saúde humanizados, aperfeiçoando suas comunicações, escritas/orais, satisfazendo as necessidades/habilidades dos usuários.

  14. Vigilância em saúde do trabalhador e promoção da saúde: aproximações possíveis e desafios

    Directory of Open Access Journals (Sweden)

    Alves Roberta Belizário

    2003-01-01

    Full Text Available O trabalho pretende discutir as aproximações possíveis entre as práticas de Vigilância em Saúde do Trabalhador e o enfoque da promoção da saúde, bem como os distanciamentos e desafios da Vigilância em Saúde do Trabalhador em face dessa outra concepção de saúde pública, procurando refletir sobre a pertinência, a relevância e a viabilidade de tal perspectiva para a Saúde do Trabalhador. A discussão empreendida defende que existem muitos pontos em comum entre essas abordagens, em termos teóricos e metodológicos, e aponta a necessidade para a Vigilância em Saúde do Trabalhador de se integrar de forma mais efetiva às ações de promoção da saúde, a fim de a buscar uma maior viabilização de suas ações e sua consolidação como área da saúde pública.

  15. Vigilância em saúde do trabalhador e promoção da saúde: aproximações possíveis e desafios

    Directory of Open Access Journals (Sweden)

    Roberta Belizário Alves

    2003-02-01

    Full Text Available O trabalho pretende discutir as aproximações possíveis entre as práticas de Vigilância em Saúde do Trabalhador e o enfoque da promoção da saúde, bem como os distanciamentos e desafios da Vigilância em Saúde do Trabalhador em face dessa outra concepção de saúde pública, procurando refletir sobre a pertinência, a relevância e a viabilidade de tal perspectiva para a Saúde do Trabalhador. A discussão empreendida defende que existem muitos pontos em comum entre essas abordagens, em termos teóricos e metodológicos, e aponta a necessidade para a Vigilância em Saúde do Trabalhador de se integrar de forma mais efetiva às ações de promoção da saúde, a fim de a buscar uma maior viabilização de suas ações e sua consolidação como área da saúde pública.

  16. Atenção à saúde mental na Estratégia Saúde da Família: recursos não reconhecidos

    Directory of Open Access Journals (Sweden)

    Mariana de Oliveira Pasqualin Ribeiro

    2013-12-01

    Full Text Available Um dos pilares da política de Atenção Básica, a Estratégia Saúde da Família, realiza assistência descentralizada nos territórios adscritos, atendendo diferentes demandas, incluindo a saúde mental. Esta pesquisa teve como objetivo produzir sentidos com profissionais da Saúde da Família sobre seus recursos para o cuidado em saúde mental. Para tanto, foram realizados grupos focais com profissionais da saúde da família de um município do interior do estado de São Paulo. A análise do material foi realizada por procedimentos qualitativos de análise temática, com base nas contribuições do movimento construcionista social. Essa análise permitiu dar visibilidade a importantes recursos técnicos e relacionais da equipe para o cuidado em saúde mental, mas que pareciam pouco legitimados em seu cotidiano. Discutimos a necessidade de criação de espaços de reflexão onde os trabalhadores de saúde possam ressignificar suas ações, o que pode contribuir para a qualificação do atendimento em saúde mental na Atenção Básica.

  17. Qualification of High Specific Energy Li-Ion Cell VES180SA

    Science.gov (United States)

    Defer, M.; Du Peyrat, D.; Prevot, D.; Borthomieu, Y.

    2008-09-01

    In order to improve the competitiveness of future platform by reducing weight and cost of the flight batteries solutions, a high specific energy VES180SA cell has been developed and qualified jointly with ESA, CNES, Astrium and Thales in the frame of Artes8 program. This new generation of cell achieves a specific energy of 155Wh/kg in the same casing as the previous generation of VES140S/SA cells given for 115Wh/kg and takes benefit of:* Use of a Ni based G5 generation electrochemistry already implemented in mass production for industrial application.* Use of return on G4 (VES140) & G5 life tests results as well as VES140S/SA flight experience * Use of SA mechanics i.e. with jelly roll attached in order to sustain more severe mechanical environmentVES180SA cell design is the same as the existing VES140SA cell design except the electrochemistry (jelly-roll) which has evolved in order to deliver more energy. The cell casing is composed by a thin al. tube closed by two al. covers that are welded on the extremities of the tube. During the whole cell lifetime, casing is stressed by combined static loads due to internal gas pressure, in cycling jelly-roll swelling and irreversible jelly roll swelling due to ageing phenomena. In addition to that, static loads are temporarily combined to dynamic loads during the launch phase. Whereas, dynamic loads applied on VES140SA and VES180SA cells are the same, maximal internal gas pressure and jelly-roll swelling are higher in VES180SA cell due to its new electrochemistry. The maximal internal pressure of a cell can be estimated by a Saft numerical model based on pressure measurement and extrapolations. For what concern the jelly roll swelling, such a model was not available at the start of the development of the VES180SA cell. The aim of the cell development phase was therefore to optimize the design by characterizing the casing material and performing adequate tests in order to define the cell worst case mechanical loads as a

  18. O discurso dos Agentes Comunitários de Saúde sobre as práticas de saúde mental na atenção básica.

    OpenAIRE

    Juliana Cardoso ÁLVARES; Maria Fátima de SOUSA; Maria da Glória LIMA

    2013-01-01

    O artigo objetivou identificar o discurso coletivo dos Agentes Comunitários de Saúde - ACS, frente a identificação da manifestação do sofrimento psíquico, as ações de saúde mental desenvolvidas bem como, os seus elementos considerados potencializadores e 1 - Este artigo é parte da dissertação de Mestrado: Percepção dos Agentes Comunitários de Saúde sobre as práticas de saúde mental na unidade básica de saúde da família do Paranoá no Distrito Federal, Programa de Pós-graduação em Ciências d...

  19. Vigilância em saúde do trabalhador e promoção da saúde: aproximações possíveis e desafios Worker's health surveillance and health promotion: similarities and challenges

    OpenAIRE

    Roberta Belizário Alves

    2003-01-01

    O trabalho pretende discutir as aproximações possíveis entre as práticas de Vigilância em Saúde do Trabalhador e o enfoque da promoção da saúde, bem como os distanciamentos e desafios da Vigilância em Saúde do Trabalhador em face dessa outra concepção de saúde pública, procurando refletir sobre a pertinência, a relevância e a viabilidade de tal perspectiva para a Saúde do Trabalhador. A discussão empreendida defende que existem muitos pontos em comum entre essas abordagens, em termos teóricos...

  20. Vigilância em saúde do trabalhador e promoção da saúde: aproximações possíveis e desafios

    OpenAIRE

    Roberta Belizário Alves

    2003-01-01

    O trabalho pretende discutir as aproximações possíveis entre as práticas de Vigilância em Saúde do Trabalhador e o enfoque da promoção da saúde, bem como os distanciamentos e desafios da Vigilância em Saúde do Trabalhador em face dessa outra concepção de saúde pública, procurando refletir sobre a pertinência, a relevância e a viabilidade de tal perspectiva para a Saúde do Trabalhador. A discussão empreendida defende que existem muitos pontos em comum entre essas abordagens, em termos teóricos...

  1. Reflexões sobre a saúde bucal no Brasil

    Directory of Open Access Journals (Sweden)

    Anya Pimentel Gomes Fernandes Vieira Meyer

    2013-12-01

    Full Text Available No último século, numerosos avanços em pesquisas e tecnologias biomédicas na área odontológica foram responsáveis por melhorias na saúde e no bem-estar das populações(1. Entretanto, apesar das grandes realizações no âmbito da saúde bucal, muitos problemas ainda permanecem, como a cárie dental, a mais comum das doenças bucais. A prevalência da cárie dentária apresentou uma tendência de declínio nas três últimas décadas do século XX e no início do século XXI, especialmente nos países desenvolvidos, contudo, ainda é considerada uma importante questão de saúde pública mundial, afetando de 60% a 90% das crianças em idade escolar, além da vasta maioria dos adultos(2-4. No levantamento epidemiológico SB Brasil 2010(5, foram observadas melhoras na condição bucal dos brasileiros, porém, ainda é alta a prevalência de cárie. Entre os adolescentes de 15 a 19 anos, por exemplo, a média de dentes afetados foi de 4,25 mais que o dobro do número médio encontrado aos 12 anos. Entre os idosos de 65a 74 anos, o número de dentes cariados, perdidos e obturados (CPO praticamente não se alterou, ficando em 27,5 em 2010, enquanto, em 2003, a média era de 27,8. Em termos internacionais, de acordo com o Ministério da Saúde brasileiro(5,um estudo realizado pela Organização Mundial da Saúde (OMS em 2004 indicou que, nos dados de 188 países, o valor médio do CPO aos 12 anos foi de 1,6, sendonas Américas a média de 2,8, enquanto na Europa ficou em 1,6. Na América do Sul,somente a Venezuela apresentou média de CPO aos 12 anos semelhante à brasileira(2,1. Nos demais países, as médias apresentaram-se mais altas, como na Argentina(3,4, Bolívia (4,7, Colômbia (2,3, Paraguai (2,8 e Peru (3,7. Os achados epidemiológicos de 2010 sobre a saúde bucal no Brasil(5mostraram que o país entrou para o grupo daqueles com baixa prevalência de carie aos 12 anos. Embora os resultados nesse quesito tenham sido animadores, a

  2. The Novel Transcriptional Regulator SA1804 Is Involved in Mediating the Invasion and Cytotoxicity of Staphylococcus aureus

    Directory of Open Access Journals (Sweden)

    JUNSHU eYANG

    2015-03-01

    Full Text Available The two-component regulatory system, SaeRS, controls expression of important virulence factors, including toxins and invasins, which contribute to the pathogenicity of Staphylococcus aureus. Previously, we conducted a transcriptomics study for identification of SaeRS regulon and found that inactivation of SaeRS dramatically enhances the transcription of a novel transcriptional regulator (SA1804. This led us to question whether SA1804 is involved in bacterial pathogenicity by regulating the expression of virulence factors. To address this question, we created sa1804, saeRS, and sa1804/saeRS double deletion mutants in a USA300 community-acquired MRSA strain, 923, and determined their impact on the pathogenicity. The deletion of sa1804 dramatically increased the cytotoxicity and enhanced the capacity of bacteria to invade into the epithelial cells (A549, whereas the deletion of saeRS eliminated the cytotoxicity and abolished the bacterial ability to invade into the epithelial cells. Moreover, the double deletions of sa1804 and saeRS appeared a similar phenotype with the saeRS null mutation. Furthermore, we determined the regulatory mechanism of SA1804 using qPCR and gel-shift approaches. Our data indicate that the novel virulence repressor SA1804 is dependent on the regulation of SaeRS. This study sheds light on the regulatory mechanism of virulence factors and allows for us further elucidate the molecular pathogenesis of S. aureus.

  3. Ang Kasaysayan at Panitikan sa Pagbuo ng Bayan: Rebyu ng Nobelang The Feet of Juan Bacnang ni F. Sionil Jose

    Directory of Open Access Journals (Sweden)

    Moreal Nagarit Camba

    2013-06-01

    Full Text Available Mababasa sa The Feet of Juan Bacnang (2011, ang pinakabagong nobela ni F. (Francisco Sionil Jose o Frankie sa kanyang mga kaibigan, ang mahigpit na ugnayan ng manunulat at ng kanyang bayan. Siya ang nagsisilbing zeitgeist ng maraming panahon; ang espiritu at boses ng nakaraan at kasalukuyan, isang manunulat na kumakatha ng mga akdang sumasalamin sa mayamang karanasan at kasaysayan ng kultura at lahing pinag-usbungan. Kung saan ang kanyang nobelang Juan Bacnang, katulad ng iba pa niyang naunang mga nobela, bagamat likhang-isip, ay repleksyon ng buhay, pasakit, at aspirasyon ng manunulat at lipunang lumikha rito; mga tunguhing hindi nalalayo sa layunin ng mga ninuno nitong anyong panitikan, ang mga epiko at kuwentong bayan. Ibig sabihin, ang akda bilang Weltanschauung na ayon kay Terry Eagleton ay “partikular na paraan ng pagtingin sa mundo; na may kaugnayan sa gahum na nagtatakda kung paano tingnan ang mundo na maituturing na ‘pag-iisip ng lipunan’ o ideyolohiya ng panahon”1 (sinipi ni Geok-Lin Lim A Modern National Epic 74. Dagdag pa rito, ang kanyang (mga nobela, partikular ang Juan Bacnang, ay nagsisilbing “siwang sa mga kurtinang-papel” sa kasaysayan;2 mga tala ng karanasan at pang-araw-araw na buhay, na madalas hindi naisusulat ng mga tradisyunal na historyador. Ito (ang mga tala, ayon kay Pierre Macherey, ang mga puwang o pinipi na boses na naisantabi ng maraming akdang pangkasaysayan (sinipi ni Eagleton Marxism and Literary Criticism 34-35.

  4. 75 FR 53609 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-500 Airplanes

    Science.gov (United States)

    2010-09-01

    ... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or... Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-500 Airplanes AGENCY: Federal Aviation... de Aeronautica S.A. (EMBRAER): Docket No. FAA- 2010-0870; Directorate Identifier...

  5. 75 FR 9814 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 190-100 STD...

    Science.gov (United States)

    2010-03-04

    ... Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic... de Aeronautica S.A. (EMBRAER) Model ERJ 190-100 STD,-100 LR,-100 IGW,-200 STD,-200 LR, and- 200 IGW..., contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Technical Publications Section (PC 060),...

  6. 75 FR 63422 - Airworthiness Directives; Embraer-Empresa Brasileira de Aeronautica S.A. Model EMB-500 Airplanes

    Science.gov (United States)

    2010-10-15

    ... rule'' under the DOT Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will... Brasileira de Aeronautica S.A. Model EMB-500 Airplanes AGENCY: Federal Aviation Administration (FAA.... 39.13 by adding the following new AD: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket...

  7. 75 FR 9811 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes

    Science.gov (United States)

    2010-03-04

    ... Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic... de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes AGENCY: Federal Aviation Administration (FAA... information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A....

  8. 77 FR 24425 - Airworthiness Directives; Empresa Brasileria de Aeronáutica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2012-04-24

    ... Procedures (44 FR 11034, February 26, 1979), (3) Will not affect intrastate aviation in Alaska, and (4) Will... proposed AD, contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Phenom Maintenance Support, Av... de Aeronautica S.A. (EMBRAER), Phenom Maintenance Support, Av. Brigadeiro Faria Lima, 2170, S o...

  9. 75 FR 8557 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135ER...

    Science.gov (United States)

    2010-02-25

    ... Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic... de Aeronautica S.A. (EMBRAER) Model EMB-135ER, -135KE, -135KL, and -135LR Airplanes; and EMBRAER... information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A....

  10. 75 FR 45558 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-500 Airplanes

    Science.gov (United States)

    2010-08-03

    ... Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic... de Aeronautica S.A. (EMBRAER) Model EMB-500 Airplanes AGENCY: Federal Aviation Administration (FAA...: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket No. FAA- 2010-0754; Directorate Identifier...

  11. 75 FR 14333 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and...

    Science.gov (United States)

    2010-03-25

    ... 12866; ] 2. Is not a ``significant rule'' under the DOT Regulatory Policies and Procedures (44 FR 11034... de Aeronautica S.A. (EMBRAER) Model ERJ 170 and Model ERJ 190 Airplanes AGENCY: Federal Aviation... by adding the following new AD: 2010-07-04 Empresa Brasileira de Aeronautica S.A....

  12. 76 FR 2279 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2011-01-13

    ... rule'' under the DOT Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will... de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ 190 Airplanes AGENCY: Federal Aviation..., contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Technical Publications Section (PC 060),...

  13. 75 FR 74670 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2010-12-01

    ... Order 12866; 2. Is not a ``significant rule'' under the DOT Regulatory Policies and Procedures (44 FR... de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ 190 Airplanes AGENCY: Federal Aviation..., contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Technical Publications Section (PC 060),...

  14. 76 FR 13539 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 190 Airplanes

    Science.gov (United States)

    2011-03-14

    ... 12866; 2. Is not a ``significant rule'' under the DOT Regulatory Policies and Procedures (44 FR 11034... de Aeronautica S.A. (EMBRAER) Model ERJ 190 Airplanes AGENCY: Federal Aviation Administration (FAA... information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A....

  15. Turismo de saúde em Portugal: turismo médico e turismo de bem-estar

    OpenAIRE

    Ferreira, Ricardo

    2013-01-01

    Mestre em Gestão de Serviços de Saúde O turismo de saúde engloba duas subcategorias, o turismo médico (cirurgias e serviços de saúde no estrangeiro) e o turismo de bem-estar (viajar para locais específicos para promoção da saúde de uma forma preventiva). Na vertente de bem-estar, há vários aspectos a considerar e diversas formas de promoção da saúde de forma preventiva, uma delas é o turismo termal (com um longo histórico em Portugal mas actualmente numa situação premente de reforma). A...

  16. A categoria racionalidade médica e uma nova epistemologia em saúde

    Directory of Open Access Journals (Sweden)

    Marilene Cabral do Nascimento

    2013-12-01

    Full Text Available O artigo é um relato analítico da trajetória de 20 anos da categoria racionalidade médica, que emergiu no Campo da Saúde Coletiva, área das Ciências Sociais e Humanas em Saúde, no início da década de 1990, com o objetivo de estudar sistemas médicos complexos e terapêuticas tradicionais, complementares e alternativas. Com base em revisão crítica da literatura, apresentam-se aspectos do contexto cultural, político-institucional e social de seu surgimento, como também suas principais contribuições e desdobramentos nos planos teórico e das políticas e práticas sociais em saúde. Utiliza-se o conceito de epistemologia do sul de Boaventura de Sousa Santos, para a reflexão sobre a contribuição da categoria racionalidade médica à crítica da racionalidade científica pós-moderna e à construção de uma nova epistemologia em saúde.

  17. Finanční analýza podniku Pegas Nonwovens, S.A.

    OpenAIRE

    Dlugošová, Lenka

    2010-01-01

    The topic of this bachelor thesis is "Financial analysis of PEGAS NONVOWENS S.A.". The main objective is to identify and analyse the overall financial situation of this company. Financial analysis is performed by implementing ratio analysis, the horizontal and vertical analysis, calculation of economic value added indicator and applying reliability and bankruptcy models. The summary contains peer analysis.

  18. Resisting Colonial Education: Zitkala-Sa and Native Feminist Archival Refusal

    Science.gov (United States)

    Terrance, Laura L.

    2011-01-01

    This paper examines resistance through a Native Feminist lens, employing the boarding school memoirs of Zitkala-Sa. Within a "story" of appropriation in methodology, it considers protest and parody, and presents archival refusal as modes of resistance to colonial education. (Contains 1 figure.)

  19. Data of evolutionary structure change: 3GD5D-3D7SA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 3GD5D-3D7SA 3GD5 3D7S D A --TRFRPDLLSLDDLDEAQLHALLTLAHQLKRGERVANL...HGKVLGLVFLKASTRTRVSFTVAMYQLGGQVIDL------------EPVRDTARVLGRYVDGLAIRTFAQTELEEYAHYAG-IPVINALTD-HEHPCQVVADLLTIRENFGRLAGLKLAYVGD...ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSFETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSGNVPVLNAGD...GSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYILDMLDEK----GIAWSLH.../index> 3GD5 D 3GD5D

  20. Data of evolutionary structure change: 1A7SA-2GDDC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A7SA-2GDDC 1A7S 2GDD A C IVGGRKARPRQFPFLASIQNQ---GRHFCGGALIHARFV...FPRFVNVTVTPEDQC-----------------RPNNVCTGVLTRRGGICNGDGGTPLVCE----GLAHGVASFSLGPCGR--GPDFFTRVALFRDWIDGVLNNPGPGP...Y----QDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGD...n14> 2GDD C 2GDDC ARG CA 404 PHE CA 422 VAL CA 380

  1. Estresse, coping e estado de saúde entre enfermeiros hospitalares

    Directory of Open Access Journals (Sweden)

    Laura de Azevedo Guido

    2011-12-01

    Full Text Available Estudo quantitativo com o objetivo de identificar estressores, nível de estresse dos enfermeiros, estado geral de saúde e formas de enfrentamento utilizadas pelos enfermeiros no ambiente de trabalho. Os dados foram coletados utilizando-se três instrumentos: formulário para levantamento de atividades diárias; inventário de estratégias de coping; inventário sobre o estado geral de saúde. A população deste estudo foi composta de 143 enfermeiros e a maioria encontra-se com baixo nível de estresse (55,25% e com estado regular de saúde (50,35%. Em relação às formas de enfrentamento, identificou-se resolução de problemas como o fator de maior média. Concluindo, ações educativas devem ser incentivadas, a fim de disponibilizar ferramentas para que o profissional desenvolva estratégias de coping resolutivas em seu dia a dia, minimizando o efeito do estresse no seu estado de saúde e no seu trabalho.

  2. Resisting the Script of Indian Education: Zitkala Sa and the Carlisle Indian School.

    Science.gov (United States)

    Enoch, Jessica

    2002-01-01

    Offers a "definition" of Zitkala Sa as an Indian teacher who, at the turn of the 20th century, challenged and countered educational norms that silenced Indian voices and erased Indian culture. Examines her autobiographical essays, "Impressions of an Indian Childhood,""The School Days of an Indian Girl," and "An Indian Teacher among Indians," in…

  3. 76 FR 77446 - Airworthiness Directives; Turbomeca S.A. Turboshaft Engines

    Science.gov (United States)

    2011-12-13

    ...-14-11, Amendment 39-15961 (74 FR 34221, July 15, 2009), for Turbomeca S.A. Arrius 2F turboshaft... wearing and finally rupture of the P3 air pipe (first section). The loss of P3 air pressure would then... autorotation landing or accident. Actions Since Existing AD Was Issued Since we issued AD 2009-14-11 (74...

  4. 75 FR 52263 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2010-08-25

    ... products. That NPRM was published in the Federal Register on June 2, 2009 (74 FR 26315). That NPRM proposed... Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant... de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes; and Model ERJ 190-100 LR, -100 IGW, -100...

  5. 76 FR 27237 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2011-05-11

    ... products. That NPRM was published in the Federal Register on February 10, 2011 (76 FR 7511). That NPRM... ''significant rule'' under the DOT Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3... de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes; and Model ERJ 190-100 STD, ERJ 190- 100...

  6. 75 FR 19201 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2010-04-14

    ... published in the Federal Register on January 5, 2010 (75 FR 260). That NPRM proposed to correct an unsafe... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or... de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes; and Model ERJ 190-100 STD, -100 LR, -100...

  7. A study of the Sa-Ahm Five Element acupuncture theory.

    Science.gov (United States)

    Ahn, Chang-Beohm; Jang, Kyung-Jun; Yoon, Hyun-Min; Kim, Cheol-Hong; Min, Young-Kwang; Song, Chun-Ho; Lee, Jang-Cheon

    2009-12-01

    This study is a review of the theoretical basis of Sa-Ahm Five Element acupuncture devised about 360 years ago. A total of 21 books and papers ranging from the ancient Huang Di Nei Jing to modern biomedical acupuncture for pain management were researched in relation to the Five Shu points. Gao-Wu, in the Chinese Ming Dynasty, used the Five Shu points for the first time based on the creation cycle as the tonification and sedation treatment, termed the "tonification and sedation treatment of self meridian". Since then, and for no particular reason, this method has been rarely used until Sa-Ahm's new doctrine, which includes the concept of the destruction cycle, was asserted. Sa-Ahm Five Element acupuncture is a method in which the Five Shu points are used from the viewpoints of the simultaneous tonification and sedation methods that are based on the promotion and control cycles. Although it is currently the most utilized method in accordance with the practitioner's points, this method is in need of designated guidelines by which Sa-Ahm acupuncture can be practiced effectively. PMID:20633508

  8. Processo comunicativo e humanização em saúde

    Directory of Open Access Journals (Sweden)

    Suely Ferreira Deslandes

    2009-01-01

    Full Text Available O artigo aborda o processo comunicacional como um dos desafios enfrentados na humanização em saúde. Reflete sobre potencialidades e requisitos para a produção do agir comunicativo e aponta alguns obstáculos, baseando-se em estudos antropológicos sobre a cultura biomédica. Com base no conceito de entendimento, discute sobre os encontros em saúde e a relevância da validação e do reconhecimento do discurso dos diferentes atores. Aponta para a importância de se relativizarem marcas identitárias associadas à cultura biomédica, desconstruírem-se alguns conceitos, criticarem seus contextos de aplicabilidade e até mesmo se propor novas marcas por meio da humanização. Discute-se a relação entre as tecnologias biomédicas e o processo comunicacional. O desafio colocado é o de aprender, reconhecer e negociar com o outro, que detém direitos, autonomia e estoque cultural peculiares. Finalmente, discute os esforços teóricos para que a humanização das práticas em saúde venha a fazer parte do ethos ou visão do mundo dos profissionais de saúde.

  9. Lech Wałęsa - kangelane või reetur? / Zygmunt Dzieciolowski ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Dzieciolowski, Zygmunt

    2016-01-01

    Intervjuu Poola politoloogi ja ajakirjaniku Zygmunt Dzieciolowskiga Solidaarsuse liikumise juhi Lech Wałęsa elu tumedatest varjudest, käimasolevast skandaalist seoses tema sidemetega kommunistliku režiimi salapolitsei SBga ning kohast Poola ühiskonnas ja ajaloos

  10. SA-based concrete seismic stress monitoring: a case study for normal strength concrete

    Science.gov (United States)

    Hou, S.; Zhang, H. B.; Ou, J. P.

    2016-09-01

    The stress history of concrete structures that have survived an earthquake can serve as a critical index to evaluate the health of the structure. There are currently few reliable monitoring methods to assess concrete stress after a seismic event. Piezoelectric-based smart aggregate (SA) provides an innovative experimental approach to monitor stress on concrete. The principle of SA-based concrete seismic stress monitoring is based on the assumption that concrete stress can be reliably predicted by the average output voltages of limited SAs with an acceptable margin of error. In this study, the meso-scale randomness of concrete was evaluated throughout the overall stress range of concrete and the influence of different load paths was considered. Four cylindrical specimens of normal strength concrete were embedded with a total of 24 SAs. The SA output sensitivity curve in the paths of loading–unloading with different amplitudes and monotonic loading up to failure was obtained. Monitoring errors were analyzed during pre- and post-peak stages from the experimental results. This research suggests that SA-based concrete seismic stress monitoring for normal strength concrete is reliable.

  11. Le comité scientifique du PPARC publie sa stratégie

    CERN Multimedia

    2003-01-01

    "Le comite scientifique du PPARC a publie un document resumant sa strategie pour les dix prochaines annees et ses recommandations en termes de programme scientifique ("Recommended Science Programme ou RSP). Le conseil de recherche PPARC s'est felicite du RSP, l'a approuve et a decide de l'utiliser comme base pour son plan operationnel detaille sur trois ans" (1 page).

  12. Fenomenologia heideggeriana como referencial para estudos sobre formação em saúde

    Directory of Open Access Journals (Sweden)

    Alberto Durán González

    2012-09-01

    Full Text Available Reflete-se sobre as possibilidades da fenomenologia heideggeriana como referência na análise da educação na saúde. Heidegger propõe, em "Ser e tempo", a investigação sobre o sentido do ser, fundamental para o conhecimento que o homem possa ter de si mesmo como ser finito. Suas ideias provocaram transformações na concepção humanista moderna e na prática em educação. O indivíduo é sempre ator, sendo na medida em que existe, experimentando a si próprio na existência. O modo de ser privativo da saúde, o padecimento, é acompanhado sempre de uma limitação da possibilidade de viver. Assim, a fenomenologia heideggeriana nos ajuda a questionar a educação em saúde. Compreende-se que o homem se encontra sempre em copresença, entre a preocupação substitutiva e a libertadora. Este caminho se mostra possível quando contemplados os diversos modos de ser-professor e de ser-estudante. Possibilita-se, assim, aprofundar o ensinar-aprender na formação em saúde.

  13. Whole-Genome Sequence of Staphylococcus aureus Strain LCT-SA112

    OpenAIRE

    Wang, Junfeng; Liu, Yanhong; Wan, Daiwei; Fang, Xiangqun; Li, Tianzhi; Guo, Yinghua; Chang, De; Su, Longxiang; Wang, Yajuan; Zhao, Jiao; Liu, Changting

    2012-01-01

    Staphylococcus aureus is a facultative anaerobic Gram-positive coccal bacterium. S. aureus is the most common species of Staphylococcus to cause staphylococcal infections, which are very common in clinical medicine. Here we report the genome sequence of S. aureus strain LCT-SA112, which was isolated from S. aureus subsp. aureus CGMCC 1.230.

  14. Mulher, direito e saúde: repensando o nexo coesivo Women, rights and health

    Directory of Open Access Journals (Sweden)

    Rosa Maria Godoy Serpa da Fonseca

    1999-12-01

    Full Text Available Esse artigo é construído a partir de três elementos básicos: mulher, direito e saúde, articulados entre si a partir de: 1 considerações acerca das condições objetivas de constituição das mulheres enquanto sujeitos sociais na sociedade contemporânea; 2 direitos das mulheres como direitos humanos e 3 direito das mulheres à saúde no contexto da implementação do PAISM (Programa de Atenção Integral à Saúde da Mulher, como focalização do SUS (Sistema Único de Saúde.That article is built from three basic elements: women, rights and health, articulated to each other starting from: 1 considerations concerning the objective conditions of the women's constitution as social subjects in contemporary society; 2 women's rights as human rights and 3 women's rights to health in the context of PAISM (Program of Integral Attention to the Woman's Health, as part of SUS (Unified System of Health.

  15. Sentimentos e percepções da equipe de saúde frente ao paciente terminal

    Directory of Open Access Journals (Sweden)

    Alberto Manuel Quintana

    2006-12-01

    Full Text Available O atendimento a pacientes terminais pelas equipes de saúde, comprovadamente apontado por evidências na literatura, mostra a grande dificuldade que esses profissionais têm em lidar com o tema "morte". O presente estudo objetivou compreender como as equipes de saúde definem e vivenciam o paciente terminal. Para tanto, utilizou-se uma abordagem qualitativa que empregou a pesquisa etnográfica através de observação não-participativa, além de entrevistas semi-estruturadas nas unidades de hemato-oncologia e de infectologia de um hospital público. Os resultados certificaram as dificuldades por parte da equipe em lidar com pacientes terminais, bem como em defini-los como tais e comunicar aos mesmos a sua condição. Dessa forma, percebeu-se a intensa necessidade da realização de um trabalho direto com as equipes de saúde com o intuito de lhes proporcionar um espaço de reflexão e de entendimento, propiciando a continência das emoções suscitadas na equipe de saúde perante a situação da morte.

  16. Novel Castellaniella denitrificans SA13P as a Potent Malachite Green Decolorizing Strain

    Directory of Open Access Journals (Sweden)

    Ankita Chawla

    2014-01-01

    Full Text Available Triphenylmethane dyes represent a major group of dyes causing serious environmental hazards. Malachite Green is one of the commonly and extensively used triphenylmethane dyes although it is carcinogenic and mutagenic in nature. Various physicochemical methods have been employed for its elimination but are highly expensive, coupled with the formation of huge amount of sludge. Hence, biological methods being ecofriendly are good alternatives. In the present study, the novel bacterial isolate SA13P was isolated from UASB tank of tannery effluent treatment plant. Phylogenetic characterization of 1470 bp fragment of SA13P has revealed its similarity with Castellaniella denitrificans. This strain has been found to decolorize the dye (malachite green at a concentration of 100 mg L−1 (80.29%. Decolorization was done by living bacterial cells rather than adsorption. Growth conditions have also been optimized for the decolorization. Maximum decolorization was observed at a temperature of 37°C and pH 8.0. Also, it has been found that bacterization of seeds of Vigna radiata with Castellaniella denitrificans SA13P increases germination rate. We have reported for the first time that Castellaniella denitrificans SA13P may be used as a novel strain for dye decolorization (malachite green and biological treatment of tannery effluent.

  17. 78 FR 275 - Airworthiness Directives; REIMS Aviation S.A. Airplanes

    Science.gov (United States)

    2013-01-03

    ... 12866, (2) Is not a ``significant rule'' under the DOT Regulatory Policies and Procedures (44 FR 11034... Directives; REIMS Aviation S.A. Airplanes AGENCY: Federal Aviation Administration (FAA), Department of Transportation (DOT). ACTION: Notice of proposed rulemaking (NPRM). SUMMARY: We propose to adopt a...

  18. Programa Saúde da Família no Brasil: uma agenda incompleta?

    Directory of Open Access Journals (Sweden)

    Maria Fátima de Sousa

    2009-10-01

    Full Text Available Este artigo trata de uma análise longitudinal da experiência brasileira com o Programa Saúde da Família (PSF, ao longo dos doze anos da sua implantação e implementação. Toma como ponto de partida o propósito fundamental desta estratégia, que é a reorganização da atenção básica de saúde, contextualizando à luz da experiência que é única e peculiar ao Sistema Único de Saúde (SUS. Evidencia os avanços e desafios do PSF, apontando nesse sentido as necessidades mais urgentes em termos de incorporação tecnológica, formação da força de trabalho, estabelecimento de novos mecanismos e pactos em torno do financiamento da atenção básica e encaminhamento de novas estratégias e tecnologias nos processos de monitoramento e avaliação. Finaliza apontando elementos para subsidiar um debate sobre as questões em pauta, o qual deve ser permanente e lúcido na perspectiva da construção do SUS e do direito à saúde.

  19. Propagandas de medicamentos: a saúde como produto de consumo

    Directory of Open Access Journals (Sweden)

    Elaine Teixeira Rabello

    2012-06-01

    Full Text Available O objetivo deste estudo foi discutir as propagandas televisivas de medicamentos como forma de transmissão e representação das concepções circulantes sobre saúde, funções e uso de medicamentos. Foi realizada uma análise de conteúdo qualitativa em dez propagandas televisivas, diretas ao consumidor, de medicamentos de comercialização livre no mercado brasileiro, e uma propaganda institucional de uma empresa farmacêutica. Os dados mostraram que a noção que entrelaça as ideias subjacentes às mensagens e as funções do medicamento anunciadas é a de que os "problemas de saúde" advêm de questões corporais, relacionais ou sociais, mas a solução apresentada é individual e consagra-se na compra e no uso do medicamento. A análise sugere, enfim, que noções de saúde e qualidade de vida podem estar marcadas por noções que fundamentam o ideal de saúde atrelado ao consumo.

  20. SaTool - a Software Tool for Structural Analysis of Complex Automation Systems

    DEFF Research Database (Denmark)

    Blanke, Mogens; Lorentzen, Torsten

    2006-01-01

    The paper introduces SaTool, a tool for structural analysis, the use of the Matlab (R)-based implementation is presented and special features are introduced, which were motivated by industrial users. Salient features of tool are presented, including the ability to specify the behavior of a comple...

  1. SA-based concrete seismic stress monitoring: a case study for normal strength concrete

    Science.gov (United States)

    Hou, S.; Zhang, H. B.; Ou, J. P.

    2016-09-01

    The stress history of concrete structures that have survived an earthquake can serve as a critical index to evaluate the health of the structure. There are currently few reliable monitoring methods to assess concrete stress after a seismic event. Piezoelectric-based smart aggregate (SA) provides an innovative experimental approach to monitor stress on concrete. The principle of SA-based concrete seismic stress monitoring is based on the assumption that concrete stress can be reliably predicted by the average output voltages of limited SAs with an acceptable margin of error. In this study, the meso-scale randomness of concrete was evaluated throughout the overall stress range of concrete and the influence of different load paths was considered. Four cylindrical specimens of normal strength concrete were embedded with a total of 24 SAs. The SA output sensitivity curve in the paths of loading-unloading with different amplitudes and monotonic loading up to failure was obtained. Monitoring errors were analyzed during pre- and post-peak stages from the experimental results. This research suggests that SA-based concrete seismic stress monitoring for normal strength concrete is reliable.

  2. Perilaku Wirausaha Industri Keramik Berskala Kecil untuk Meningkatkan Daya Saing Produk di Malang

    Directory of Open Access Journals (Sweden)

    Sri Hadiati

    2008-01-01

    Full Text Available The purposes of the study was to find out the explanation of ceramic entrepreneurs’ respond to the environment factors affecting competitiveness of small scale ceramic industries (SSCIs. The environment factors are internal and external then form a strategy. The research was carried out in Malang using a survey and case study. Data were collected using questionnaire and in-depth interview from 107 SSCIs that was chosen randomly chosen from 180 registered SSCIs. Structural Equation Modeling (SEM with AMOS software was used to analyze data. The research results showed that environment factors were both directly and indirectly affecting SSCI’s competitiveness through strategy. In order to increase competitiveness then SSCIs need to empower the existing producers’ association in some aspects such as provision of raw material, pricing the products, and marketing. Training, education, and research need to be developed and improved by local government and higher education institutions. Abstract in Bahasa Indonesia: Penelitian ini bertujuan mencari penjelasan tentang perilaku wirausaha keramik terhadap faktor-faktor lingkungan yang mempengaruhi daya saing industri keramik berskala kecil di Malang. Secara spesifik penelitian ini bertujuan mempelajari pengaruh faktor internal dan eksternal terhadap strategi dan daya saing serta pengaruh strategi terhadap daya saing industri keramik berskala kecil di Malang. Faktor-faktor lingkungan tersebut dapat dikelompokkan kedalam faktor internal dan eksternal perusahaan. Penelitian diambil dari 107 industri keramik berskala kecil yang dipilih secara acak sederhana dari 180 unit usaha yang ada di Malang. Data dikumpulkan menggunakan kuesioner dan wawancara mendalam. Variabel dalam penelitian dibagi menjadi 4 kelompok yaitu, faktor lingkungan internal dan eksternal dari usaha kecil, strategi dan daya saing industri keramik berskala kecil. Data yang diperoleh selanjutnya dianalisis menggunakan Structural Equation

  3. Discriminative Stimulus Properties of the Endocannabinoid Catabolic Enzyme Inhibitor SA-57 in Mice.

    Science.gov (United States)

    Owens, Robert A; Ignatowska-Jankowska, Bogna; Mustafa, Mohammed; Beardsley, Patrick M; Wiley, Jenny L; Jali, Abdulmajeed; Selley, Dana E; Niphakis, Micah J; Cravatt, Benjamin F; Lichtman, Aron H

    2016-08-01

    Whereas the inhibition of fatty acid amide hydrolase (FAAH) or monoacylglycerol lipase (MAGL), the respective major hydrolytic enzymes of N-arachidonoyl ethanolamine (AEA) and 2-arachidonoylglycerol (2-AG), elicits no or partial substitution for Δ(9)-tetrahydrocannabinol (THC) in drug-discrimination procedures, combined inhibition of both enzymes fully substitutes for THC, as well as produces a constellation of cannabimimetic effects. The present study tested whether C57BL/6J mice would learn to discriminate the dual FAAH-MAGL inhibitor SA-57 (4-[2-(4-chlorophenyl)ethyl]-1-piperidinecarboxylic acid 2-(methylamino)-2-oxoethyl ester) from vehicle in the drug-discrimination paradigm. In initial experiments, 10 mg/kg SA-57 fully substituted for CP55,940 ((-)-cis-3-[2-hydroxy-4-(1,1-dimethylheptyl)phenyl]-trans-4-(3-hydroxypropyl)cyclohexanol), a high-efficacy CB1 receptor agonist in C57BL/6J mice and for AEA in FAAH (-/-) mice. Most (i.e., 23 of 24) subjects achieved criteria for discriminating SA-57 (10 mg/kg) from vehicle within 40 sessions, with full generalization occurring 1 to 2 hours postinjection. CP55,940, the dual FAAH-MAGL inhibitor JZL195 (4-​nitrophenyl 4-​(3-​phenoxybenzyl)piperazine-​1-​carboxylate), and the MAGL inhibitors MJN110 (2,5-dioxopyrrolidin-1-yl 4-(bis(4-chlorophenyl)methyl)piperazine-1-carboxylate) and JZL184 (4-[Bis(1,3-benzodioxol-5-yl)hydroxymethyl]-1-piperidinecarboxylic acid 4-nitrophenyl ester) fully substituted for SA-57. Although the FAAH inhibitors PF-3845 ((N-3-pyridinyl-4-[[3-[[5-(trifluoromethyl)-2-pyridinyl]oxy]phenyl]methyl]-1-piperidinecarboxamide) and URB597 (cyclohexylcarbamic acid 3'-(aminocarbonyl)-[1,1'-biphenyl]-3-yl ester) did not substitute for SA-57, PF-3845 produced a 2-fold leftward shift in the MJN110 substitution dose-response curve. In addition, the CB1 receptor antagonist rimonabant blocked the generalization of SA-57, as well as substitution of CP55,940, JZL195, MJN110, and JZL184. These findings

  4. La participation des acteurs locaux à l’élaboration et l’évaluation des politiques publiques de développement durable  en Nouvelle-Calédonie

    Directory of Open Access Journals (Sweden)

    Séverine Bouard

    2008-11-01

    Full Text Available L’objet de cet article est d’explorer les conditions et l’opérationnalité d’une réflexion participative sur le développement durable et ses implications pour élaborer et évaluer des politiques publiques de développement. Après une présentation succincte des controverses dont fait l’objet le concept de développement durable à l’échelle mondiale, nous tenterons de préciser les enjeux de durabilité dans le contexte de la Nouvelle-Calédonie. L’entrée privilégie les articulations entre les trois dimensions de la durabilité, en s’appuyant sur les formes localement perçues de la performance économique, de l’intégrité de l’environnement et de l’équité sociale. Pour illustrer ces enjeux, nous nous intéressons plus précisément à la gestion sociale des impacts d’un important projet industriel d’extraction et de traitement du nickel dans la province Nord de Nouvelle-Calédonie. L’article décrit ensuite les principes à respecter pour la mise en place d’un suivi évaluation concerté entre les différents acteurs, susceptible de faciliter la prise en charge de cette transversalité et la gestion sociale des impacts du projet. Nous partons pour cela des acquis d’un programme de recherche portant sur l’élaboration d’une méthode de suivi évaluation participatif des programmes de développement local en province Nord. Enfin, nous insisterons sur les contraintes à l’efficacité et à la pérennité de dispositifs réellement participatifs, mais aussi à l’application des principes du développement durable, notamment dans le contexte du Pacifique insulaire.The aim of this article is to investigate the conditions and the interests of a participatory reflexion on the sustainable development and its consequences to draw up and to assess development policies. After a brief display of the controversies carried out by the use and sense of the “sustainable development”, we explain what is at

  5. La vente des biens nationaux à la fin du XVIIIe siècle, nouvelle donne pour la ville The sale of national assets at the end of the 18th century – a gift to the city

    Directory of Open Access Journals (Sweden)

    François Antoine

    2009-05-01

    Full Text Available À la fin de l’Ancien Régime, les villes des Pays-Bas gardaient les traits de villes médiévales sans ordre et faites d’entrelacs de rues et de ruelles. Le caractère corporatif de la production limitait la présence de grands ensembles industriels et les couvents et leurs jardins occupaient une grande partie de la superficie intra et extra muros des cités. Par ailleurs, l’Église était propriétaire d’un important parc immobilier de petites demeures adossées à des églises jusqu’aux importants refuges d’abbayes dominant dans les campagnes de vastes espaces fonciers. Durant la deuxième moitié du xviiie, les autorités habsbourgeoises menèrent une politique tendant à moderniser les villes en faisant, en autres, tomber les enceintes et en donnant une nouvelle affectation aux couvents contemplatifs supprimés. La Révolution française bouleversa ces ensembles urbains en libérant d’un coup une masse très importante de biens immobiliers qui appartenait à l’Église et en modifiant radicalement les modes de production par la suppression des corporations de métiers. La bourgeoisie principalement négociante réussi habilement tirer tous les profits de cette nouvelle donne. Cet effet d’aubaine contribua grandement à faire passer nos régions dans un nouveau stade de leur démarrage industriel.At the end of the Ancien Régime, the towns of the Netherlands retained the characteristics of medieval towns, without any order and consisting of warrens of streets and alleys. The corporative nature of production limited the presence of major industrial complexes and the monasteries and convents, together with their gardens, covered a large part of the urban areas both within and outside city walls. In addition, the church had important property holdings, ranging from small residential properties attached to churches to major abbey residences dominating vast countryside estates. During the second half of the 18th century, the

  6. As representações da saúde bucal na mídia impressa

    Directory of Open Access Journals (Sweden)

    Aline Guio Cavaca

    2012-12-01

    Full Text Available Buscou-se compreender como as informações sobre Saúde Bucal são veiculadas pela mídia impressa no estado do Espírito Santo - Brasil, por meio de uma pesquisa qualitativa, com análise de conteúdo de 66 matérias relacionadas à temática, veiculadas no período de março de 2004 a junho de 2009, nos jornais A Gazeta e A Tribuna.O material empírico originou sete categorias analíticas: responsabilização do indivíduo; realidades extremas; imaginário popular do dentista e do consultório dentário; patologização da halitose; valorização estética; determinantes da saúde bucal; prevenção e hábitos. A abordagem midiática da saúde bucal perpassa uma complexidade de fatores sociais, culturais, políticos, biológicos e econômicos, que destaca a importância de uma comunicação contextualizada com os interesses da sociedade, que seja interativa e dialógica e explore sua potência crítica na educação e promoção da saúde, veiculando, de maneira consciente, o consumismo em Saúde Bucal.

  7. Development of a linear motion antenna for the JT-60SA ECRF system

    Energy Technology Data Exchange (ETDEWEB)

    Moriyama, Shinichi, E-mail: moriyama.shinichi@jaea.go.jp [Fusion Research and Development Directorate, Japan Atomic Energy Agency, Mukoyama 801-1, Naka, Ibaraki 311-0193 (Japan); Kobayashi, Takayuki; Isayama, Akihiko; Hoshino, Katsumichi; Suzuki, Sadaaki; Hiranai, Shinichi; Yokokura, Kenji; Sawahata, Masayuki; Terakado, Masayuki; Hinata, Jun; Wada, Kenji; Sato, Yoshikatsu [Fusion Research and Development Directorate, Japan Atomic Energy Agency, Mukoyama 801-1, Naka, Ibaraki 311-0193 (Japan)

    2013-10-15

    Highlights: ► Development of an antenna featuring linear motion (LM) concept for long pulse electron cyclotron range of frequency (ECRF) heating and current drive in JT-60SA is in progress. ► A mock-up using a metallic sliding bearing with solid lubricant was fabricated. ► A vacuum pumping test with mass analyzer showed evidence of some hydrocarbons during shaft motion. ► Injection beam profile in toroidal beam scan was checked by low power measurement with mock-up. ► Current drive characteristics with the LM antenna for typical experimental scenarios of JT-60SA have been investigated by calculation. -- Abstract: Development of an antenna that features the linear motion (LM) concept for long-pulse electron-cyclotron range of frequency heating and current drive for the JT-60SA is in progress. Combining a linearly movable first mirror and a fixed curved second mirror allows the injection-beam angle to be controlled. Cooling water is fed through the drive shaft for the first mirror and through the fixed support for the second mirror. The shaft support structure uses a metallic sliding bearing with a solid lubricant. The sliding bearing supports combined linear and rotational motion, whereas a conventional ball bearing supports either linear or rotational motion. Therefore, the sliding bearing offers the advantage of reducing the support-structure volume, which is important in the design of the relatively narrow port duct of the JT-60SA. Recently, the sliding bearing has been installed into the mockup. Results of a vacuum test with a mass analyzer indicate the presence of hydrocarbons during shaft motion. The injection-beam profile obtained from a toroidal beam scan is checked against low-power measurements taken on the mockup. Finally, for typical JT-60SA experimental scenarios, heating- and current-drive characteristics of the LM antenna are investigated theoretically.

  8. O emprego de auxiliares de saúde em áreas de desenvolvimento: alguns conceitos

    Directory of Open Access Journals (Sweden)

    Nilton Tornero

    1978-11-01

    Full Text Available In this paper the author discusses the real meaning of health auxiliary according to World Health Organization criteria. Next he discusses_ the relationship between health auxiliary and primary sanitary aid models, trying to show how the right comprehension of some elements of theses models will be of the highest importance to the definition of the auxiliary's functions. Among such elements he calls attention to the relationships between health services and other services offered to the community by other organizations: the choice of the workable area as pre-requisites to the training of personnel; relationships among the primary health aid and the services of campaign, the preventive and curative medicine and general guidelines for the pacification, management and training of health manpower.No presente trabalho procura-se conceituar o que se entende por auxiliar de saúde segundo critérios da Organização Mundial de Saúde. Discute-se, a seguir, as relações existentes entre o auxiliar de saúde e os modelos de assistência sanitária primária, procurando mostrar como a compreensão correta de alguns elementos destes modelos serão de primordial importância na definição das funções dos auxiliares de saúde. Dentre tais elementos, aborda-se: as relações entre o setor saúde e outros setores da sociedade; a escolha da área programática de atuação como pré-requisito para a preparação do pessoal; relações entre assistência primária e os serviços de campanhas, a medicina preventiva e curativa, e as diretrizes gerais para a planificação, gestão e formação dos recursos humanos.

  9. Partial Activation of SA- and JA-Defensive Pathways in Strawberry upon Colletotrichum acutatum Interaction.

    Science.gov (United States)

    Amil-Ruiz, Francisco; Garrido-Gala, José; Gadea, José; Blanco-Portales, Rosario; Muñoz-Mérida, Antonio; Trelles, Oswaldo; de Los Santos, Berta; Arroyo, Francisco T; Aguado-Puig, Ana; Romero, Fernando; Mercado, José-Ángel; Pliego-Alfaro, Fernando; Muñoz-Blanco, Juan; Caballero, José L

    2016-01-01

    Understanding the nature of pathogen host interaction may help improve strawberry (Fragaria × ananassa) cultivars. Plant resistance to pathogenic agents usually operates through a complex network of defense mechanisms mediated by a diverse array of signaling molecules. In strawberry, resistance to a variety of pathogens has been reported to be mostly polygenic and quantitatively inherited, making it difficult to associate molecular markers with disease resistance genes. Colletotrichum acutatum spp. is a major strawberry pathogen, and completely resistant cultivars have not been reported. Moreover, strawberry defense network components and mechanisms remain largely unknown and poorly understood. Assessment of the strawberry response to C. acutatum included a global transcript analysis, and acidic hormones SA and JA measurements were analyzed after challenge with the pathogen. Induction of transcripts corresponding to the SA and JA signaling pathways and key genes controlling major steps within these defense pathways was detected. Accordingly, SA and JA accumulated in strawberry after infection. Contrastingly, induction of several important SA, JA, and oxidative stress-responsive defense genes, including FaPR1-1, FaLOX2, FaJAR1, FaPDF1, and FaGST1, was not detected, which suggests that specific branches in these defense pathways (those leading to FaPR1-2, FaPR2-1, FaPR2-2, FaAOS, FaPR5, and FaPR10) were activated. Our results reveal that specific aspects in SA and JA dependent signaling pathways are activated in strawberry upon interaction with C. acutatum. Certain described defense-associated transcripts related to these two known signaling pathways do not increase in abundance following infection. This finding suggests new insight into a specific putative molecular strategy for defense against this pathogen. PMID:27471515

  10. Gestão do conhecimento em instituições de saúde portuguesas

    Directory of Open Access Journals (Sweden)

    Sofia Gaspar Cruz

    2016-06-01

    Full Text Available RESUMO A gestão do conhecimento impõe-se como uma necessidade premente para as organizações de vários setores da economia, inclusive do setor da saúde. Objetivo: avaliar a perceção dos colaboradores de instituições de saúde relativamente à gestão do conhecimento na instituição onde atuam e analisar a existência de diferenças nessa perceção, em função do modelo de gestão da instituição. Método: estudo realizado numa amostra de 671 colaboradores de dez instituições de saúde portuguesas, com diferentes modelos de gestão. Para avaliar a perceção de gestão do conhecimento, utilizamos uma escala construída a partir de itens de escalas disponíveis na literatura. Resultados: evidenciam perceção de moderada gestão do conhecimento nas instituições de saúde e diferenças estatisticamente significativas na perceção de gestão do conhecimento, em cada modelo de gestão. Conclusão: a gestão do conhecimento ocorre nas instituições de saúde, e o modelo de gestão vigente influencia a forma como elas gerenciam o seu conhecimento.

  11. Saúde organizacional e síndrome de burnout em escolas e hospitais

    Directory of Open Access Journals (Sweden)

    Etienne Andrade de Medeiros Dantas

    2012-04-01

    Full Text Available Estudou-se a prevalência da síndrome de burnout em instituições hospitalares e escolares em conformidade com a saúde organizacional dessas instituições. A pesquisa empírica foi realizada em três escolas públicas de ensino médio e em três hospitais públicos, sendo um geral, um especializado e outro militar. Contou-se com amostra acidental de 168 participantes. Para avaliação da prevalência da síndrome de burnout, aplicaram-se o Inventário de Burnout de Maslach (MBI e uma ficha sociodemográfica. Para análise de saúde organizacional, foram realizadas entrevistas semi-estruturadas com pessoas-chave das organizações, utilizando um roteiro baseado nos fatores-componentes do construto. Os resultados corroboram a expectativa de alta prevalência da síndrome de burnout. Entretanto, não se encontraram diferenças de prevalência entre as instituições participantes, embora os participantes das escolas apresentem escores mais elevados no fator de Diminuição da Realização Pessoal. Em relação à variação da saúde organizacional, observou-se uma precária saúde organizacional em todas as instituições pesquisadas.  No entanto, considerando a alta prevalência da síndrome de burnout, é adequado assinalar que os resultados corroboram a previsão de que um ambiente de saúde organizacional deficiente amplia a probabilidade de desenvolvimento da síndrome pelos trabalhadores.

  12. Partial Activation of SA- and JA-Defensive Pathways in Strawberry upon Colletotrichum acutatum Interaction

    Science.gov (United States)

    Amil-Ruiz, Francisco; Garrido-Gala, José; Gadea, José; Blanco-Portales, Rosario; Muñoz-Mérida, Antonio; Trelles, Oswaldo; de los Santos, Berta; Arroyo, Francisco T.; Aguado-Puig, Ana; Romero, Fernando; Mercado, José-Ángel; Pliego-Alfaro, Fernando; Muñoz-Blanco, Juan; Caballero, José L.

    2016-01-01

    Understanding the nature of pathogen host interaction may help improve strawberry (Fragaria × ananassa) cultivars. Plant resistance to pathogenic agents usually operates through a complex network of defense mechanisms mediated by a diverse array of signaling molecules. In strawberry, resistance to a variety of pathogens has been reported to be mostly polygenic and quantitatively inherited, making it difficult to associate molecular markers with disease resistance genes. Colletotrichum acutatum spp. is a major strawberry pathogen, and completely resistant cultivars have not been reported. Moreover, strawberry defense network components and mechanisms remain largely unknown and poorly understood. Assessment of the strawberry response to C. acutatum included a global transcript analysis, and acidic hormones SA and JA measurements were analyzed after challenge with the pathogen. Induction of transcripts corresponding to the SA and JA signaling pathways and key genes controlling major steps within these defense pathways was detected. Accordingly, SA and JA accumulated in strawberry after infection. Contrastingly, induction of several important SA, JA, and oxidative stress-responsive defense genes, including FaPR1-1, FaLOX2, FaJAR1, FaPDF1, and FaGST1, was not detected, which suggests that specific branches in these defense pathways (those leading to FaPR1-2, FaPR2-1, FaPR2-2, FaAOS, FaPR5, and FaPR10) were activated. Our results reveal that specific aspects in SA and JA dependent signaling pathways are activated in strawberry upon interaction with C. acutatum. Certain described defense-associated transcripts related to these two known signaling pathways do not increase in abundance following infection. This finding suggests new insight into a specific putative molecular strategy for defense against this pathogen. PMID:27471515

  13. Évolution et manifestation de la nouvelle esthétique de l’image et de la poétique de la parole dans l’avant-garde russe, exprimée dans les livres d’artistes futuristes

    Directory of Open Access Journals (Sweden)

    Elina Knorpp

    2011-07-01

    Full Text Available Bien que le futurisme russe, à ses débuts, fût influencé par les futuristes italiens, il évolua d’une manière autonome. Dans le domaine de la littérature, on trouve un grand nombre de groupements futuristes divers, tandis que dans les arts visuels, le soi disant Cubo-futurisme voyait le jour. Le Cubo-futurisme liait des tendances cubistes et futuristes afin de faire advenir une forme singulièrement russe. Les livres futuristes, publiés dans les années 1910, nous montrent la naissance d’une nouvelle esthétique du texte et de l’image ainsi que la rupture avec les anciennes normes littéraires et artistiques. Ceci s’exprime à travers des illustrations, la création d’une nouvelle langue et l’entrelacs de l’image et de la parole. Cet article analyse les commencements du futurisme en Russie à partir de plusieurs livres russes pris comme exemples de cette esthétique nouvelle.Although the Russian Futurist movement was initially influenced by the Italian Futurists, it developed in an independent way. In literature, there had been a number of different futurist groups, whereas in the visual arts, the so-called Cubo-Futurism was established, linking the cubist and futurist tendencies in a singularly Russian form. Futurist books, published in the1910s, show the birth of a new aesthetics of text and image and the break with older literary and artistic norms. This was expressed through illustrations, new language and the affiliation of image and word. This article examines the beginnings of Futurism in Russia and considers a few Futurist books as examples of this new aesthetic.

  14. La nouvelle alimentation pulsée de 60MW à 0.5Hz pour le Synchrotron à protons du CERN un système totalement statique avec stockage d’énergie par condensateurs

    CERN Document Server

    Burnet, Jean-Paul

    2010-01-01

    Le Synchrotron à proton (PS) du CERN est un accélérateur de particules mis en service en 1959. Aujourd’hui, il est plus que jamais un élément essentiel de la chaine des accélérateurs du CERN. Il reçoit les protons d’un pré-accélérateur à une énergie de 1.4GeV et il les accélère jusqu’à 25GeV. Les cycles d’accélération durent 1.2 ou 2.4 secondes et s’enchainent les uns à la suite des autres, 5000 heures par an. Cent un aimants sont répartis sur les six cents mètres de circonférence de la machine et créent un champ magnétique qui permet de conserver les protons sur la trajectoire circulaire de la machine. Ils sont tous connectés en série et alimentés par un seul convertisseur de puissance. En réalité, ce convertisseur est un système de puissance complexe comprenant un groupe tournant de 90MVA. Ce groupe est en service depuis 1968 et après plus de 200 millions de cycles, montre des signes de fatigue. Une nouvelle alimentation prendra bientôt la relève. La solution reten...

  15. Télédétection de la chlorophylle de surface dans un système lagonaire tropical : validation des données MODIS couleur de l'eau du lagon sud-ouest de Nouvelle-Calédonie : rapport de stage

    OpenAIRE

    Savranski, T.

    2010-01-01

    L'observation par satellite de la couleur de l'océan, donc de la chlorophylle, est fondamentale pour comprendre les écosystèmes marins et le cycle du carbone du lagon sud-ouest de Nouvelle-Calédonie. L'objectif est de valider les mesures satellites par comparaison de la chlorophylle estimée à l'aide des algorythmes OC3 et OC5 par le capteur MODIS (Moderate Resolution Imaging Spectroradiometer) avec la chlorophylle totale in-situ. La construction d'une base de données issues des différentes ca...

  16. Saúde mental infantil na atenção primária à saúde: discursos de profissionais médicos

    Directory of Open Access Journals (Sweden)

    Fernanda Márcia de Azevedo Gomes

    2015-03-01

    Full Text Available O impacto de ações que asseguram o crescimento e o desenvolvimento da criança, tais como a redução da mortalidade infantil e dos índices de desnutrição, é significativo nos últimos anos. No entanto, estima-se que 10 a 20% da população infantil sofre com transtornos mentais, e de 3 a 4% necessitam tratamento intensivo. Neste sentido, é fundamental compreender como os profissionais médicos da atenção primária à saúde (APS lidam com tais questões. A pesquisa buscou compreender sentidos e significados sobre saúde mental infantil (SMI dos profissionais médicos da APS por meio dos seus discursos. Foram realizadas entrevistas contendo um questionário para a caracterização sociodemográfica e um roteiro semidirigido. Como resultados do processo de análise, emergiram cinco núcleos de significação, indicando: (1 limitações com relação à implicação no tratamento das condições que envolvem problemas de SMI; (2 a “família desestruturada” como determinante fundamental do sofrimento psíquico da criança que nela convive; (3 a mãe como principal responsável pela saúde mental de seu filho; (4 a transcrição da receita e averiguação dos retornos aos especialistas como condutas centrais nos casos de problemas de SMI, e (5 a fragmentação das ações de cuidado devido à segmentação das responsabilidades no tratamento de problemas de SMI. É fundamental a escuta qualificada das necessidades das famílias e das mães e/ou responsáveis pelas crianças que enfrentam problemas de saúde mental, bem como a concentração de esforços na construção de ações intersetoriais e na formação continuada em SMI.

  17. Inductors of change in the training of health personnel: pró-saúde and pet-saúde (pro-health and pet-health strategies

    OpenAIRE

    Isabel Cristina Luck Coelho de Holanda; Magda Moura de Almeida; Edyr Marcelo Costa Hermeto

    2012-01-01

    In the last decade, the training of health professionals has been redesigned in order to meet people’s health needs and not just their demands. Public policies on education and health promoted in partnership with the Ministry of Education and Culture (MEC) and the Ministry of Health (Ministério da Saúde - MS) signaled for a curricular reform that is essential to graduate schools in health area(1,2).The milestone in the formalization of this change was the introduction of the National Curricul...

  18. Enfermagem e saúde ambiental: possibilidades de atuação para a promoção da saúde

    OpenAIRE

    Maria do Socorro Vieira Lopes; Lorena Barbosa Ximenes

    2011-01-01

    Este estudo qualitativo objetivou compreender o significado de participação para os integrantes do Comitê da Sub-Bacia Hidrográfica do Rio Salgado, CE, Brasil, subsidiando a promoção da saúde para um ambiente sustentável no que se refere aos recursos hídricos; refletir sobre a interface enfermagem/ambiente a partir do componente hídrico. Os sujeitos foram 18 representantes do comitê. Os dados foram coletados através de entrevista, analisados através do Discurso do Sujeito Coletivo. A compreen...

  19. Gênero e trabalho em Saúde: um olhar crítico sobre o trabalho de agentes comunitárias/os de Saúde

    OpenAIRE

    Regina Helena Simões Barbosa; Clarissa Alves Fernandes de Menezes; Helena Maria Scherlowski Leal David; Vera Joana Bornstein

    2012-01-01

    Apresentam-se resultados de uma pesquisa interdisciplinar sobre o trabalho da/o agente comunitária/o de Saúde (ACS). Adotou-se uma abordagem crítica de gênero para se compreenderem os entrelaçamentos entre socialização de gênero e qualificação profissional em uma modalidade de trabalho precarizado, que se apropria da força de trabalho de mulheres pobres em países periféricos. Buscou-se captar, entre as ACS, tanto as vantagens relativas deste trabalho, que permite conciliar tarefas produtivas ...

  20. Right = Left ? The concepts of “right-left” and brain asymmetrySağ = Sol ? “Sağ-sol” kavramları ve beyin asimetrisi

    Directory of Open Access Journals (Sweden)

    Evrim Gülbetekin

    2015-11-01

    Full Text Available Although “right” and “left” are neutral words those describe directions, they have some positive and negative meanings in cultural contexts. Attributing positive meanings for right and negative meanings for left is observed in different cultures, languages and belief systems including Turkish culture. In the presented study, Turkish words, sayings and phrasses including right, left and right-left together were examined according to their meanings (positive, negative, neutral by referencing Turkish Language Instituion. It was observed that the word “right” had 15 positive meanings and the word “left” had no positive meanings.  On the other hand, it was found that the word “right” had no negative meanings and “left” had four negative meanings and there were eight negative meanings including the words “left” and “right” together.  The predisposition of attributing positive/negative meanings to right and left is discussed in a neuroscientific perspective and it is assessed in the context of two hemispheric specializations in the brain: 1. Motor asymmetries and handedness 2. Emotions and Valence Hypothesis.  Generally, attributing positive meanings for right and negative meanings for left seems to be related to human physiological system, structural and functional brain asymmetries and dependently human cognition and comprehension.   Özet Sağ ve sol kavramları ilk anlamları itibariyle yön belirten nötr sözcükler olmasına rağmen kültürel bağlamda bu sözcüklerin olumlu ve olumsuz anlamlara sahip olduğu görülmektedir. Sağa olumlu, sola olumsuz anlam atfetme Türk kültürü de dahil olmak üzere farklı kültürlerde, dillerde ve inanç sistemleri içerisinde gözlenmektedir. Sunulan makalede Türk Dil Kurumu referans alınarak sağ, sol ve sağ ile solun birlikte kullanıldığı sözcük, birleşik sözcük, deyim ve atasözleri içerdikleri olumlu, olumsuz ve nötr anlamlara göre grupland

  1. Inductors of change in the training of health personnel: pró-saúde and pet-saúde (pro-health and pet-health strategies

    Directory of Open Access Journals (Sweden)

    Isabel Cristina Luck Coelho de Holanda

    2012-12-01

    Full Text Available In the last decade, the training of health professionals has been redesigned in order to meet people’s health needs and not just their demands. Public policies on education and health promoted in partnership with the Ministry of Education and Culture (MEC and the Ministry of Health (Ministério da Saúde - MS signaled for a curricular reform that is essential to graduate schools in health area(1,2.The milestone in the formalization of this change was the introduction of the National Curriculum Guidelines (Diretrizes Curriculares Nacionais - DCN for undergraduate programmes in the health field. All current instruments guide theconstruction of the graduates’ profile by means of an academic and professional model in which attitudes, skills and contents aim at a generalist, humanist, critical and reflective training, with competence in performance of all levels of health care,basing their conduct on scientific and ethical rigour(3-7.Not coincidentally, all documents point out the same fields of competence to be developed during the training of different professionals: health care, decision making, communication, leadership, lifelong education, administration and management (3-7, since health, being a complex field, is unable to perform resolving actions through a single discipline or area of knowledge.The proposal advocated by MEC and MS to produce transformation in the processes of training, working and expanding the service coverage has been accomplished through induction programmes, such as the Reorientation of Professional Training in Health National Programme (Pro-Health and the Educationthrough Labour on Health Programme (PET-Health(1,2.Pro-Health, which has been implemented in the country since 2005, through the disclosure of open announcements, wishes to tune healthcare education and social needs, considering historical, cultural and economic dimensions of the population(8. It encourages discarding the disease as the object of study and

  2. ULAKBİM Cahit Arf Bilgi Merkezinde Belge Sağlamanın Maliyet Analizi

    Directory of Open Access Journals (Sweden)

    Yurdagül Ünal

    2005-06-01

    Full Text Available This study aims to review the document delivery requests submitted to the Cahit Arf Information Center, Document Delivery Services Unit of the National Academic Network and Information Center (ULAKBIM. It aims to determine which one is more economic and dispatch in terms of the length of time (in days it takes to fill a request and the unit cost of supplying requests from printed journals and electronic ones. We tracked the data with regards to document delivery requests that were submitted to the Unit for the year 2000 on October and November. Information (labour cost, corrective maintenance, cleaning, communication, etc. was obtained from the Center to calculate the unit cost. In order to calculate the unit cost, the cost types such as labour cost, raw product and general cost were identified and the total cost was divided to the total number of document delivery request. The unit cost of supplying an article in the year 2000 was found as about 3 million Turkish Liras (According to the Consumer Price Index of September 2004, the unit cost of a supplied document was 8.690.541 Turkish Liras. From submission to the mailing of the document, it took a total of 15 days to fill a document delivery request. Since the procedure of supplying the electronic or printed documents was not different in the Unit, the length of time and unit cost were almost the same for supplying the documents from printed journals and electronic ones. Bu araştırmada amaç, Ulusal Akademik Ağ ve Bilgi Merkezi (ULAKBİM Cahit Arf Bilgi Merkezi (CABİM Belge Sağlama Hizmetleri Biriminde basılı dergilerden sağlanan isteklerle elektronik dergilerden sağlanan istekleri süre ve birim maliyet açısından karşılaştırarak hangisinin daha hızlı ve ekonomik olduğunu belirlemektir. Çalışmada, 2000 yılının Ekim ve Kasım aylarında Birime yapılan 9213 belge sağlama isteği izlenmiş ve bu isteklerin birim maliyetim bulmak için gerekli veriler (işçilik, bak

  3. CoPc(COOH)_8-SA/mCS双极膜的制备及表征%Preparation and Characterization of CoPc(COOH)_8-SA/mCS Bipolar Membranes

    Institute of Scientific and Technical Information of China (English)

    陈日耀; 陈震; 郑曦; 陈晓; 黄彩霞

    2009-01-01

    分别用Fe~(3+)离子和戊二醛作为交联剂对海藻酸钠(SA)阳膜层和壳聚糖(CS)阴膜层进行改性,制备了八羧基钴酞菁.海藻酸钠/改性壳聚糖(CoPc(COOH)_8SA/mCS)双极膜(BPM).在海藻酸钠阳膜层中添加八羧基钻酞菁以提高阳膜的离子交换容量,促进中间层水的解离.用傅立叶红外(FT-IR)光谱、扫描电镜(SEM)等方法对制备的双极膜进行了表征.实验结果表明,经八羧基钻酞菁改性后,阳离子交换膜层的离子交换容最、H+离子透过率均获得提高.与Fe~(3+)离子改性或二茂铁离子改性的mSA/mCS双极膜相比,CoPc(COOH)_8-SA/mCS双极膜的交流阻抗、电阻压降(IR降)和溶胀度降低.当电流密度高达105 mA·cm~(-2)时,CoPc(COOH)_8-SM/mCS双极膜的IR降仅为0.7V.%A sodium alginate (SA) cation layer was modified by cobalt octocarboxyphthalocyanine (CoPc(COOH)_8) to improve its ion exchange capacity and to promote water splitting at the interlayer. The CoPc(COOH)_8-SA and chitosan (CS) were then modified using Fe~(3+) and glutaraldehyde as linking reagents to prepare CoPc(COOH)_8-SA/mCS bipolar membranes (BPMs). FT-IR spectra and SEM were used to characterize CoPc(COOH)_8-SA/mCS BPMs. Experimental results showed that the ion exchange capacity and hydrogen ion transmigration rate of the CoPc(COOH)_8-SA cation exchange membrane had increased. By comparison to the mSA/mCS BPM that was modified by Fe~(3+) or ferrocene, the AC impedance, IR drop and the swelling degree of the CoPc(COOH)_8-SA/mCS BPMs all decreased. The IR drop of the CoPc(COOH)_8-SA/mCS BPM was only 0.7 V at a higher current density of 105 mA·cm~(-2).

  4. SA-Mot: a web server for the identification of motifs of interest extracted from protein loops.

    Science.gov (United States)

    Regad, Leslie; Saladin, Adrien; Maupetit, Julien; Geneix, Colette; Camproux, Anne-Claude

    2011-07-01

    The detection of functional motifs is an important step for the determination of protein functions. We present here a new web server SA-Mot (Structural Alphabet Motif) for the extraction and location of structural motifs of interest from protein loops. Contrary to other methods, SA-Mot does not focus only on functional motifs, but it extracts recurrent and conserved structural motifs involved in structural redundancy of loops. SA-Mot uses the structural word notion to extract all structural motifs from uni-dimensional sequences corresponding to loop structures. Then, SA-Mot provides a description of these structural motifs using statistics computed in the loop data set and in SCOP superfamily, sequence and structural parameters. SA-Mot results correspond to an interactive table listing all structural motifs extracted from a target structure and their associated descriptors. Using this information, the users can easily locate loop regions that are important for the protein folding and function. The SA-Mot web server is available at http://sa-mot.mti.univ-paris-diderot.fr.

  5. A dimensão ética na educação para a saúde

    Directory of Open Access Journals (Sweden)

    Patrick Paul

    2005-04-01

    Full Text Available A ética, como julgamento de apreciação das condutas positivas e negativas, tanto no que diz respeito ao usuário como ao profissional, coloca de início a problemática do desejo e do conhecimento. A educação para a saúde, através dos três modelos classicamente referidos da saúde positiva, da saúde negativa e da saúde global, vai interrogar de variadas maneiras o posicionamento ético em função dos pontos de vista diferentes fortemente ligados às representações sociais. Além disso, o questionamento ético da saúde inscreve-se também naquele, mais largo, da filosofia da educação entre praxis e poïesis. Mas ele impõe também a aceitação do acidente como imperativo que valoriza o erro, com a introdução da complexidade vindo quebrar o dogma das certezas. Reunir as diferentes facetas da saúde e de sua educação sugere então, finalmente, que tomar cuidado é viver o mais autenticamente possível, com o educar para a saúde significando formar e formar-se para a autenticidade.

  6. Saúde na Agenda de Desenvolvimento pós-2015 das Nações Unidas

    Directory of Open Access Journals (Sweden)

    Paulo Marchiori Buss

    2014-12-01

    Full Text Available O artigo examina a presença da saúde como Ob-jetivo do Desenvolvimento Sustentável (ODS na Agenda do Desenvolvimento pós-2015, no processo transcorrido entre 2012 e 2014. Presente desde a Cúpula do Milênio e os ODM (2000, a saúde também aparece nos documentos que tratam da Agenda pós-2015, da Rio+20 ao documento do Grupo de Trabalho Aberto das Nações Unidas (OWG, submetido à Assembleia Geral das Nações Unidas (AGNU 2014-2015, passando pela Con-sulta Global sobre Saúde e o Painel de Alto Nível de Pessoas Eminentes. Os autores concluem pela uniformidade com que a saúde aparece nestes documentos. Identificam a amplitude do enunciado do ODS Saúde, mas alertam para o fracionamento e redução conceitual de suas metas. Propõem mudanças nas mesmas, acrescentando a questão dos determinantes sociais da saúde e metas em saúde pública, ausentes na proposta do OWG. Alertam para a necessidade de reformas na governança global e nacional, bem como para a participação da sociedade civil e da influência que pode exercer sobre a diplomacia, responsável pelo pacto que será firmado na AGNU de 2015.

  7. El libro, instrumento de cultura y objeto económico. Pere sa Sala, escribano real (siglo XV

    Directory of Open Access Journals (Sweden)

    Hernando, Josep

    1999-12-01

    Full Text Available Pere sa Sala (✝1480, royal scrivener and citizen of Barcelona, notes in a memorandum in his will, which books (held by other people belong to him and which books (that he holds belong to others. This allows us to see a sample of his excellent library. Besides, Pere sa Sala copied books, lent books, accepted books as a guarantee for loans, and exchanged books. A book was for him both a cultural tool and an economic object.[fr] Pere sa Sala (✝1480, écrivain du roi et citoyen de Barcelone, rappelle dans un mémorial inséré dans son testament, quels livres, que ont des autres, sont de sa propriété, et quels livres, qui sont dans sa bibliothèque, appartiennent à des autres. Ceci nous permet voir quelque chose de l’excellente bibliothèque de l'écrivain Pere sa Sala. En outre, Pere sa Sala copia des livres, accepta des livres en gage, changea des livres. Le livre était pour lui un instrument de culture et un objet économique.

  8. Effect of methyl salicylate (MeSA), an elicitor on growth, physiology and pathology of resistant and susceptible rice varieties

    Science.gov (United States)

    Kalaivani, Kandaswamy; Kalaiselvi, Marimuthu Maruthi; Senthil-Nathan, Sengottayan

    2016-01-01

    Methyl salicylate (MeSA) is a volatile organic compound synthesized from salicylic acid (SA) a plant hormone that helps to fight against plant disease. Seed treatment with MeSA, is an encouraging method to the seed industry to produce more growth and yield. The aim of our study is to find out the growth, development and disease tolerance of rice seed treated with different concentrations of MeSA. Also the seed treatments were studied to determine whether they directly influenced seedling emergence and growth in rice (Oryza sativa L) cultivars ‘IR 20, IR 50, IR 64, ASD 16, ASD 19 and ADT 46’ under greenhouse condition. MeSA seed treatments at 25, 50, 75 and 100 mg/L significantly increased seedling emergence. Effects were stronger in IR 50, and IR 64 and the effects were dose dependent, although the relationship between dose and effect was not always linear. MeSA seed treated rice plant against bacterial blight were analyzed. Bacterial blight was more effectively controlled by the seed treated with 100 mg/L than others. These results suggest that seed treatment with MeSA alters plant physiology in ways that may be useful for crop production as well as protection. PMID:27725719

  9. Tendências de gerenciamento de unidades de saúde e de pessoas

    Directory of Open Access Journals (Sweden)

    Adriana Maria André

    2013-02-01

    Full Text Available OBJETIVO: Identificar que fatores produzem novas tendências no gerenciamento das unidades básicas de saúde e mudanças nos modelos de gestão. MÉTODOS: Estudo prospectivo com dez gestores de unidades de saúde e dez especialistas da área de saúde de São Paulo, SP, em 2010. Foi adotada a metodologia Delphi. Foram utilizadas quatro rodadas para a coleta de dados, três quantitativas e a quarta qualitativa. Nas três primeiras foram levantadas as tendências de mudança nos modelos de gestão; no perfil do gestor e nas competências requeridas para a função, foi utilizado o teste estatístico de Mann Whitney. A quarta rodada ocorreu por meio de um painel com os envolvidos, tendo sido escolhida a análise temática. RESULTADOS: Foram identificados os principais fatores que estão impulsionando o gerenciamento das unidades básicas de saúde, como as mudanças nos modelos de gestão. Foi consenso de que as dificuldades no gerenciamento das equipes e nas políticas influemciam nesse processo. Verificou-se que os gestores estão a par das tendências do macrocontexto com o advento das organizações sociais de saúde, mas ainda não estão se antecipando nas ações institucionais. CONCLUSÕES: A formação acadêmica deve ser revista não só quanto aos conteúdos, mas quanto ao desenvolvimento desses profissionais. O recrutamento, a seleção, o desenvolvimento e a avaliação devem ser norteados por essas competências alinhadas à missão, à visão, aos valores e aos modelos de gestão das organizações no contexto do Sistema Único de Saúde.

  10. Psicologia e saúde: desafios atuais Psychology and health: recent challenges

    Directory of Open Access Journals (Sweden)

    Fernando González Rey

    1997-01-01

    Full Text Available Este artigo apresenta e discute diferentes desafios que a psicologia tem que enfrentar em seus estudos sobre assuntos relacionados com a saúde, que, sobre o ponto de vista do autor, são impossíveis de desenvolver com os estudos atuais sobre saúde e psicologia clínica. O autor enfatiza desafios concretos: o primeiro que é colocado está relacionado com a elaboração teórica do conceito de saúde, que tem sido praticamente ignorado na literatura psicológica, a qual tem se centrado no problema da doença. Neste sentido, o autor propõe abandonar a definição de saúde em termos de normalidade, equilíbrio ou ausência de sintomas. Para este propósito, o autor utiliza o conceito de distress e o explica com diferente enquadramento teórico, levando em conta sua complexa constituição subjetiva e social no curso da vida do sujeito. O outro desafio coloca a necessidade de incluir o problema da saúde entre outros já desenvolvidos pelas psicologias social e educacional, enfatizando a importância de um estudo intradisciplinar do problema da saúde em psicologia.This paper presents and discusses different challenges that psychology has to face in its approach to health issues, which, from my point of view, are impossible to develop within the current approaches to health and clinical psychology. I emphasize concrete challenges: the first deals with the theoretical elaboration of the concept of health, which has been practically ignored in the psychological literature that focus mostly on the matter of disease. In this sense, I propose to abandon the definition of health in terms of normality, equilibrium, or absence of symptoms. For this purpose, I take the concept of distress and explain it within a different theoretical framework, taking into account its complex subjective and social constitution on the subject’s life course. The other challenges relate to the need to include the matter of health among those developed by social and

  11. The Endophytic Bacterium, Sphingomonas SaMR12, Improves the Potential for Zinc Phytoremediation by Its Host, Sedum alfredii

    OpenAIRE

    Bao Chen; Jianguo Shen; Xincheng Zhang; Fengshan Pan; Xiaoe Yang; Ying Feng

    2014-01-01

    The endophytic bacterium, Sphingomonas SaMR12, isolated from Sedum alfredii Hance, appears to increase plant biomass and zinc-extraction from contaminated soil; however, the mechanism by which this occurs is not clear. Here, the ability of SaMR12 to promote zinc extraction and its effects on root morphology and exudation were examined in hydroponics. Zinc treatment increased shoot biomass by 30 to 45%, and by a further 10 to 19% when combined with SaMR12 inoculation. Zinc treatment also incre...

  12. Studies on the phenotypic and genotypic characteristics of SA14 wild Japanese encephalitis virus and its attenuated viruses

    Institute of Scientific and Technical Information of China (English)

    XING LIANG FAN; YONG XIN YU; DE FU LI; ZHI HUI YAO; LI LI JIA

    2006-01-01

    The aim of this study was to explore the molecular basis for the attenuation of the Japanese encephalitis virus (JEV) vaccine strain SA14-14-2. The virulence of SA14 wild Japanese encephalitis virus (JEV) and its several attenuated viruses was tested by intracerebral (i. c. ) or intraperitonial (i. p. ) inoculation of 10-12 g mice. The stability of neuroattenuation was tested by one passage in suckling mouse brain. The E protein genes of those viruses were amplified by PCR, sequenced and compared. Three attenuated virus strains, SA14-14-2 vaccine virus, SA14-9-7 and SA14-5-3, did not exhibit lethal infections by i.c. or i.p. inoculation of 10-12 g mice and revert to the virulence. The other virus strain, SA14-12-1-7, showed no neuroinvasiveness by i.p. inoculation but residual neurovirulence by i.c. inoculation and reverted to high virulence after one brain passage. Comparison of the E protein gene sequences of the five virus strains indicated that there were differences of twelve nucleotides and eight amino acids between the parent strain SA14 and vaccine strain SA14-14-2, of which six amino acids (E-107, E-176, E-439, E138, E-279, E-315) exhibited changes common to those of SA14-9-7 and SA14-5-3, three substitutions common to SA14-12-1-7. Two amino acid substitutions at the sites E177 (T→A) and E264 (Q→H) are unique to the SA14-14-2 vaccine virus. The results suggest that the mutations of E-107 (Leu→Phe), E176 (Ile→Val), and E-439 (Lys→Arg) may contribute for the attenuation of neuroinvasiveness and partially for the attenuation of neurovirulence, the mutations of E-138, E-279, E-315 may not only critical to the neuroattenuation but also to its stability.

  13. Environmental and Mechanical Stability of Environmental Barrier Coated SA Tyrannohex SiC Composites Under Simulated Turbine Engine Environments

    Science.gov (United States)

    Zhu, Dongming; Halbig, Michael Charles; Sing, Mrityunjay

    2014-01-01

    The environmental stability and thermal gradient cyclic durability performance of SA Tyrannohex composites were investigated for turbine engine component applications. The work has been focused on investigating the combustion rig recession, cyclic thermal stress resistance and thermomechanical low cycle fatigue of uncoated and environmental barrier coated Tyrannohex SiC SA composites in simulated turbine engine combustion water vapor, thermal gradients, and mechanical loading conditions. Flexural strength degradations have been evaluated, and the upper limits of operating temperature conditions for the SA composite material systems are discussed based on the experimental results.

  14. 现代企业加快推行SA8000标准导入问题研究

    Institute of Scientific and Technical Information of China (English)

    郑琼

    2012-01-01

    一、SA8000标准在各国的推行情况SA8000是1997年8月由美国CEPAA制定的国际标准。SA8000的含义是"社会责任标准",是Social Accoutability 8000的英文简称。与ISO9000质量管理体系及ISO14000环境管理体系一样,皆为一套可被第三方认证机构审核之国际标准。

  15. Core loading pattern optimization of a typical two-loop 300 MWe PWR using Simulated Annealing (SA), novel crossover Genetic Algorithms (GA) and hybrid GA(SA) schemes

    International Nuclear Information System (INIS)

    Highlights: • SA and GA based optimization for loading pattern has been carried out. • The LEOPARD and MCRAC codes for a typical PWR have been used. • At high annealing rates, the SA shows premature convergence. • Then novel crossover and mutation operators are proposed in this work. • Genetic Algorithms exhibit stagnation for small population sizes. - Abstract: A comparative study of the Simulated Annealing and Genetic Algorithms based optimization of loading pattern with power profile flattening as the goal, has been carried out using the LEOPARD and MCRAC neutronic codes, for a typical 300 MWe PWR. At high annealing rates, Simulated Annealing exhibited tendency towards premature convergence while at low annealing rates, it failed to converge to global minimum. The new ‘batch composition preserving’ Genetic Algorithms with novel crossover and mutation operators are proposed in this work which, consistent with the earlier findings (Yamamoto, 1997), for small population size, require comparable computational effort to Simulated Annealing with medium annealing rates. However, Genetic Algorithms exhibit stagnation for small population size. A hybrid Genetic Algorithms (Simulated Annealing) scheme is proposed that utilizes inner Simulated Annealing layer for further evolution of population at stagnation point. The hybrid scheme has been found to escape stagnation in bcp Genetic Algorithms and converge to the global minima with about 51% more computational effort for small population sizes

  16. Participação Popular em Saúde: Um Estudo Sobre o Conselho Regional de Saúde de Ceilândia, Distrito Federal.

    Directory of Open Access Journals (Sweden)

    Andrecinda Rocha PINA

    2013-04-01

    Full Text Available A questão da participação popular para o exercício do controle social do Sistema Único de Saúde é especialmente importante para o debate da política de saúde no Brasil e, conforme estabelecido na Lei 8142 de 1990, essa participação deve ser realizada por meio dos conselhos e conferências de saúde. O presente artigo estuda a participação popular em saúde no Conselho Regional de Saúde de Ceilândia, Distrito Federal, problematizando em torno do exercício do controle social exercido pelos conselheiros do respectivo colegiado. Esta pesquisa teve por objetivo geral entender como se dá a Participação Social no Conselho Regional de Saúde de Ceilândia na gestão 2010-2011, buscando especificamente entender sua dinâmica de funcionamento. Partindo de uma abordagem metodológica qualiquantitativa, utilizamos como procedimento a análise documental, com levantamento de dados relativos à dinâmica de suas reuniões. Depreende-se do estudo realizado a participação expressiva dos segmentos integrantes. A grande maioria dos assuntos pautados foi proposta, especialmente, pelo segmento gestor. Entretanto, os itens em discussão revelam que os interesses dos usuários e trabalhadores permeavam com mais frequência os debates. Por fim, conclui-se que, em um contexto geral, o Conselho Regional de Saúde de Ceilândia é um fórum político legítimo e atuante, com atuação decisiva nas deliberações das ações e serviços de saúde a nível local. ABSTRACT The issue of popular participation in the exercise of social control Health System is especially important for the health policy debate in Brazil and, as stated in the Law 8142/1990, this participation must be done through the advice and health conferences. This paper studies popular participation in health in the Regional Health Ceilândia, Distrito Federal, questioning around the exercise of social control exercised by the directors of the respective collegiate. This research aimed

  17. As dissonâncias do sistema privado de saúde e a judicialização da saúde no Distrito Federal

    Directory of Open Access Journals (Sweden)

    Isabella Cristina Fernandes da SILVA

    2013-04-01

    Full Text Available RESUMO A saúde, bem maior constante da nossa Constituição Federal da República de 1988, é um tema que tem sido bastante discutido ultimamente. O compromisso com a qualidade de vida, juntamente com os avanços da tecnologia e a precariedade no atendimento público levaram ao surgimento de diversas operadoras de saúde. Com o aumento desse segmento, o estado viu a necessidade de regulamentar essa atividade, a fim de proteger a relação usuário-operadora de saúde. Nesse contexto, foi criado um conjunto de normas jurídicas para regulação dos planos e seguros de saúde. A Agência Nacional de Saúde Suplementar representa um papel de suma importância na fiscalização e regulação das operadoras de saúde, assegurando o equilíbrio dessa relação. No entanto, o número de insatisfação dos usuários de planos e seguros de saúde vem aumentando e muitas reclamações feitas são levadas ao judiciário, fenômeno este chamado de judicialização. O presente trabalho versa sobre a identificação e análise das demandas judiciais do TJDFT atinentes às reclamações dos usuários do sistema privado de saúde no ano de 2010. ABSTRACT Health, which is considered to be the greater good of the 1988 federal constitution, has been a widely disscussed topic lately. The obligation to maintain the quality of life, along with the technological advances and the precariousness of public services, have set the grounds for the emergence of various health insurers. The state was forced to regulate these kind of activities in order to protect the user - health insurer relationship. In this context, a number of judicial norms were created. The National supplementary health agency has a very important role in the inspection and regulation of health insurers, ensuring a balanced relationship. However, the number of unsatisfied health plan users has been increasing and many of the complaints have been taken to the judiciary, which is called judicialization

  18. Enfermagem e saúde ambiental: possibilidades de atuação para a promoção da saúde

    Directory of Open Access Journals (Sweden)

    Maria do Socorro Vieira Lopes

    2011-02-01

    Full Text Available Este estudo qualitativo objetivou compreender o significado de participação para os integrantes do Comitê da Sub-Bacia Hidrográfica do Rio Salgado, CE, Brasil, subsidiando a promoção da saúde para um ambiente sustentável no que se refere aos recursos hídricos; refletir sobre a interface enfermagem/ambiente a partir do componente hídrico. Os sujeitos foram 18 representantes do comitê. Os dados foram coletados através de entrevista, analisados através do Discurso do Sujeito Coletivo. A compreensão de participação pelos sujeitos foi resumida no discurso síntese: participação envolve consciência social, informação, comunicação em busca de soluções que representem a coletividade. A interface da enfermagem no comitê se apresenta como uma possibilidade de ampliação de seu objeto ao incorporar o campo ambiental nas ações de promoção da saúde

  19. [Output and citation in public health: a perspective based on the journals Cadernos de Saúde Pública and Revista de Saúde Pública].

    Science.gov (United States)

    Carvalho, Leandro; Coimbra, Carlos E A; Souza-Santos, Reinaldo; Santos, Ricardo Ventura

    2007-12-01

    This is a comparative bibliometric study of the two main scientific journals in the Public Health field in Brazil: Cadernos de Saúde Pública (CSP) and Revista de Saúde Pública (RSP). Twenty-four issues of each periodical were analyzed, published from 1996 to 2003, comprising a sample of 819 articles (496 from CSP and 323 from RSP). The following elements in the articles were identified and analyzed: thematic area of the article and citation pattern of publications (articles in periodicals, books and/or book chapters, theses/dissertations, Internet documents, "gray" literature, and other types of publications). The resulting data showed that the majority of the articles represent the sub-area of "epidemiology". The citation pattern in the journals showed articles in periodicals in first place, followed by citations of books and/or book chapters. Papers in the sub-area "social sciences in health" published in CSP are exceptions, since books and chapters are the most frequently cited. The authors discuss the implications of the findings for the characterization and evaluation of scientific output in Public Health in Brazil. PMID:18157345

  20. SA-516GR.70与S30403焊接工艺研究%Research on SA-516GR.70 and S30403 welding procedure

    Institute of Scientific and Technical Information of China (English)

    赵婷

    2015-01-01

    In this paper,the SA-516GR.70 and S30403 dissimilar steel welding procedure is studied by optimizing the joint type, method,material and parameters of welding. The results show that the optimized process effectively avoid the welding joint brittle martensite,control the diffusion of the carbon and ensure the homogeneity of the welding joint. Meanwhile,the impact toughness and tensile strength can meet the requirements of pressure vessels. It can be used for welding transition section and straight pipe in Ethylene Oxide reactors.%本文对SA-516GR.70与S30403异种钢焊接工艺进行了研究,优化了焊接接头形式、焊接方法、焊接材料、焊接参数.结果表明,优化后的工艺有效避免了焊接接头出现脆性马氏体组织,可以控制碳的扩散,确保焊接接头化学成分均匀.同时冲击韧性、抗拉强度均能满足容器的使用性能,可以用于环氧乙烷类反应器中小端过渡段与直管间的焊接.

  1. SA-516GR.70与S30403焊接工艺研究%Research on SA-516GR.70 and S30403 welding procedure

    Institute of Scientific and Technical Information of China (English)

    赵婷

    2015-01-01

    本文对SA-516GR.70与S30403异种钢焊接工艺进行了研究,优化了焊接接头形式、焊接方法、焊接材料、焊接参数.结果表明,优化后的工艺有效避免了焊接接头出现脆性马氏体组织,可以控制碳的扩散,确保焊接接头化学成分均匀.同时冲击韧性、抗拉强度均能满足容器的使用性能,可以用于环氧乙烷类反应器中小端过渡段与直管间的焊接.%In this paper,the SA-516GR.70 and S30403 dissimilar steel welding procedure is studied by optimizing the joint type, method,material and parameters of welding. The results show that the optimized process effectively avoid the welding joint brittle martensite,control the diffusion of the carbon and ensure the homogeneity of the welding joint. Meanwhile,the impact toughness and tensile strength can meet the requirements of pressure vessels. It can be used for welding transition section and straight pipe in Ethylene Oxide reactors.

  2. SA8000标准:人本主义还是新重商主义?%SA8000 Standard: Humanism or New Mercantilism?

    Institute of Scientific and Technical Information of China (English)

    赵应宗

    2005-01-01

    SA8000是发达国家制定的一种贸易标准,它以"社会责任"为名,标榜其"人本主义"特征,实际上却毫不顾及发展中国家的经济利益,是一种专门削弱劳动密集型产品价格优势的苛刻标准.SA8000标准具有合理与不合理的双重性.其合理性在于它蕴涵着人本主义因素,初步工业化国家可借此推进工业文明;其不合理性是该标准只对发达国家有利,新重商主义可借此攫取贸易利益,甚至以流通支配工业生产、进而干预一国政治经济的发展.正确辨析该标准的双重特性,有助于我们制定合理的对策,促进经贸的新发展.

  3. A atuação do agente comunitário de saúde na promoção da saúde e na prevenção de doenças

    OpenAIRE

    Maria Rizoneide Negreiros Araújo; Raquel Silva Assunção

    2004-01-01

    O artigo trata das ações desenvolvidas pelo agente comunitário de saúde - ACS no Programa de Saúde da Família de Divinópolis - MG, fazendo uma relação de tuação nos campos da Promoção da Saúde e da Prevenção de Doenças, tomando como referencial a I Conferência Internacional sobre Promoção da Saúde, realizada no Canadá, em 1986. A pesquisa de campo foi realizada com questionário, observação direta e entrevista com os ACS. De abordagem qualitativa em que as concepções e expressões dos sujeitos ...

  4. Direcção estratégica e gestão de expectativas no sistema de saúde português: o papel de um observatório para os sistemas de saúde

    OpenAIRE

    Sakellarides, Constantino

    2000-01-01

    RESUMO - Existe um amplo consenso no país sobre a necessidade e a urgência de uma reforma na saúde. O governo declarou, em Outubro de 1999, a saúde como a sua principal prioridade social. A «prioridade da saúde» não pode deixar de ser considerada um importante factor de mobilização para a investigação e formação no sector. Durante os últimos três anos tomaram-se importantes iniciativas com vista a analisar e influenciar a evolução do sistema de saúde português. D...

  5. E o que faz/pode fazer um bacharel em Saúde Coletiva? A arte de pesquisar como prática de promoção de saúde

    OpenAIRE

    Rosamaria Carneiro CARNEIRO

    2013-01-01

    Este pequeno ensaio busca explorar as habilidades e as competências dos egressos dos recém-criados cursos de graduação de Saúde Coletiva no Brasil, partindo de uma leitura pouco convencional de promoção da saúde. Para tanto, tomando de saída, a particularidade ou pretensão “transdisciplinar” dos referidos cursos de graduação, nos dispomos a pensar o Sanitarista tanto como profissional diferenciado e ainda em construção, como também aquele que pode realizar a metacrítica do campo da saúde. Se ...

  6. Commercial statistical bulletin of the Brazilian electric utility Centrais Eletricas de Santa Catarina S.A; Boletim estatistico comercial da CELESC: Centrais Eletricas de Santa Catarina S.A

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    Statistical data concerning the Brazilian Centrais Eletricas de Santa Catarina S.A. utility relative to April 1996 are presented. They include, among other things, electricity consumption, number and class of consumers and electricity rates 6 figs., 50 tabs.

  7. A brief history of cadernos de Saúde Pública/reports in Public Health.

    Science.gov (United States)

    Carvalho, Marilia Sá; Coeli, Cláudia Medina; Travassos, Claudia

    2015-07-01

    This article was written as part of the 20th-year commemorative issue of Ciência e Saúde Coletiva (C&SC). We take advantage of this opportunity to revisit the successful history of Cadernos de Saúde Pública (CSP)/Reports in Public Health in its 30 years of publication, progressing from a quarterly periodical with limited circulation to a monthly journal indexed in the main scientific databases. We also summarize some themes from our recent editorials, including the internationalization of scientific journals, the demand for relevant and original articles, plagiarism, and peer review. We also discuss the article submission management system developed by CSP and conclude with ideas on cooperation between journals in the public health field. PMID:26132239

  8. "Kus sa oled mu võluratsu..." : [luuletused] / Mõkola Vingranovski ; tlk. Harald Rajamets

    Index Scriptorium Estoniae

    Vingranovski, Mõkola

    2004-01-01

    Sisu: "Kus sa oled mu võluratsu..." ; Ja rahvas on... ; "Oled rada, mu armsam..." ; "Sa oled siin! Mu armastus, mu lumm..." ; "Me ahvatluste aastad, albid aastad..." ; "Mul juba siis, kui oli kevad veel..." ; "Nüüd tõuse, kalur! Kustumas on tähed..." ; Meresügisel ; "Kauss hirsiputru, õilmelend..." ; "Õde võõpab aias õunapuid..." ; Esimene hälilaul ; "Noor tüdruk, alles laps. Ei kõnni kikivarvul..." ; "Ülal künka peal seisis päike..." ; "Jäid suve lõpul tuhmiks puud..." ; "Nüüd hakkab lumesadu, nüüd..." ; "Lumehämarus, hall nagu hall..." ; "Tüüpõllu aur on jäärakute kohal..." ; "Parv linde kriiskab salu kohal..." ; "Põld kuivi maisivarsi täis..." ; Haiavata

  9. Spatial Pattern Detection of Tuberculosis: A Case Study of Si Sa Ket Province, Thailand

    Directory of Open Access Journals (Sweden)

    Siriwan Hassarangsee

    2015-12-01

    Full Text Available This retrospective population-based study was conducted to analyze spatial patterns of tuberculosis (TB incidence in Si Sa Ket province, Thailand. TB notification data from 2004 to 2008 collected from TB clinics throughout the province was used along with population data to reveal a descriptive epidemiology of TB incidences. Global clustering patterns of the occurrence were assessed by using global spatial autocorrelation techniques. Additionally, local spatial pattern detection was performed by using local spatial autocorrelation and spatial scan statistic methods. The findings indicated clusters of the disease occurred in the study area. More specifically, significantly high-rate clusters were mostly detected in Mueang Si Sa Ket and Khukhan districts, which are located in the northwestern part of the province, while significantly low-rate clusters were persistent in Kantharalak and Benchalak districts, which are located at the southeastern area.

  10. As redes de atenção à saúde Health care networks

    Directory of Open Access Journals (Sweden)

    Eugênio Vilaça Mendes

    2010-08-01

    Full Text Available As transições demográfica e epidemiológica significam um incremento relativo das condições crônicas. Tem sido assim, no Brasil, que apresenta uma situação de saúde de tripla carga de doenças, manifestada na convivência de doenças infecciosas, parasitárias e problemas de saúde reprodutiva, causas externas e doenças crônicas. Há uma crise dos sistemas de saúde contemporâneos que se explica pela incoerência entre uma situação de saúde com predomínio relativo forte de condições crônicas e uma resposta social através de sistemas fragmentados e voltados, principalmente, para as condições agudas e as agudizações das condições crônicas. Essa crise se manifesta em nosso país, tanto no setor público quanto no setor privado. A solução para essa crise está em recompor a coerência entre a situação de tripla carga de doenças com uma resposta social estruturada em sistemas integrados de saúde: as redes de atenção à saúde. Conclui-se que há evidências na literatura internacional de que as redes de atenção à saúde podem melhorar a qualidade dos serviços, os resultados sanitários e a satisfação dos usuários e reduzir os custos dos sistemas de atenção à saúde.The demographic and epidemiologic transition resulting from aging and the increase of life expectation means an increment related to chronic conditions. The healthcare systems contemporary crisis is characterized by the organization of the focus on fragmented systems turned to the acute conditions care, in spite of the chronic conditions prevalence, and by the hierarchical structure without communication flow among the different health care levels. Brazil health care situation profile is now presenting a triple burden of diseases, due to the concomitant presence of infectious diseases, external causes and chronic diseases. The solution is to restore the consistence between the triple burden of diseases on the health situation and the current

  11. Do real ao ideal - o (des)cuidar da saúde dos idosos longevos

    OpenAIRE

    Tatiane Michel; Maria Helena Lenardt; Mariluci Hautsch Willig; Angela Maria Alvarez

    2015-01-01

    RESUMOObjetivo:analisar semelhanças e dessemelhanças nos significados do cuidado à saúde de idosos longevos atribuídos por eles e pelos profi ssionais de enfermagem no cenário de uma unidade básica de saúde.Método:pesquisa qualitativa etnográfica, alicerçada no método de Spradley e McCurdy e na antropologia interpretativa de Geertz e Kleinman. Participaram 20 informantes-chaves, as informações foram coletadas por meio da observação participante e entrevista etnográfica no período de março a o...

  12. Green synthesis and surface properties of Fe3O4@SA core-shell nanocomposites

    Science.gov (United States)

    Cao, Huimin; Li, Juchuan; Shen, Yuhua; Li, Shikuo; Huang, Fangzhi; Xie, Anjian

    2014-05-01

    In this paper, a one-step, economic and green approach was explored to prepare Fe3O4 nanoparticles by using L-cysteine as reducer and disperser without any inert gas protection. The Fe3O4 nanoparticles were then modified with stearic acid (SA) to form Fe3O4@SA core-shell nanocomposites. The experiment results indicate that the core-shell nanocomposites prepared could form monolayer on the water surface or films by means of Langmuir-Blodgett (LB) technology due to their hydrophobic and lipophilic properties. Also the composites exhibit paramagnetism, which make product dispersed stably in the oil medium to form magnetic fluid. Moreover, they are developed as sorbents to remove oil from water surface.

  13. Linguistique contrastive et traduction. L’épithète et sa traduction en arabe

    Directory of Open Access Journals (Sweden)

    Chokri RHIBI

    2010-06-01

    Full Text Available Dans cet article, nous aborderons, dans un cadre contrastif (français/arabe, certains problèmes relatifs à la traduction de l’adjectif. Nous examinons plus particulièrement les contraintes sur la position de l’adjectif et les effets stylistiques qui se rattachent à sa postposition ou à son antéposition. Nous montrerons que les contraintes qui pèsent sur l’ordre des mots en arabe, et notamment sur la place de l’adjectif (obligatoirement postposé ne constituent pas un obstacle à sa traduction quitte à admettre qu’il est possible d’exprimer le même sens mais avec des structures syntaxiques différentes.

  14. SA8000带给中国企业的深层思考

    Institute of Scientific and Technical Information of China (English)

    郑卫东

    2004-01-01

    作为全球第一个企业道德规范标准,SA8000明确了企业的社会责任规范,也提出了相应的管理要求.它不仅对我国企业的销售和生产成本产生直接影响,更是揭露了企业经营管理层面存在的若干问题.中国企业必须勇于面对现实、正视自身不足,并采取有力措施改善管理,从而突破SA8000的制约,提高企业竞争力.

  15. A mulher camponesa e suas lutas pelo direito à saúde.

    Directory of Open Access Journals (Sweden)

    Noemi Margarida KREFTA

    2014-06-01

    Full Text Available Pensar e construir uma política de saúde para os povos do campo, da floresta e das águas tem sido um desafio de vários anos. Em 2004, com a instituição do Grupo da Terra, foi iniciado o debate e a construção de cada passo da Política Nacional de Saúde Integral da População do Campo, Floresta e Águas (PNSIPCFA. Naquela ocasião, os Movimentos Sociais Populares foram convocados para dar sua contribuição, o que foi importante, pois nada mais justo do que ter como protagonista da política aqueles que vivem a realidade em questão.

  16. UNPUBLISHED CHAPTERS FROM THE OFFICIAL HISTORY OF THE SA NAVAL FORCES DURING THE SECOND WORLD WAR

    Directory of Open Access Journals (Sweden)

    W.M. Bisset

    2012-02-01

    Full Text Available The first narrative of the South African Naval Forces during the Second World War was written by Cdr H.R. Gordon-Cumming, OBE for the Union War Histories Section in the Office of the Prime Minister and appears to have been completed in December 1950. A number of chapters from this work were included in War In the Southern Oceans 1939-45 which was published by Oxford University Press in 1961. In December 1967 a shortened version of Cdr Gordon-Cumming's narrative, which he entitled Brief History (Sea was included in a book duplicated on a Roneo machine, A Short History of the SA Navy, compiled by Lt (now Cdre, Retired A.P. Burgers for the SA Navy's Directorate of Personnel at Naval Headquarters.

  17. Antecedentes e consequentes da identificação organizacional nos profissionais de saúde

    OpenAIRE

    Silva, Liliana Veríssimo da

    2010-01-01

    Mestrado em Gestão dos Serviços de Saúde As organizações preocupam-se não apenas com os resultados, mas com a qualidade de serviço prestado aos seus clientes. O serviço prestado ao cliente é de crucial importância para a imagem da organização e consequente sobrevivência. Os profissionais que experienciam um clima interno favorável ao desenvolvimento do seu trabalho, transmitem essa satisfação ao cliente. A identificação dos profissionais de saúde com a organização (IDO) para...

  18. Advocacia em saúde no Brasil contemporâneo

    Directory of Open Access Journals (Sweden)

    Sueli Gandolfi Dallari

    1996-12-01

    Full Text Available Apresenta-se o conceito de advocacia em saúde, por meio da descrição de seus elementos, sua prática e seus agentes. A necessidade da formulação de tal conceito surge da função que tem a universidade, entre outras, de identificar demandas sociais e oferecer alternativas que busquem a superação de obstáculos. A ênfase é centrada na participação social, assegurada na Constituição, promulgada em 1988, e que desde então tem sido tomada como referência no desenvolvimento dos mecanismos de construção da cidadania, especialmente quando relacionada à conquista do direito à saúde.

  19. Naturologia e a emergência de novas perspectivas na saúde

    OpenAIRE

    Barros, Nelson Filice de; Leite-Mor, Ana Cláudia Moraes Barros

    2011-01-01

    O objetivo deste trabalho é refletir sobre a Naturologia como novo agente no campo da saúde brasileiro e suas peculiaridades relativas à convergência com a perspectiva social atual e contribuições à problemática contemporânea da saúde. Para isso, debatemos com a ciência moderna e suas transformações, a partir da “revolução fenomenológica”, que refuta o objetivismo, a neutralidade e a separação sujeito-objeto, e da “revolução quântica”, que atestou a insuficiência da mecânica clássica e a não-...

  20. Diálogos entre naturologia e antropologia da saúde

    OpenAIRE

    Leite-Mor, Ana Cláudia Moraes Barros; Wedekin, Luana Maribele

    2011-01-01

    A Naturologia Aplicada consolida-se como um novo campo de conhecimento para a Área da Saúde. Paralelamente às disciplinas até então vigentes nessa área, em grande parte alicerçadas no modelo biomédico, a Naturologia procura uma visão integral do ser humano, com base nas medicinas energéticas. O presente artigo propõe uma reflexão, a partir da Antropologia da Saúde, acerca das duas questões em que se constitui a Naturologia: primeiro, o diálogo que estabelece com as medicinas energéticas (Ayur...