Spectral investigation of an a.c. plasma display
International Nuclear Information System (INIS)
Musa, G.; Nastase, L.; Trache, M.
1981-01-01
The work presents the spectral investigations on an a.c. plasma display, in order of a better understanding of the physical phenomena taking place in such a device. The spectral characteristics of the panel filled with a Penning mixture Ne + 0.1% Ar are presented and the influence of the nitrogen addition on these characteristics was evidentiated. The presence of the trace of nitrogen in the device may be used in order to evidentiate small leaks or imperfections in pumping and outgasing processing of the display. (author)
Discharge efficiency in high-Xe-content plasma display panels
Hayashi, D.; Kroesen, G.M.W.; Hagelaar, G.J.M.; Heusler, G.
2004-01-01
We study theoretically the overall output performance and the dominating reaction processes of the vacuum ultraviolet (UV) radiation production in high-Xe partial pressures in plasma display panels (PDPs) with Ne-Xe gas mixtures. A two-dimensional self-consistent fluid model is applied for the
Properties of excited xenon atoms in a plasma display panel
International Nuclear Information System (INIS)
Uhm, Han S.; Hong, Byoung H.; Oh, Phil Y.; Choi, Eun H.
2009-01-01
The luminance efficiency of a plasma display panel is directly related to the vacuum ultraviolet (VUV) light that is emitted from excited xenon (Xe) atoms and molecules. It is therefore necessary to investigate the properties of excited xenon atoms. This study presents experimental data associated with the behavior of excited xenon atoms in a PDP discharge cell and compares the data with the theoretical results obtained using an analytical model. The properties of excited xenon atoms in the discharge cells of a plasma display panel are investigated by measuring the excited atom density through the use of laser absorption spectroscopy. The density of the excited xenon atoms increases from zero, reaches its peak, and decreases with time in the discharge cells. The profile of the excited xenon atoms is also studied in terms of the xenon mole fraction. The typical density of the excited xenon atoms in the metastable state is on the order of 10 13 atoms per cubic cm.
JTEC panel on display technologies in Japan
Tannas, Lawrence E., Jr.; Glenn, William E.; Credelle, Thomas; Doane, J. William; Firester, Arthur H.; Thompson, Malcolm
1992-01-01
This report is one in a series of reports that describes research and development efforts in Japan in the area of display technologies. The following are included in this report: flat panel displays (technical findings, liquid crystal display development and production, large flat panel displays (FPD's), electroluminescent displays and plasma panels, infrastructure in Japan's FPD industry, market and projected sales, and new a-Si active matrix liquid crystal display (AMLCD) factory); materials for flat panel displays (liquid crystal materials, and light-emissive display materials); manufacturing and infrastructure of active matrix liquid crystal displays (manufacturing logistics and equipment); passive matrix liquid crystal displays (LCD basics, twisted nematics LCD's, supertwisted nematic LCD's, ferroelectric LCD's, and a comparison of passive matrix LCD technology); active matrix technology (basic active matrix technology, investment environment, amorphous silicon, polysilicon, and commercial products and prototypes); and projection displays (comparison of Japanese and U.S. display research, and technical evaluation of work).
Atmospheric plasma generation for LCD panel cleaning
Kim, Gyu-Sik; Won, Chung-Yuen; Choi, Ju-Yeop; Yim, C. H.
2007-12-01
UV lamp systems have been used for cleaning of display panels of TFT LCD or Plasma Display Panel (PDP). However, the needs for high efficient cleaning and low cost made high voltage plasma cleaning techniques to be developed and to be improved. Dielectric-barrier discharges (DBDs), also referred to as barrier discharges or silent discharges have for a long time been exclusively related to ozone generation. In this paper, a 6kW high voltage plasma power supply system was developed for LCD cleaning. The -phase input voltage is rectified and then inverter system is used to make a high frequency pulse train, which is rectified after passing through a high-power transformer. Finally, bi-directional high voltage pulse switching circuits are used to generate the high voltage plasma. Some experimental results showed the usefulness of atmospheric plasma for LCD panel cleaning.
Gaseous discharge display panel including pilot electrodes and radioactive wire
International Nuclear Information System (INIS)
Edwards, R.J.; Hairabedian, B.Z.; Poley, N.M.
1975-01-01
In a plasma display panel consisting of gas enclosed between adjacent insulating members, a light source is used to supply charged particles in the gas to permit firing of the gas when coordinate conductors identifying a site location are energized. The use of such pilot lamps facilitates ignition in firing with uniform selection and firing potentials within all sites of the display panel. To eliminate the difficulty in achieving firing during cold starts a radioactive source comprised of a copper wire electroplated with nickel 63 and overcoated with a protective coat of nickel is placed within the gas panel to provide a source of free electrons. The wire is held in place by friction against the inside walls of the panel. Since the wire emits only beta radiation, no radiation hazard exists externally to the panel
Technical trends of large-size photomasks for flat panel displays
Yoshida, Koichiro
2017-06-01
Currently, flat panel displays (FPDs) are one of the main parts for information technology devices and sets. From 1990's to 2000's, liquid crystal displays (LCDs) and plasma displays had been mainstream FPDs. In the middle of 2000's, demand of plasma displays declined and organic light emitting diodes (OLEDs) newly came into FPD market. And today, major technology of FPDs are LCDs and OLEDs. Especially for mobile devices, the penetration of OLEDs is remarkable. In FPDs panel production, photolithography is the key technology as same as LSI. Photomasks for FPDs are used not only as original master of circuit pattern, but also as a tool to form other functional structures of FPDs. Photomasks for FPDs are called as "Large Size Photomasks(LSPMs)", since the remarkable feature is " Size" which reaches over 1- meter square and over 100kg. In this report, we discuss three LSPMs technical topics with FPDs technical transition and trend. The first topics is upsizing of LSPMs, the second is the challenge for higher resolution patterning, and the last is "Multi-Tone Mask" for "Half -Tone Exposure".
Development of a Two-Dimensional Tracker with Plasma Panel Detector
AUTHOR|(CDS)2233132
Plasma panel sensors are micropattern gaseous radiation detectors which are based on the technology of plasma display panels. This thesis summarizes the research that had been done on commercially available plasma display panels that were converted to plasma panel sensor prototypes and describes the construction of a two-dimensional tracker consisting of four of those prototypes, with one-dimensional readout on each, used to detect tracks of cosmic muons. A large amount of 2-point as well as 3 and 4-point tracks were detected. Qualitative analyses as well as Pearson’s χ2 tests are performed on the track angular distribution and on a histogram of the linearity measure of 3-point tracks to reject the hypothesis that these tracks result from completely random panel hits. Some RF noise effects contributing to false positives are ruled out, while it is shown that other effects can be ruled out only with a high-intensity minimum ionizing particle source. A significant part of the tracker construction was the dev...
Optical studies of E-beam evaporated MgO films for plasma display panels
Lee, S I; Oh, S G
1999-01-01
Variable-incident-angle spectroscopic ellipsometry has been used for non-destructive depth profiling of MgO thin films, one of the key elements of plasma display panels. We have found that all the examined MgO films have a three-layer structure with a dense interface layer , a void-included middle layer, and a surface layer. We have also found that the void fraction is increased with the oxygen-flow rate at a fixed substrate temperature and decreased with the substrate temperature at a fixed oxygen-flow rate. Moreover, discuss the close correlation between the water adsorption and the void fraction and show a general agreement between the surface layer thickness and the mean height determined by using a atomic force microscopy.
Propiedades acústicas de los paneles de carrizo
Directory of Open Access Journals (Sweden)
Díaz, César
2012-03-01
Full Text Available Reed is a plant species very similar to common cane which is widespread all over the Earth. It is an ecological and sustainable material which is low-cost, aesthetically attractive, easy to obtain and install, and can be used in different construction systems.
This work analyses the acoustic properties of reed panels from the point of view of sound absorption and sound insulation against airborne noise, according to the corresponding EN ISO standards. The experimental results obtained point to the conclusion that reed panels are suitable construction systems for controlling reverberant sound within a space, and that the sound reduction index values for different thicknesses of reed panels, or reed panels used in combination with wood particle boards, demonstrate the possibility of using them in construction as an element on the facades and roofs of buildings and for interior partitions.
El carrizo es una especie vegetal, parecida a la caña común, que se encuentra ampliamente distribuida en la superficie terrestre. Es un material ecológico y sostenible de bajo coste, estéticamente aceptable, fácil de obtener y colocar, que permite generar diferentes sistemas constructivos.
En este trabajo se analizan las propiedades acústicas de los paneles de carrizo en lo referente a la absorción acústica y al aislamiento acústico a ruido aéreo, para ello se han aplicado los procedimientos de las normas EN ISO correspondientes. De los resultados experimentales obtenidos se concluye que los paneles de carrizo son unos sistemas constructivos adecuados para el control del sonido reverberante en un recinto y que los valores del índice de reducción acústica de paneles de diferentes espesores o en combinación con tableros de partículas de madera muestran la posibilidad de utilizarlos en la edificación como elemento de fachada, en cubiertas de edificios y particiones interiores.
Flat panel display - Impurity doping technology for flat panel displays
Energy Technology Data Exchange (ETDEWEB)
Suzuki, Toshiharu [Advanced Technology Planning, Sumitomo Eaton Nova Corporation, SBS Tower 9F, 10-1, Yoga 4-chome, Setagaya-ku, 158-0097 Tokyo (Japan)]. E-mail: suzuki_tsh@senova.co.jp
2005-08-01
Features of the flat panel displays (FPDs) such as liquid crystal display (LCD) and organic light emitting diode (OLED) display, etc. using low temperature poly-Si (LTPS) thin film transistors (TFTs) are briefly reviewed comparing with other FPDs. The requirements for fabricating TFTs used for high performance FPDs and system on glass (SoG) are addressed. This paper focuses on the impurity doping technology, which is one of the key technologies together with crystallization by laser annealing, formation of high quality gate insulator and gate-insulator/poly-Si interface. The issues to be solved in impurity doping technology for state of the art and future TFTs are clarified.
Flat panel display - Impurity doping technology for flat panel displays
International Nuclear Information System (INIS)
Suzuki, Toshiharu
2005-01-01
Features of the flat panel displays (FPDs) such as liquid crystal display (LCD) and organic light emitting diode (OLED) display, etc. using low temperature poly-Si (LTPS) thin film transistors (TFTs) are briefly reviewed comparing with other FPDs. The requirements for fabricating TFTs used for high performance FPDs and system on glass (SoG) are addressed. This paper focuses on the impurity doping technology, which is one of the key technologies together with crystallization by laser annealing, formation of high quality gate insulator and gate-insulator/poly-Si interface. The issues to be solved in impurity doping technology for state of the art and future TFTs are clarified
A new method for measuring the wall charge waveforms of AC PDP
International Nuclear Information System (INIS)
Liang Zhihu; Liu Zujun; Liu Chunliang
2004-01-01
A new method is developed to measure the wall charge waveforms in coplanar alternating current plasma display panel (AC PDP). In the method, two groups of display electrodes are selected from a coplanar AC PDP and two capacitors are respectively connected with these two groups of display electrodes in series, and a measuring circuit and a reference circuit are thus constructed. With the help of special processing, discharge takes place in the cells included in the measuring circuit under a normal drive voltage but no discharge takes place in the cells included in the reference circuit under a normal drive voltage. The wall charge waveforms are obtained from the voltage difference between the two capacitors. Using the method, the wall charge waveforms are measured during resetting period, addressing period and sustaining period for the 304.8 mm (12-inch) test PDP panel. The result shows that the wall voltage is about 96 V during the sustaining period. (authors)
Plasma Panel Detectors for MIP Detection for the SLHC and a Test Chamber Design
Ball, Robert; Etzion, Erez; Friedman, Peter S; Levin, Daniel S; Moshe, Meny Ben; Weaverdyck, Curtis; Zhou, Bing
2010-01-01
Performance demands for high and super-high luminosity at the LHC (up to 10^35 cm^(-2) sec^(-1) after the 2017 shutdown) and at future colliders demand high resolution tracking detectors with very fast time response and excellent temporal and spatial resolution. We are investigating a new radiation detector technology based on Plasma Display Panels (PDP), the underlying engine of panel plasma television displays. The design and production of PDPs is supported by four decades of industrial development. Emerging from this television technology is the Plasma Panel Sensor (PPS), a novel variant of the micropattern radiation detector. The PPS is fundamentally an array of micro-Geiger plasma discharge cells operating in a non-ageing, hermetically sealed gas mixture . We report on the PPS development program, including design of a PPS Test Cell.
Flat-panel electronic displays: a triumph of physics, chemistry and engineering.
Hilsum, Cyril
2010-03-13
This paper describes the history and science behind the development of modern flat-panel displays, and assesses future trends. Electronic displays are an important feature of modern life. For many years the cathode ray tube, an engineering marvel, was universal, but its shape was cumbersome and its operating voltage too high. The need for a flat-panel display, working at a low voltage, became imperative, and much research has been applied to this need. Any versatile flat-panel display will exploit an electro-optical effect, a transparent conductor and an addressing system to deliver data locally. The first need is to convert an electrical signal into a visible change. Two methods are available, the first giving emission of light, the second modulating ambient illumination. The most useful light-emitting media are semiconductors, historically exploiting III-V or II-VI compounds, but more recently organic or polymer semiconductors. Another possible effect uses gas plasma discharges. The modulating, or subtractive, effects that have been studied include liquid crystals, electrophoresis, electrowetting and electrochromism. A transparent conductor makes it possible to apply a voltage to an extended area while observing the results. The design is a compromise, since the free electrons that carry current also absorb light. The first materials used were metals, but some semiconductors, when heavily doped, give a better balance, with high transmission for a low resistance. Delivering data unambiguously to a million or so picture elements across the display area is no easy task. The preferred solution is an amorphous silicon thin-film transistor deposited at each cross-point in an X-Y matrix. Success in these endeavours has led to many applications for flat-panel displays, including television, flexible displays, electronic paper, electronic books and advertising signs.
Energy Technology Data Exchange (ETDEWEB)
Park, Choon-Sang [School of Electronics Engineering, College of IT Engineering, Kyungpook National University, Daegu (Korea, Republic of); Tae, Heung-Sik, E-mail: hstae@ee.knu.ac.kr [School of Electronics Engineering, College of IT Engineering, Kyungpook National University, Daegu (Korea, Republic of); Jung, Eun Young [Core Technology Lab., Corporate R and D Center, Samsung SDI Company Ltd., Cheonan (Korea, Republic of)
2013-11-29
This paper examines the optical and discharge characteristics of alternating-current plasma display panel when adopting the Al{sub 2}O{sub 3} reflective layer. The Al{sub 2}O{sub 3} reflective layer is deposited under the phosphor layer by using the screen-printing method. The resulting changes in the optical and discharge characteristics, including the power consumption, color temperature, luminance, luminous efficiency, scanning electron microscopy image, and reflectance, are then compared for both cases with and without Al{sub 2}O{sub 3} reflective layer. As a result of optimizing the thicknesses between the Al{sub 2}O{sub 3} and phosphor layers, the luminance and luminous efficiency are improved by about 17% and 7%, respectively. - Highlights: • We examine characteristics of plasma display panel when adopting reflective layer. • Al{sub 2}O{sub 3} reflective layer was deposited under the phosphor layer. • Al{sub 2}O{sub 3} reflective layer with flaky shape is very effective in enhancing luminance.
International Nuclear Information System (INIS)
Kim, H.C.; Yang, S.S.; Lee, J.K.
2003-01-01
In plasma display panels (PDPs), the resonance radiation trapping is one of the important processes. In order to incorporate this effect in a PDP cell, a three-dimensional radiation transport model is self-consistently coupled with a fluid simulation. This model is compared with the conventional trapping factor method in gas mixtures of neon and xenon. It shows the differences in the time evolutions of spatial profile and the total number of resonant excited states, especially in the afterglow. The generation rates of UV light are also compared for the two methods. The visible photon flux reaching the output window from the phosphor layers as well as the total UV photon flux arriving at the phosphor layer from the plasma region are calculated for resonant and nonresonant excited species. From these calculations, the time-averaged spatial profiles of the UV flux on the phosphor layers and the visible photon flux through the output window are obtained. Finally, the diagram of the energy efficiency and the contribution of each UV light are shown
Flat panel planar optic display
Energy Technology Data Exchange (ETDEWEB)
Veligdan, J.T. [Brookhaven National Lab., Upton, NY (United States). Dept. of Advanced Technology
1994-11-01
A prototype 10 inch flat panel Planar Optic Display, (POD), screen has been constructed and tested. This display screen is comprised of hundreds of planar optic class sheets bonded together with a cladding layer between each sheet where each glass sheet represents a vertical line of resolution. The display is 9 inches wide by 5 inches high and approximately 1 inch thick. A 3 milliwatt HeNe laser is used as the illumination source and a vector scanning technique is employed.
Effects of ramp reset pulses on the address discharge in a shadow mask plasma display panel
International Nuclear Information System (INIS)
Yang Lanlan; Tu Yan; Zhang Xiong; Jiang Youyan; Zhang Jian; Wang Baoping
2007-01-01
A two-dimensional self-consistent numerical simulation model is used to analyse the effects of the ramp reset pulses on the address discharge in a shadow mask plasma display panel (SM-PDP). Some basic parameters such as the slope of the ramp pulse and the terminal voltage of the ramp reset period are varied to investigate their effects. The simulation results illustrate that the wall voltage is mainly decided by the terminal voltage and the firing voltage at the end of the ramp reset period. Moreover, the variation of the ramp slope will also bring a few modifications to the wall voltage. The priming particles in the beginning of the addressing period are related to the slope of the ramping down voltage pulse. The simulation results can help us optimize the driving scheme of the SM-PDP
Directory of Open Access Journals (Sweden)
Kim Chan-Mi
2017-06-01
Full Text Available The objective of this particular study was to recover valuable metals from waste plasma display panels using high energy ball milling with subsequent acid dissolution. Dissolution of milled (PDP powder was studied in HCl, HNO3, and H2SO4 acidic solutions. The effects of dissolution acid, temperature, time, and PDP scrap powder to acid ratio on the leaching process were investigated and the most favorable conditions were found: (1 valuable metals (In, Ag, Mg were recovered from PDP powder in a mixture of concentrated hydrochloric acid (HCl:H2O = 50:50; (2 the optimal dissolution temperature and time for the valuable metals were found to be 60°C and 30 min, respectively; (3 the ideal PDP scrap powder to acid solution ratio was found to be 1:10. The proposed method was applied to the recovery of magnesium, silver, and indium with satisfactory results.
Developing an integrated digitizing and display surface
Hipple, James D.; Wedding, Daniel K.; Wedding, Donald K., Sr.
1995-04-01
The development of an integrated digitizing and display surface, which utilizes touch entry and flat panel display (FPD) technology, is a significant hardware advance in the field of geographic information systems (GIS). Inherent qualities of the FPD, notably the ac gas plasma display, makes such a marriage inevitable. Large diagonal sizes, high resolution color, screen flatness, and monitor thickness are desirable features of an integrated digitizing and display surface. Recently, the GIS literature has addressed a need for such an innovation. The development of graphics displays based on sophisticated technologies include `photorealistic' (or high definition) imaging at resolutions of 2048 X 2048 or greater, palates of 16.7 million colors, formats greater than 30 inches diagonal, and integrated touch entry. In this paper, there is an evaluation of FPDs and data input technologies in the development of such a product.
Laser illuminated flat panel display
Energy Technology Data Exchange (ETDEWEB)
Veligdan, J.T.
1995-12-31
A 10 inch laser illuminated flat panel Planar Optic Display (POD) screen has been constructed and tested. This POD screen technology is an entirely new concept in display technology. Although the initial display is flat and made of glass, this technology lends itself to applications where a plastic display might be wrapped around the viewer. The display screen is comprised of hundreds of planar optical waveguides where each glass waveguide represents a vertical line of resolution. A black cladding layer, having a lower index of refraction, is placed between each waveguide layer. Since the cladding makes the screen surface black, the contrast is high. The prototype display is 9 inches wide by 5 inches high and approximately I inch thick. A 3 milliwatt HeNe laser is used as the illumination source and a vector scanning technique is employed.
International Nuclear Information System (INIS)
Hu Wenbo; Han Mengju; Liang Zhihu
2006-01-01
The effects of the Xe gas content and total gas pressure on the discharge characteristics of colour plasma display panels including the sustaining voltage margin, white-field chromaticity, discharge time lag (DTL), discharge current peak, and full-width-at-half-maximum (FWHM) of the discharge current pulse, are experimentally studied. The results indicate that as the Xe gas content in the He-Ne-Xe gas mixture or total pressure increases, the sustaining voltage margin increases, the white-field chromaticity improves, and the discharge current peak has a maximum value, while DTL and FWHM have a minimum value. The mean electron energy in the gas mixture discharge is also calculated through a numerical solution of Boltzmann equation. The experimental results are explained from a view of the mean electron energy variations with the Xe gas content and total gas pressure
Ergonomic evaluation of CRT display in new control panels for nuclear power stations
International Nuclear Information System (INIS)
Kabazawa, Yoshihiko
1983-01-01
New control panels are to support powerfully the synthetic judgement function of operators by processing enormous plant data in the normal operation and at the time of accidents in nuclear power stations, and displaying the results in collective and ordered form on CRTs. This time, by carrying out the evaluation of new control panels using human engineering method, it was able to be confirmed that the new control panels have achieved the initial objectives, and to determine the criteria for the ergonomic evaluation of central control panels mainly with CRT display. Besides, it is considered that the application to wide range can be expected for this evaluation, not only to the CRT display system of the new control panels for nuclear power stations but also to other CRT images, therefore, the outline is reported. Chubu Electric Power Co., Inc. plans to adopt the new control panels with CRT display effectively utilizing process computers hereafter. It is necessary to give sufficient consideration to the method of using CRT images, the kinds of displayed images, colors and the form and arrangement of letters and symbols. 12 CRTs are used for the new control panel. The results are reflected to the control panel for Hamaoka No.3 plant. (Kako, I.)
Color quality management in advanced flat panel display engines
Lebowsky, Fritz; Neugebauer, Charles F.; Marnatti, David M.
2003-01-01
During recent years color reproduction systems for consumer needs have experienced various difficulties. In particular, flat panels and printers could not reach a satisfactory color match. The RGB image stored on an Internet server of a retailer did not show the desired colors on a consumer display device or printer device. STMicroelectronics addresses this important color reproduction issue inside their advanced display engines using novel algorithms targeted for low cost consumer flat panels. Using a new and genuine RGB color space transformation, which combines a gamma correction Look-Up-Table, tetrahedrization, and linear interpolation, we satisfy market demands.
Flat panel planar optic display. Revision 4/95
Energy Technology Data Exchange (ETDEWEB)
Veligdan, J.T.
1995-05-01
A prototype 10 inch flat panel Planar Optic display, (POD), screen has been constructed and tested. This display screen is comprised of hundreds of planar optic glass sheets bonded together with a cladding layer between each sheet where each glass sheet represents a vertical line of resolution. The display is 9 inches wide by 5 inches high and approximately 1 inch thick. A 3 milliwatt HeNe laser is used as the illumination source and a vector scanning technique is employed.
Full dynamic resolution low lower DA-Converters for flat panel displays
Directory of Open Access Journals (Sweden)
C. Saas
2006-01-01
Full Text Available It has been shown that stepwise charging can reduce the power dissipated in the source drivers of a flat panel display. However the solution presented only provided a dynamic resolution of 3 bits which is not sufficient for obtaining a full color resolution display. In this work a further development of the basic idea is presented. The stepwise charging is increased to 4 bits and supplemented by a current source to provide an output signal which represents an 8 bit value with sufficient accuracy. Within this work the application is an AM-OLED flat panel display, but the concept can easily be applied to other display technologies like TFT-LCD as well.
16 CFR 500.21 - Type size in relationship to the area of the principal display panel.
2010-01-01
... principal display panel. 500.21 Section 500.21 Commercial Practices FEDERAL TRADE COMMISSION RULES... relationship to the area of the principal display panel. (a) The statement of net quantity of contents shall be... display panel of the package or commodity and shall be uniform for all packages or commodities of...
Effects of Linear Falling Ramp Reset Pulse on Addressing Operation in AC PDP
International Nuclear Information System (INIS)
Liu Zujun; Liang Zhihu; Liu Chunliang; Meng Lingguo
2006-01-01
The effects of linear falling ramp reset pulse related to addressing operation in an alternating current plasma display panel (AC PDP) were studied. The wall charge waveforms were measured by the electrode balance method in a 12-inch coplanar AC PDP. The wall charge waveforms show the relationship between the slope ratio of the falling ramp reset pulse and the wall charges at the end of the falling ramp reset pulse which influences the addressing stability. Then the effects of the slope ratio of the linear falling ramp reset pulse on the addressing voltage and addressing time were investigated. The experimental results show that the minimum addressing voltage increases with the increase of the slope ratio of the falling ramp reset pulse, and so does the minimum addressing time. Based on the experimental results, the optimization of the addressing time and the slope ratio of the falling ramp pulse is discussed
International Nuclear Information System (INIS)
Lim, Seong-Rin; Schoenung, Julie M.
2010-01-01
Display devices such as cathode-ray tube (CRT) televisions and computer monitors are known to contain toxic substances and have consequently been banned from disposal in landfills in the State of California and elsewhere. New types of flat panel display (FPD) devices, millions of which are now purchased each year, also contain toxic substances, but have not previously been systematically studied and compared to assess the potential impact that could result from their ultimate disposal. In the current work, the focus is on the evaluation of end-of-life toxicity potential from the heavy metal content in select FPD devices with the intent to inform material selection and design-for-environment (DfE) decisions. Specifically, the metals antimony, arsenic, barium, beryllium, cadmium, chromium, cobalt, copper, lead, mercury, molybdenum, nickel, selenium, silver, vanadium, and zinc in plasma TVs, LCD (liquid crystal display) TVs, LCD computer monitors and laptop computers are considered. The human health and ecotoxicity potentials are evaluated through a life cycle assessment perspective by combining data on the respective heavy metal contents, the characterization factors in the U.S. EPA Tool for the Reduction and Assessment of Chemical and other environmental Impacts (TRACI), and a pathway and impact model. Principal contributors to the toxicity potentials are lead, arsenic, copper, and mercury. Although the heavy metal content in newer flat panel display devices creates less human health toxicity potential than that in CRTs, for ecological toxicity, the new devices are worse, especially because of the mercury in LCD TVs and the copper in plasma TVs.
Bartlett, Christopher T.
2000-08-01
The manufacture of Flat Panel Displays (FPDs) is dominated by Far Eastern sources, particularly in Active Matrix Liquid Crystal Displays (AMLCD) and Plasma. The United States has a very powerful capability in micro-displays. It is not well known that Europe has a very active research capability which has lead to many innovations in display technology. In addition there is a capability in display manufacturing of organic technologies as well as the licensed build of Japanese or Korean designs. Finally, Europe has a display systems capability in military products which is world class.
Transparent Solar Concentrator for Flat Panel Display
Yeh, Chia-Hung; Chang, Fuh-Yu; Young, Hong-Tsu; Hsieh, Tsung-Yen; Chang, Chia-Hsiung
2012-06-01
A new concept of the transparent solar concentrator for flat panel display is experimentally demonstrated without adversely affecting the visual effects. The solar concentrator is based on a solar light-guide plate with micro prisms, not only increasing the absorption area of solar energy but also enhancing the conversion efficiency. The incident light is guided by the designed solar light-guide plate according to the total internal reflection (TIR), and converted into electrical power by photovoltaic solar cells. The designed transparent solar concentrator was made and measured with high transparency, namely 94.8%. The developed solar energy system for display can store energy and supply the bias voltage to light on two light-emitting diodes (LEDs) successfully.
Effect of high Xe-concentration in a plasma display panel with a SrCaO cold cathode
International Nuclear Information System (INIS)
Uchida, Giichiro; Kajiyama, Hiroshi; Shinoda, Tsutae; Uchida, Satoshi; Akiyama, Toshiyuki
2010-01-01
We present here measurements of high Xe-contents plasma display panel (PDP) with SrCaO cold cathode. Luminous efficacy (η) shows a two-step increase with Xe-concentration in Ne/Xe gas mixture: η drastically increases up to Xe-concentration of 30% (Xe: 30%), and then attains 5 lm/W at the highest Xe-concentration of Xe: 100%. The high performance PDP with Xe: 100% can be operated at low applied voltage between 230 and 377 V due to the high secondary electron emission from the SrCaO cathode. Emission measurements clearly show the change in discharge characteristics at Xe: 30%, where the discharge changes from a Ne/Xe mixture discharge to an almost pure Xe discharge, and the vacuum ultraviolet (VUV) radiation from the combination of resonance and excimer radiations to only excimer radiation. Theoretical analysis solving Boltzmann equation for electron demonstrates that increasing Xe-concentration enhances the collision frequency for electron impact excitation directly from ground state to lower levels concerned with the VUV radiation, resulting in a drastic increase in luminous efficacy up to Xe: 30%. Also, one-dimensional fluid simulation of a Ne/Xe dielectric barrier discharge clearly shows that a combination of high secondary electron emission cathode and high Xe-concentration is quite effective for high VUV radiation efficiency because it induces a drastic increase in electron-heating efficiency.
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-03-01
This project is aimed at creation of the new world display industry in Shikoku by developing the high-function flat panel display techniques and thereby establishing new techniques which solve the problems involved in, e.g., LEDs, plasma-aided devices and ELs other than liquid crystal devices. For development of emitters using diamond, important results have been obtained for the morphology, and cathode luminescence, Raman and photoluminescence spectra of polycrystalline diamond, synthesized by the vapor-phase process under varying conditions, on the electron radiation characteristics of the emitters. These results have led to clarification of the optimum vapor-phase synthesis conditions for diamond for high-function emitters. The techniques utilizing focused ion beams have also advanced to develop thin polycrystalline diamond films for emitters which correspond to the image elements of quality for television. For electron emitters, a structure prepared by implantation without using a high electrical field is proposed, and the device mechanisms involved are clarified. (NEDO)
Handbook of display technology
Castellano, Joseph A
1992-01-01
This book presents a comprehensive review of technical and commercial aspects of display technology. It provides design engineers with the information needed to select proper technology for new products. The book focuses on flat, thin displays such as light-emitting diodes, plasma display panels, and liquid crystal displays, but it also includes material on cathode ray tubes. Displays include a large number of products from televisions, auto dashboards, radios, and household appliances, to gasoline pumps, heart monitors, microwave ovens, and more.For more information on display tech
Advances in infrastructure support for flat panel display manufacturing
Bardsley, James N.; Ciesinski, Michael F.; Pinnel, M. Robert
1997-07-01
The success of the US display industry, both in providing high-performance displays for the US Department of Defense at reasonable cost and in capturing a significant share of the global civilian market, depends on maintaining technological leadership and on building efficient manufacturing capabilities. The US Display Consortium (USDC) was set up in 1993 by the US Government and private industry to guide the development of the infrastructure needed to support the manufacturing of flat panel displays. This mainly involves the supply of equipment and materials, but also includes the formation of partnerships and the training of a skilled labor force. Examples are given of successful development projects, some involving USDC participation, others through independent efforts of its member companies. These examples show that US-based companies can achieve leadership positions in this young and rapidly growing global market.
International Nuclear Information System (INIS)
Kwon, Ohyung; Whang, Ki-Woong; Bae, Hyun Sook
2009-01-01
The discharge characteristics of He-Ne-Xe gas mixture in the plasma display panel were investigated using a two-dimensional numerical simulation to understand the effects of adding He and varying the Xe contents in the gas mixture, and also varying sustain electrode gap. With 5% Xe content and 60 μm sustain electrode gap, decreased ionization led to the improvement of the vacuum ultraviolet (vuv) efficacy at increasing He mixing ratios. However, at 20% Xe content and 60 μm sustain electrode gap, increased electron heating improved the vuv efficacy until the He mixing ratio reached 0.7, but the efficacy decreased beyond the ratio of 0.7 due to the increased ionization of Xe atoms. At 5% Xe content and 200 μm sustain electrode gap, the vuv efficacy increased as a result of increased electron heating at the gap space at increasing He mixing ratios.
Visual and ocular effects from the use of flat-panel displays
Directory of Open Access Journals (Sweden)
Esteban Porcar
2016-06-01
Full Text Available AIM: To evaluate the prevalence of eye symptoms in a non-presbyopic population of video display unit (VDU users with flat-panel displays. METHODS: One hundred and sixteen VDU users with flat-panel display from an urban population participated in the study; their ages ranging from 20 to 34y. There were 60 females and 56 males. An eye examination to rule out the presence of significant uncorrected refractive errors, general binocular dysfunctions and eye conditions was carried out. In order to determine and quantify the type and nature of eye symptoms, participants were asked to answer written questionnaire and the results were grouped by gender, age and number of hours a day spent using a VDU. RESULTS: Seventy-two percent of participants reported eye symptoms related to VDU use. Eye symptoms from moderate-to-severe were found in 23% of participants. The main symptom was moderate-to-severe tired eyes (14%; followed by sensitivity to bright lights (12%, blurred vision at far distances (10%, eyestrain or dry eye or irritated or burning eyes (9%, difficulty in refocusing from one distance to another or headache (8% and blurred vision at near or intermediate distances (<4%. Eye symptoms were greater among females (P=0.005 and increased with VDU use, markedly above 6h spent using a VDU in a typical day (P=0.01. CONCLUSION: Significant eye symptoms relate to VDU use often occur and should not be underestimated. The increasing use of electronic devices with flat-panel display should prompt users to take appropriate measures to prevent or to relieve the eye symptoms arising from their use.
Visual and ocular effects from the use of flat-panel displays.
Porcar, Esteban; Pons, Alvaro M; Lorente, Amalia
2016-01-01
To evaluate the prevalence of eye symptoms in a non-presbyopic population of video display unit (VDU) users with flat-panel displays. One hundred and sixteen VDU users with flat-panel display from an urban population participated in the study; their ages ranging from 20 to 34y. There were 60 females and 56 males. An eye examination to rule out the presence of significant uncorrected refractive errors, general binocular dysfunctions and eye conditions was carried out. In order to determine and quantify the type and nature of eye symptoms, participants were asked to answer written questionnaire and the results were grouped by gender, age and number of hours a day spent using a VDU. Seventy-two percent of participants reported eye symptoms related to VDU use. Eye symptoms from moderate-to-severe were found in 23% of participants. The main symptom was moderate-to-severe tired eyes (14%); followed by sensitivity to bright lights (12%), blurred vision at far distances (10%), eyestrain or dry eye or irritated or burning eyes (9%), difficulty in refocusing from one distance to another or headache (8%) and blurred vision at near or intermediate distances (<4%). Eye symptoms were greater among females (P=0.005) and increased with VDU use, markedly above 6h spent using a VDU in a typical day (P=0.01). Significant eye symptoms relate to VDU use often occur and should not be underestimated. The increasing use of electronic devices with flat-panel display should prompt users to take appropriate measures to prevent or to relieve the eye symptoms arising from their use.
Flat-panel video resolution LED display system
Wareberg, P. G.; Kennedy, D. I.
The system consists of a 128 x 128 element X-Y addressable LED array fabricated from green-emitting gallium phosphide. The LED array is interfaced with a 128 x 128 matrix TV camera. Associated electronics provides for seven levels of grey scale above zero with a grey scale ratio of square root of 2. Picture elements are on 0.008 inch centers resulting in a resolution of 125 lines-per-inch and a display area of approximately 1 sq. in. The LED array concept lends itself to modular construction, permitting assembly of a flat panel screen of any desired size from 1 x 1 inch building blocks without loss of resolution. A wide range of prospective aerospace applications exist extending from helmet-mounted systems involving small dedicated arrays to multimode cockpit displays constructed as modular screens. High-resolution LED arrays are already used as CRT replacements in military film-marking reconnaissance applications.
Analysis of AC and DC Lighting Systems with 150-Watt Peak Solar Panel in Denpasar Based on NASA Data
Narottama, A. A. N. M.; Amerta Yasa, K.; Suwardana, I. W.; Sapteka, A. A. N. G.; Priambodo, P. S.
2018-01-01
Solar energy on the Earth’s surface has different magnitudes on every longitude and latitude. National Aeronautics and Space Administration (NASA) provides surface meteorology and solar energy database which can be accessed openly online. This database delivers information about Monthly Averaged Insolation Incident On A Horizontal Surface, Monthly Averaged Insolation Incident On A Horizontal Surface At Indicated GMT Times and also data about Equivalent Number Of No-Sun Or Black Days for any latitude and longitude. Therefore, we investigate the lighting systems with 150-Watt peak solar panel in Denpasar City, the capital province of Bali. Based on NASA data, we analyse the received wattage by a unit of 150-Watt peak solar panel in Denpasar City and the sustainability of 150-Watt peak solar panel to supply energy for 432-Watt hour/day AC and 360-Watt hour/day DC lighting systems using 1.2 kWh battery. The result shows that the maximum received wattage by a unit of 150-Watt peak solar panel is 0.76 kW/day in October. We concluded that the 1.2 kWh installed battery has higher capacity than the battery capacity needed in March, the month with highest no-sun days, for both AC and DC lighting systems. We calculate that the installed battery can be used to store the sustainable energy from sun needed by AC and DC lighting system for about 2.78 days and 3.51 days, consecutively.
Research on the Plasma Anemometer Based on AC Glow Discharge
Directory of Open Access Journals (Sweden)
Bing Yu
2017-01-01
Full Text Available A new plasma anemometer based on AC glow discharge is designed in this article. Firstly, theoretical analysis of plasma anemometer working principle is introduced to prove the feasibility of the experimental measurement method. Then the experiments are carried out to study the effects of different parameters on the static discharge characteristics of the plasma anemometer system, by which the system optimization methods are obtained. Finally, several groups of appropriate parameters are selected to build the plasma anemometer system based on resistance capacitance coupling negative feedback AC glow discharge, and different airflow speeds are applied to obtain the achievable velocity measurement range. The results show that there is a linear relationship between airflow velocity and discharge current in an allowable error range, which can be applied for airflow velocity measurement. Negative feedback coupling module, which is composed of the coupling resistance and the coupling capacitance, has good effects on improving the system stability. The measurement range of the airflow velocity is significantly increased when the electrode gap is 3 mm, coupling resistance is 470 Ω, and coupling capacitance is 220 pF.
Protected electrodes for plasma panels
International Nuclear Information System (INIS)
Hall, S.W.
1984-01-01
A metal oxide coating is applied between the conductive base and the magnesium oxide dielectric of the input and/or erase electrode(s) in a plasma display device to prevent break-down of the dielectric
International Nuclear Information System (INIS)
Chang Hungwen; Hsu Chengche
2012-01-01
In this work, three major problems, namely severe electrode damage, poor plasma stability and excess power consumption, arising in ac-driven plasmas in saline solutions are solved using a rectified power source. Diagnostic studies on the effects of power source polarity and frequency on the plasma behaviour are performed. Examination of I-V characteristics and temporally resolved light emission shows that the polarity significantly influences the current amplitude when the plasma exists, while the frequency alters the bubble dynamics, which in turn affects the plasma ignition voltage. When the plasma is driven by a rectified ac power source, the electrode erosion is reduced substantially. With a low frequency, moderate applied voltage and positively rectified ac power source (e.g. 100 Hz and 350 V), a stable plasma is ignited in nearly every power cycle. (paper)
Plasma Facing Components Generic Facilities Review Panel (PFC-GFRP): Final report
International Nuclear Information System (INIS)
McGrath, R.; Allen, S.; Hill, D.; Brooks, J.; Mattas, R.; Davis, J.; Lipschultz, B.; Ulrickson, M.
1993-10-01
The Plasma Facing Components (PFC) Facilities Review Panel was chartered by the US Department of Energy, Office of Fusion Energy, ITER (International Thermonuclear Experimental Reactor) and Technology Division, to outline the program plan and identify the supporting test facilities that lead to reliable, long-lived plasma facing components for ITER. This report summarizes the panel's findings and identifies the necessary and sufficient set of test facilities required for ITER PFC development
The Space Station Photovoltaic Panels Plasma Interaction Test Program: Test plan and results
Nahra, Henry K.; Felder, Marian C.; Sater, Bernard L.; Staskus, John V.
1989-01-01
The Plasma Interaction Test performed on two space station solar array panels is addressed. This includes a discussion of the test requirements, test plan, experimental set-up, and test results. It was found that parasitic current collection was insignificant (0.3 percent of the solar array delivered power). The measured arcing threshold ranged from -210 to -457 V with respect to the plasma potential. Furthermore, the dynamic response of the panels showed the panel time constant to range between 1 and 5 microsec, and the panel capacitance to be between .01 and .02 microF.
The Space Station photovoltaic panels plasma interaction test program - Test plan and results
Nahra, Henry K.; Felder, Marian C.; Sater, Bernard L.; Staskus, John V.
1990-01-01
The plasma Interaction Test performed on two space station solar array panels is addressed. This includes a discussion of the test requirements, test plan, experimental set-up, and test results. It was found that parasitic current collection was insignificant (0.3 percent of the solar array delivered power). The measured arcing threshold ranged from -210 to -457 V with respect to the plasma potential. Furthermore, the dynamic response of the panels showed the panel time constant to range between 1 and 5 microsec, and the panel capacitance to be between .01 and .02 microF.
9 CFR 355.35 - Label information to be displayed on principal panel.
2010-01-01
... AND VOLUNTARY INSPECTION AND CERTIFICATION CERTIFIED PRODUCTS FOR DOGS, CATS, AND OTHER CARNIVORA... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Label information to be displayed on principal panel. 355.35 Section 355.35 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE...
2010-04-01
... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Principal display panel of all OTC drug products intended for oral ingestion that contain alcohol. 328.50 Section 328.50 Food and Drugs FOOD AND DRUG... PRODUCTS INTENDED FOR ORAL INGESTION THAT CONTAIN ALCOHOL Labeling § 328.50 Principal display panel of all...
Attenuated phase-shift mask (PSM) blanks for flat panel display
Kageyama, Kagehiro; Mochizuki, Satoru; Yamakawa, Hiroyuki; Uchida, Shigeru
2015-10-01
The fine pattern exposure techniques are required for Flat Panel display applications as smart phone, tablet PC recently. The attenuated phase shift masks (PSM) are being used for ArF and KrF photomask lithography technique for high end pattern Semiconductor applications. We developed CrOx based large size PSM blanks that has good uniformity on optical characteristics for FPD applications. We report the basic optical characteristics and uniformity, stability data of large sized CrOx PSM blanks.
Léger, Laure; Chevalier, Aline
2017-07-01
Searching for information on the internet has become a daily activity. It is considered to be a complex cognitive activity that involves visual attention. Many studies have demonstrated that users' information search are affected both by the spatial configuration of words and the elements displayed on the screen: elements that are used to structure web pages. One of these elements, the web panel, contains information. Web panel is a rectangular area with a colored background that was used to highlighting content presented in this specific rectangular area. Our general hypothesis was that the presence of a panel on a web page would affect the structure of a word display, as a result, information search accuracy. We carried out an experiment in which we manipulated the presence vs. the absence of a panel, as well as its orientation on the screen (vertical vs. horizontal). Twenty participants were asked to answer questions while their eye movements were recorded. Results showed that the presence of a panel resulted in reduced accuracy and shorter response times. Panel orientation affected scanpaths, especially when they were orientated vertically. We discuss these findings and suggest ways in which this research could be developed further in future.
Review of flat panel display programs and defense applications
Gnade, Bruce; Schulze, Raymond; Henderson, Girardeau L.; Hopper, Darrel G.
1997-07-01
Flat panel display research has comprised a substantial portion of the national investment in new technology for economic and national security for the past nine years. These investments have ben made principally via several Defense Advanced Research Projects Agency (DARPA) programs, known collectively as the continuing High Definition Systems Program, and the Office of the Secretary of Defense Production Act Title III Program. Using input from the Army, Navy, and Air Force to focus research and identify insertion opportunities, DARPA and the Title III Program Office have made investments to develop the national technology base and manufacturing infrastructure necessary to meet the twin challenge of providing affordable displays in current systems and enabling the DoD strategy of winning future conflicts by getting more information to all participants during the battle. These research programs are reviewed and opportunities for applications are described. Future technology development, transfer, and transition requirements are identified. Strategy and vision are documented to assist the identification of areas meriting further consideration.
Energy Technology Data Exchange (ETDEWEB)
Kim, Sa Kil; Lee, Yong Hee [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2015-10-15
The personal aspect of human errors has been mainly overcome by virtue of the education and training. However, in the system aspect, the education and training system needs to be reconsidered for more effective reduction of human errors affected from various systems hazards. Traditionally the education and training systems are mainly not focused on team skills such as communication, situational awareness, and coordination, etc. but individual knowledge, skill, and attitude. However, the team factor is one of the crucial issues to reduce the human errors in most industries. In this study, we identify the emerging types of team errors, especially, in digitalized control room of nuclear power plants such as the APR-1400 main control room. Most works in nuclear industry are to be performed by a team of more than two persons. Even though the individual errors can be detected and recovered by the qualified others and/or the well trained team, it is rather seldom that the errors by team could be easily detected and properly recovered by the team itself. Note that the team is defined as two or more people who are appropriately interacting with each other, and the team is a dependent aggregate, which accomplishes a valuable goal. Team error is one of the typical organizational errors that may occur during performing operations in nuclear power plants. The large display panel is a representative feature of digitalized control room. As a group-view display, the large display panel provides plant overview to the operators. However, in terms of team performance and team errors, the large display panel is on a discussion board still because the large display panel was designed just a concept of passive display. In this study, we will propose revised large display panel which is integrated with several alternative interfaces against feasible team errors.
International Nuclear Information System (INIS)
Kim, Sa Kil; Lee, Yong Hee
2015-01-01
The personal aspect of human errors has been mainly overcome by virtue of the education and training. However, in the system aspect, the education and training system needs to be reconsidered for more effective reduction of human errors affected from various systems hazards. Traditionally the education and training systems are mainly not focused on team skills such as communication, situational awareness, and coordination, etc. but individual knowledge, skill, and attitude. However, the team factor is one of the crucial issues to reduce the human errors in most industries. In this study, we identify the emerging types of team errors, especially, in digitalized control room of nuclear power plants such as the APR-1400 main control room. Most works in nuclear industry are to be performed by a team of more than two persons. Even though the individual errors can be detected and recovered by the qualified others and/or the well trained team, it is rather seldom that the errors by team could be easily detected and properly recovered by the team itself. Note that the team is defined as two or more people who are appropriately interacting with each other, and the team is a dependent aggregate, which accomplishes a valuable goal. Team error is one of the typical organizational errors that may occur during performing operations in nuclear power plants. The large display panel is a representative feature of digitalized control room. As a group-view display, the large display panel provides plant overview to the operators. However, in terms of team performance and team errors, the large display panel is on a discussion board still because the large display panel was designed just a concept of passive display. In this study, we will propose revised large display panel which is integrated with several alternative interfaces against feasible team errors
Directory of Open Access Journals (Sweden)
Pacios Álvarez, Antonia
2007-06-01
Full Text Available The house prototype of the Provisional Emergency House System uses wood and its derivatives for the facades, floor structure, roofing and partitions. The extensive use of wooden panels for the construction and the lack of data, in Spain, about their acoustic behavior bring up the necessity to make in situ measurements of the acoustic isolation to airborne sound. Panels used for facades and partitions are built with a wooden framework and membrane of oriented strand board in both sides, for the facades, and of laminated plaster boards for the inner partitions. With the objective of verifying the sound insulation of the facades according to Spanish Standard UNE EN ISO 140-5, in situ measurements of airborne sound insulation of facade elements and facades have been made; according to Spanish Standard UNE EN ISO 140-4, in situ measurements of airborne sound insulation between rooms for internal walls have also been made. The procedure of the global insulation has been followed to measure the acoustic insulation of complete facades without making distinction between the elements that form it.El prototipo de vivienda del Sistema de Vivienda Provisional de Emergencia utiliza principalmente la madera y sus derivados tanto en los cerramientos y particiones como en el forjado y la cubierta. El empleo de soluciones constructivas ligeras y la falta de datos en España acerca del comportamiento acústico de los mismos plantea la necesidad de realizar mediciones in situ del aislamiento acústico a ruido aéreo. El panel base de cerramiento y particiones se construye partiendo de un entramado de montantes de madera con membrana en ambas caras de tableros de virutas de madera orientadas, para el caso de los cerramientos exteriores, y de tableros laminados de yeso para las particiones interiores. Con el objeto de comprobar el aislamiento acústico de dichos cerramiento se han realizado ensayos siguiendo la Norma UNE EN ISO 140-5 para la medición in situ del
Al-Kuhali, K.; Hussain M., I.; Zain Z., M.; Mullenix, P.
2015-05-01
Aim: This paper contribute to the flat panel display industry it terms of aggregate production planning. Methodology: For the minimization cost of total production of LCD manufacturing, a linear programming was applied. The decision variables are general production costs, additional cost incurred for overtime production, additional cost incurred for subcontracting, inventory carrying cost, backorder costs and adjustments for changes incurred within labour levels. Model has been developed considering a manufacturer having several product types, which the maximum types are N, along a total time period of T. Results: Industrial case study based on Malaysia is presented to test and to validate the developed linear programming model for aggregate production planning. Conclusion: The model development is fit under stable environment conditions. Overall it can be recommended to adapt the proven linear programming model to production planning of Malaysian flat panel display industry.
Yang, Le; Sang, Xinzhu; Yu, Xunbo; Liu, Boyang; Liu, Li; Yang, Shenwu; Yan, Binbin; Du, Jingyan; Gao, Chao
2018-05-01
A 54-inch horizontal-parallax only light-field display based on the light-emitting diode (LED) panel and the micro-pinhole unit array (MPUA) is demonstrated. Normally, the perceived 3D effect of the three-dimensional (3D) display with smooth motion parallax and abundant light-field information can be enhanced with increasing the density of viewpoints. However, the density of viewpoints is inversely proportional to the spatial display resolution for the conventional integral imaging. Here, a special MPUA is designed and fabricated, and the displayed 3D scene constructed by the proposed horizontal light-field display is presented. Compared with the conventional integral imaging, both the density of horizontal viewpoints and the spatial display resolution are significantly improved. In the experiment, A 54-inch horizontal light-field display with 42.8° viewing angle based on the LED panel with the resolution of 1280 × 720 and the MPUA is realized, which can provide natural 3D visual effect to observers with high quality.
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
A Gastric Glycoform of MUC5AC Is a Biomarker of Mucinous Cysts of the Pancreas.
Directory of Open Access Journals (Sweden)
Jessica Sinha
Full Text Available Molecular indicators to specify the risk posed by a pancreatic cyst would benefit patients. Previously we showed that most cancer-precursor cysts, termed mucinous cysts, produce abnormal glycoforms of the proteins MUC5AC and endorepellin. Here we sought to validate the glycoforms as a biomarker of mucinous cysts and to specify the oligosaccharide linkages that characterize MUC5AC. We hypothesized that mucinous cysts secrete MUC5AC displaying terminal N-acetylglucosamine (GlcNAc in either alpha or beta linkage. We used antibody-lectin sandwich assays to detect glycoforms of MUC5AC and endorepellin in cyst fluid samples from three independent cohorts of 49, 32, and 66 patients, and we used monoclonal antibodies to test for terminal, alpha-linked GlcNAc and the enzyme that produces it. A biomarker panel comprising the previously-identified glycoforms of MUC5AC and endorepellin gave 96%, 96%, and 87% accuracy for identifying mucinous cysts in the three cohorts with an average sensitivity of 92% and an average specificity of 94%. Glycan analysis showed that MUC5AC produced by a subset of mucinous cysts displays terminal alpha-GlcNAc, a motif expressed in stomach glands. The alpha-linked glycoform of MUC5AC was unique to intraductal papillary mucinous neoplasms (IPMN, whereas terminal beta-linked GlcNAc was increased in both IPMNs and mucinous cystic neoplasms (MCN. The enzyme that synthesizes alpha-GlcNAc, A4GNT, was expressed in the epithelia of mucinous cysts that expressed alpha-GlcNAc, especially in regions with high-grade dysplasia. Thus IPMNs secrete a gastric glycoform of MUC5AC that displays terminal alpha-GlcNAc, and the combined alpha-GlcNAc and beta-GlcNAc glycoforms form an accurate biomarker of mucinous cysts.
New perspectives on the dynamics of AC and DC plasma arcs exposed to cross-fields
International Nuclear Information System (INIS)
Abdo, Youssef; Rohani, Vandad; Cauneau, François; Fulcheri, Laurent
2017-01-01
Interactions between an arc and external fields are crucially important for the design and the optimization of modern plasma torches. Multiple studies have been conducted to help better understand the behavior of DC and AC current arcs exposed to external and ‘ self-induced ’ magnetic fields, but the theoretical foundations remain very poorly explored. An analytical investigation has therefore been carried out in order to study the general behavior of DC and AC arcs under the effect of random cross-fields. A simple differential equation describing the general behavior of a planar DC or AC arc has been obtained. Several dimensionless numbers that depend primarily on arc and field parameters and the main arc characteristics (temperature, electric field strength) have also been determined. Their magnitude indicates the general tendency pattern of the arc evolution. The analytical results for many case studies have been validated using an MHD numerical model. The main purpose of this investigation was deriving a practical analytical model for the electric arc, rendering possible its stabilization and control, and the enhancement of the plasma torch power. (paper)
New perspectives on the dynamics of AC and DC plasma arcs exposed to cross-fields
Abdo, Youssef; Rohani, Vandad; Cauneau, François; Fulcheri, Laurent
2017-02-01
Interactions between an arc and external fields are crucially important for the design and the optimization of modern plasma torches. Multiple studies have been conducted to help better understand the behavior of DC and AC current arcs exposed to external and ‘self-induced’ magnetic fields, but the theoretical foundations remain very poorly explored. An analytical investigation has therefore been carried out in order to study the general behavior of DC and AC arcs under the effect of random cross-fields. A simple differential equation describing the general behavior of a planar DC or AC arc has been obtained. Several dimensionless numbers that depend primarily on arc and field parameters and the main arc characteristics (temperature, electric field strength) have also been determined. Their magnitude indicates the general tendency pattern of the arc evolution. The analytical results for many case studies have been validated using an MHD numerical model. The main purpose of this investigation was deriving a practical analytical model for the electric arc, rendering possible its stabilization and control, and the enhancement of the plasma torch power.
AC-driven organic light emission devices with carbon nanotubes
Jeon, So-Yeon; Yu, SeGi
2017-02-01
We have investigated alternating current (AC)-driven organic light-emitting devices (OLEDs), with carbon nanotubes (CNTs) incorporated within the emission layer. With CNT incorporation, the brightness of the OLEDs was substantially improved, and the turn-on voltage was reduced by at least a factor of five. Furthermore, the current levels of the CNT-incorporated OLEDs were lower than that of the reference device. A roughly 70% decrease in the current level was obtained for a CNT concentration of 0.03 wt%. This was accomplished by keeping the concentration of CNTs low and the length of CNTs short, which helped to suppress the percolation networking of CNTs within the emitting layer. Strong local electric fields near the end-tips of CNTs and micro-capacitors formed by dispersed CNTs might have caused this high brightness and these low currents. CNT incorporation in the emitting layer can improve the characteristics of AC-driven OLEDs, which are considered to be one of the candidates for flat panel displays and lightning devices.
AC-driven Organic Light Emission Devices with Carbon Nanotubes
Energy Technology Data Exchange (ETDEWEB)
Jeon, So-Yeon [Sungkyunkwan University, Suwon (Korea, Republic of); Yu, SeGi [Hankuk University of Foreign Studies, Yongin (Korea, Republic of)
2017-02-15
We have investigated alternating current (AC)-driven organic light-emitting devices (OLEDs), with carbon nanotubes (CNTs) incorporated within the emission layer. With CNT incorporation, the brightness of the OLEDs was substantially improved, and the turn-on voltage was reduced by at least a factor of five. Furthermore, the current levels of the CNT-incorporated OLEDs were lower than that of the reference device. A roughly 70% decrease in the current level was obtained for a CNT concentration of 0.03 wt%. This was accomplished by keeping the concentration of CNTs low and the length of CNTs short, which helped to suppress the percolation networking of CNTs within the emitting layer. Strong local electric fields near the end-tips of CNTs and micro-capacitors formed by dispersed CNTs might have caused this high brightness and these low currents. CNT incorporation in the emitting layer can improve the characteristics of AC-driven OLEDs, which are considered to be one of the candidates for flat panel displays and lightning devices.
Displaying DIII-D plasma data using DEC's X window system
International Nuclear Information System (INIS)
Greene, K.L.
1991-11-01
The D3-D tokamak program, funded by the Department of Energy, carries out plasma physics and fusion energy research experiments. The machine began operation in February 1986; at that time, approximately 7 Mbytes of data was collected for shot. Since that time, the shot size has steadily increased to over 50 Mbytes with the average shot size between 35 and 45 Mbytes. Shots are fired every 12 to 15 minutes and last approximately 5 to 10 seconds. Between 30 and 40 shots are fired each day when plasma experiments are scheduled. In 1987 MFITD and MFITPLAY were written/modified. These two programs provide graphical output that allows the users to see, before the next shot, the plasma shape and the locations of the plasma and magnetic flux lines within the tokamak. MFITD performs the computations which calculate the shape and location of the plasma; it also graphically displays a small subset of timeslice data. MFITPLAY graphically displays the full set of timeslice data. Through interactive commands, MFITPLAY also allows the user to control the various aspects of how the data is displayed. In 1990, both programs were converted from User Interface Services (UIS) routines, which are part of the MicroVMS workstation graphics software, to DEC's X Window System using the DECWindows window manager. These modifications were required because of a move by Digital Equipment Corporation (DEC) to support X windows and phase out UIS. Due to the nature and purpose of each program, MFITD needed only simple graphics conversion while MFITPLAY was completely rewritten. The DECWindows version of MFITPLAY offers a number of improvements, such as a more intuitive user interface
Guercio, J. G.; Haines, R. F.
1978-01-01
Twelve commercial pilots were shown 50 high-fidelity slides of a standard aircraft instrument panel with the airspeed, altitude, ADI, VSI, and RMI needles in various realistic orientations. Fifty slides showing an integrated head-up display (HUD) symbology containing an equivalent number of flight parameters as above (with flight path replacing VSI) were also shown. Each subject was told what flight parameter to search for just before each slide was exposed and was given as long as needed (12 sec maximum) to respond by verbalizing the parameter's displayed value. The results for the 100-percent correct data indicated that: there was no significant difference in mean reaction time (averaged across all five flight parameters) between the instrument panel and HUD slides; and a statistically significant difference in mean reaction time was found in responding to different flight parameters.
Designing low cost LED display for the billboard
Hong, Yi-Jian; Uang, Chii-Maw; Wang, Ping-Chieh; Ho, Zu-Sheng
2011-10-01
With quickly advance of the computer, microelectronics and photonics technologies, LED display panel becomes a new electronic advertising media. It can be used to show any information whatever characters or graphics. Most LED display panels are built of many Light-Emitting Diodes arranged in a matrix form. The display has many advantages such as low power, low cost, long life and high definition. Because the display panel is asked to show rich color, the LED display panel's driving system becomes very complex. The design methodology of LED display panel's driver becomes more and more important to meet the market requirements. Cost is always the most important issue in public market domain. In this paper, we report a design methodology of LED display panel's driver based on the microprocessor control unit (MCU) system and LED display controller IC, HT1632C, to control three colors, RGB, color LED display panel and the modular panel size is 24*16 in matrix form. The HT1632C is a memory mapping LED display controller, it can be used on many applications, such as digital clock, thermometer, counter, voltmeter or other instrumentation readouts. Three pieces of HT1632C are used to drive a 24*16 RGB LED display panel, in our design case. Each HT163C chip is used to control one of the R, G and B color. As the drive mode is driven in DC mode, the RGB display panel can create and totally of seven colors under the control of MCU. The MCU generates the control signal to drive HT1632C. In this study, the software design methodology is adopted with dynamic display principle. When the scan frequency is 60Hz, LED display panel will get the clear picture and be able to display seven colors.
Study of plasma equilibrium during the AC current reversal phase in STOR-M
International Nuclear Information System (INIS)
Xiao, C.
2002-01-01
Alternating current (AC) tokamak operation and equilibrium studies have been performed on the STOR-M tokamak. The recent experiments have achieved consistent smooth current reversal through the implementation of a hybrid digital-analog position controller and by careful density control. In order to study the plasma equilibrium during the current reversal phase with negligible rotational transform, a segmented limiter with four isolated conducting plates has been installed. The plates can be connected outside the vacuum vessel, which allows measurements of currents flowing between limiter plates. When the current reversal is smooth with zero dwell time, the hydrogen line emission level and electron density remain finite, indicating a finite particle confinement. The current from the top to the bottom limiter plate is also finite and its direction is consistent with that of the grad-B drift. The observation suggests that the limiter and other conducting structures surrounding the plasmas plays the role, during the current reversal phase of AC tokamak operation, to short out the charge separation arising from the grad-B drift and to maintain a finite particle confinement. (author)
Low-impedance internal linear inductive antenna for large-area flat panel display plasma processing
International Nuclear Information System (INIS)
Kim, K.N.; Jung, S.J.; Lee, Y.J.; Yeom, G.Y.; Lee, S.H.; Lee, J.K.
2005-01-01
An internal-type linear inductive antenna, that is, a double-comb-type antenna, was developed for a large-area plasma source having the size of 1020 mmx830 mm, and high density plasmas on the order of 2.3x10 11 cm -3 were obtained with 15 mTorr Ar at 5000 W of inductive power with good plasma stability. This is higher than that for the conventional serpentine-type antenna, possibly due to the low impedance, resulting in high efficiency of power transfer for the double-comb antenna type. In addition, due to the remarkable reduction of the antenna length, a plasma uniformity of less than 8% was obtained within the substrate area of 880 mmx660 mm at 5000 W without having a standing-wave effect
International Nuclear Information System (INIS)
1993-01-01
The Plasma Science Committee (PLSC) of the National Research Council (NRC) is charged with monitoring the health of the field of plasma science in the United States and identifies and examines both broad and specific issues affecting the field. Regular meetings, teleconferences, briefings from agencies and the scientific community, the formation of study panels to prepare reports, and special symposia are among the mechanisms used by the PLSC to meet its charge. During July 1992, the PLSC sponsored a workshop on nonneutral plasmas in traps. Although no written report on the workshop results, was prepared for public distribution, a summary of highlights was provided to the OPST Subpanel on Nonneutral Plasmas. The PLSC also continued its follow-up briefings and discussions on the results of the results of the report Plasma Processing of materials. Scientific and Technological Opportunities. As a result of these activities, the Committee is now working with the NRC Committee on Atomic, Molecular, and Optical Sciences (CAMOS) to organize a symposium on database needs in plasma processing of materials
Simulation of photons from plasmas for the applications to display devices
Lee, Hae June; Yoon, Hyun Jin; Lee, Jae Koo
2007-07-01
Numerical modeling of the photon transport of the ultraviolet (UV) and the visible lights are presented for plasma based display devices. The transport of UV lights which undergo resonance trapping by ground state atoms is solved by using the Holstein equation. After the UV lights are transformed to visible lights at the phosphor surfaces, the visible lights experience complicated traces inside the cell and finally are emitted toward the viewing window after having some power loss within the cell. A three-dimensional ray trace of the visible lights is calculated with a radiosity model. These simulations for the photons strengthen plasma discharge modeling for the application to display devices.
AC plasma electrolytic oxidation of magnesium with zirconia nanoparticles
International Nuclear Information System (INIS)
Arrabal, R.; Matykina, E.; Viejo, F.; Skeldon, P.; Thompson, G.E.; Merino, M.C.
2008-01-01
The incorporation of monoclinic zirconia nanoparticles and their subsequent transformation is examined for coatings formed on magnesium by plasma electrolytic oxidation under AC conditions in silicate electrolyte. The coatings are shown to comprise two main layers, with nanoparticles entering the coating at the coating surface and through short-circuit paths to the region of the interface between the inner and outer coating layers. Under local heating of microdischarges, the zirconia reacts with magnesium species to form Mg 2 Zr 5 O 12 in the outer coating layer. Relatively little zirconium is present in the inner coating layer. In contrast, silicon species are present in both coating layers, with reduced amounts in the inner layer
Flat or curved thin optical display panel
Veligdan, J.T.
1995-01-10
An optical panel includes a plurality of waveguides stacked together, with each waveguide having a first end and an opposite second end. The first ends collectively define a first face, and the second ends collectively define a second face of the panel. The second face is disposed at an acute face angle relative to the waveguides to provide a panel which is relatively thin compared to the height of the second face. In an exemplary embodiment for use in a projection TV, the first face is substantially smaller in height than the second face and receives a TV image, with the second face defining a screen for viewing the image enlarged. 7 figures.
A new poly-Si TFT compensation pixel circuit employing AC driving mode for AMOLED displays
International Nuclear Information System (INIS)
Song Xiaofeng; Luo Jianguo; Wu Weijing; Peng Junbiao; Zhou Lei; Zhang Lirong
2013-01-01
This paper presents a new poly-Si pixel circuit employing AC driving mode for active matrix organic light-emitting diode (AMOLED) displays. The proposed pixel circuit, which consists of one driving thin-film transistor (TFT), three switching TFTs, and one storage capacitor, can effectively compensate for the threshold voltage variation in poly-Si and the OLED degradation. As there is no light emission, except for during the emitting period, and a small number of devices used in the proposed pixel circuit, a high contrast ratio and a high pixel aperture ratio can be easily achieved. Simulation results by SMART-SPICE software show that the non-uniformity of the OLED current for the proposed pixel circuit is significantly decreased (< 10%) with an average value of 2.63%, while that of the conventional 2T1C is 103%. Thus the brightness uniformity of AMOLED displays can be improved by using the proposed pixel circuit. (semiconductor integrated circuits)
Carbon Nanotube Thin Film Transistors for Flat Panel Display Application.
Liang, Xuelei; Xia, Jiye; Dong, Guodong; Tian, Boyuan; Peng, Lianmao
2016-12-01
Carbon nanotubes (CNTs) are promising materials for both high performance transistors for high speed computing and thin film transistors for macroelectronics, which can provide more functions at low cost. Among macroelectronics applications, carbon nanotube thin film transistors (CNT-TFT) are expected to be used soon for backplanes in flat panel displays (FPDs) due to their superior performance. In this paper, we review the challenges of CNT-TFT technology for FPD applications. The device performance of state-of-the-art CNT-TFTs are compared with the requirements of TFTs for FPDs. Compatibility of the fabrication processes of CNT-TFTs and current TFT technologies are critically examined. Though CNT-TFT technology is not yet ready for backplane production line of FPDs, the challenges can be overcome by close collaboration between research institutes and FPD manufacturers in the short term.
Lacoste, Deanna
2016-06-23
The responses of laminar methane-air flames to forcing by acoustic waves, AC electric fields, and nanosecond repetitively pulsed (NRP) glow discharges are reported here. The experimental setup consists of an axisymmetric burner with a nozzle made from a quartz tube. Three different flame geometries have been studied: conical, M-shaped and V-shaped flames. A central stainless steel rod is used as a cathode for the electric field and plasma excitations. The acoustic forcing is obtained with a loudspeaker located at the bottom part of the burner. For forcing by AC electric fields, a metallic grid is placed above the rod and connected to an AC power supply. Plasma forcing is obtained by applying high-voltage pulses of 10-ns duration applied at 10 kHz, between the rod and an annular stainless steel ring, placed at the outlet of the quartz tube. The chemiluminescence of CH is used to determine the heat release rate fluctuations. For forcing by acoustic waves and plasma, the geometry of the flame plays a key role in the response of the combustion, while the flame shape does not affect the response of the combustion to electric field forcing. The flame response to acoustic forcing of about 10% of the incoming flow is similar to those obtained in the literature. The flames are found to be responsive to an AC electric field across the whole range of frequencies studied. A forcing mechanism, based on the generation of ionic wind, is proposed. The gain of the transfer function obtained for plasma forcing is found to be up to 5 times higher than for acoustic forcing. A possible mechanism of plasma forcing is introduced.
Lacoste, Deanna; Xiong, Yuan; Moeck, Jonas P.; Chung, Suk-Ho; Roberts, William L.; Cha, Min
2016-01-01
The responses of laminar methane-air flames to forcing by acoustic waves, AC electric fields, and nanosecond repetitively pulsed (NRP) glow discharges are reported here. The experimental setup consists of an axisymmetric burner with a nozzle made from a quartz tube. Three different flame geometries have been studied: conical, M-shaped and V-shaped flames. A central stainless steel rod is used as a cathode for the electric field and plasma excitations. The acoustic forcing is obtained with a loudspeaker located at the bottom part of the burner. For forcing by AC electric fields, a metallic grid is placed above the rod and connected to an AC power supply. Plasma forcing is obtained by applying high-voltage pulses of 10-ns duration applied at 10 kHz, between the rod and an annular stainless steel ring, placed at the outlet of the quartz tube. The chemiluminescence of CH is used to determine the heat release rate fluctuations. For forcing by acoustic waves and plasma, the geometry of the flame plays a key role in the response of the combustion, while the flame shape does not affect the response of the combustion to electric field forcing. The flame response to acoustic forcing of about 10% of the incoming flow is similar to those obtained in the literature. The flames are found to be responsive to an AC electric field across the whole range of frequencies studied. A forcing mechanism, based on the generation of ionic wind, is proposed. The gain of the transfer function obtained for plasma forcing is found to be up to 5 times higher than for acoustic forcing. A possible mechanism of plasma forcing is introduced.
Plasma antennas driven by 5–20 kHz AC power supply
Energy Technology Data Exchange (ETDEWEB)
Zhao, Jiansen, E-mail: 67093058@qq.com; Chen, Yuli; Sun, Yang; Wu, Huafeng; Liu, Yue; Yuan, Qiumeng [Merchant Marine College, Shanghai Maritime University, Shanghai, 201306 (China)
2015-12-15
The experiments described in this work were performed with the aim of introducing a new plasma antenna that was excited by a 5–20 kHz alternating current (AC) power supply, where the antenna was transformed into a U-shape. The results show that the impedance, voltage standing-wave ratio (VSWR), radiation pattern and gain characteristics of the antenna can be controlled rapidly by varying not only the discharge power, but also by varying the discharge frequency in the range from 5 to 20 kHz. When the discharge frequency is adjusted from 10 to 12 kHz, the gain is higher within a relatively broad frequency band and the switch-on time is less than 1 ms when the discharge power is less than 5 W, meaning that the plasma antenna can be turned on and off rapidly.
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-03-01
One of the subjects in technology supporting the highly information-oriented society which will develop and diversify toward the 21st century is the construction of high grade man/machine interface. For it, high precision/high luminance/energy saving/thin plane displays are strongly requested. This R and D is to indicate models of systematical development in the region of element technology individually existing in the Shikoku area by forming a regional consortium in the industry/universities/government. Creation of new industries by gathering display related enterprises is a first step in a plan to realize `Display Island Shikoku.` As a concrete target, with the use of high-tech diamond semiconducting technology, a development is conducted of the high performance flat panel display using the negative electron affinity (NEA) electron emitter which drastically solves the problems such as luminance, visibility angle and response speed, the subjects on the commercialized liquid crystal flat panel display. 16 refs., 45 figs., 8 tabs.
A 100-kW three-phase ac plasma furnace for spheroidization of aluminum silicate particles
International Nuclear Information System (INIS)
Gold, D.; Bonet, C.; Chauvin, G.; Geinaert, G.; Mathieu, A.C.; Millet, J.
1981-01-01
A 100-kW three-phase ac plasma furnace with sheathed copper electrodes (sheathing gas: air) is presented. It is used for spheroidizing ''chamotte'' (refractory-fired clay) particles having a smooth, pore-free surface. A simple, one-dimensional numerical model for the heat transfer to the particles explains the maximum processing rate and the detrimental influence of an inhomogeneous particle size distribution
International Nuclear Information System (INIS)
Chang, Hung-wen; Hsu, Cheng-che
2011-01-01
The effect of frequency on the characteristics of plasmas in saline solution driven by 50-1000 Hz ac power is studied. Two distinct modes, namely bubble and jetting modes, are identified. The bubble mode occurs under low frequencies. In this mode, a millimeter-sized bubble is tightly attached to the electrode tip and oscillates with the applied voltage. With an increase in frequency, it shows the jetting mode, in which bubbles, hundreds of micometers in diameter, are continuously formed and jetted away from the electrode surface. Such a significant change in the bubble behavior influences the power input at a given applied voltage and significantly affects the plasma behavior. In spite of the fact that no significant difference is seen in the optical emission spectra, the broadening of the H β peak shows that the bubble mode has a lower electron density than that of the jetting mode. The temporally resolved optical emission intensities show light emission in the negative half of the power period regardless of the modes. This shows clearly that the driving frequency significantly influences the bubble dynamics, which in turn alters the plasma behavior.
Chan, Alan H S; Hoffmann, Errol R
2015-01-01
Two experiments are reported that were designed to investigate control/display arrangements having high stereotype strengths when using circular displays. Eight display locations relative to the operator and control were tested with rotational and translational controls situated on different planes according to the Frame of Reference Transformation Tool (FORT) model of Wickens et al. (2010). (Left. No, Right! Development of the Frame of Reference Transformation Tool (FORT), Proceedings of the Human Factors and Ergonomics Society 54th Annual Meeting, 54: 1022-1026). In many cases, there was little effect of display locations, indicating the importance of the Worringham and Beringer (1998. Directional stimulus-response compatibility: a test of three alternative principles. Ergonomics, 41(6), 864-880) Visual Field principle and an extension of this principle for rotary controls (Hoffmann and Chan (2013). The Worringham and Beringer 'visual field' principle for rotary controls. Ergonomics, 56(10), 1620-1624). The initial indicator position (12, 3, 6 and 9 o'clock) had a major effect on control/display stereotype strength for many of the six controls tested. Best display/control arrangements are listed for each of the different control types (rotational and translational) and for the planes on which they are mounted. Data have application where a circular display is used due to limited display panel space and applies to space-craft, robotics operators, hospital equipment and home appliances. Practitioner Summary: Circular displays are often used when there is limited space available on a control panel. Display/control arrangements having high stereotype strength are listed for four initial indicator positions. These arrangements are best for design purposes.
Directory of Open Access Journals (Sweden)
I. O. Zharinov
2016-03-01
Full Text Available Subject of Research.We consider the problem of evaluation of chromaticity coordinates shift for image displayed on liquid crystal panels with various properties on color reproduction. A mathematical model represents the color reproduction characteristics. The spread of the color characteristics of the screens has a statistical nature. Differences of color reproduction for screens are perceived by the observer in the form of different colors and shades that are displayed on the same type of commercially available screens. Color differences are characterized by numerical measure of the difference of colors and can be mathematically compensated. The solution of accounting problem of the statistical nature of the color characteristics spread for the screens has a particular relevance to aviation instrumentation. Method. Evaluation of chromaticity coordinates shift of the image is based on the application of the Grassmann laws of color mixing.Basic data for quantitative calculation of shift are the profiles of two different liquid crystal panels defined by matrixes of scales for components of primary colors (red, green, blue. The calculation is based on solving the system of equations and calculating the color difference in the XY-plane. In general, the calculation can be performed in other color spaces: UV, Lab. The statistical nature of the spread of the color characteristics for the screens is accounted for in the proposed mathematical model based on the interval setting of coordinate values of the color gamut triangle vertices on the set of commercially available samples. Main Results. Carried outresearches result in the mathematical expressions allowing to recalculate values of chromaticity coordinates of the image displayed on various samples of liquid crystal screens. It is shown that the spread of the color characteristics of the screens follows bivariate normal distribution law with the accuracy sufficient for practice. The results of
A flexible software design to determine the plasma boundary in Damavand tokamak
International Nuclear Information System (INIS)
Ghadiri, R.; Esteki, M.H.; Sadeghi, Y.
2014-01-01
A plasma boundary reconstruction code has been designed by using current filament method to calculate the magnetic flux and consequently plasma boundary in Damavand tokamak. Hence, a computer-based code “The Plasma Boundary Reconstruction Code in Tokamak (PBRCT)” was developed to make a graphical user interface and to speed up the plasma boundary estimation algorithm. All required tools as the plasma boundary and magnetic surface display (MSD), error display, primary conditions and modeling panel as well as a search motor to determine a good position and number of the current filaments to find a precise model have been considered. The core is a 3000 lines Matlab code and the graphical user interface is 10,000 lines in C language. (author)
Oil defect detection of electrowetting display
Chiang, Hou-Chi; Tsai, Yu-Hsiang; Yan, Yung-Jhe; Huang, Ting-Wei; Mang, Ou-Yang
2015-08-01
In recent years, transparent display is an emerging topic in display technologies. Apply in many fields just like mobile device, shopping or advertising window, and etc. Electrowetting Display (EWD) is one kind of potential transparent display technology advantages of high transmittance, fast response time, high contrast and rich color with pigment based oil system. In mass production process of Electrowetting Display, oil defects should be found by Automated Optical Inspection (AOI) detection system. It is useful in determination of panel defects for quality control. According to the research of our group, we proposed a mechanism of AOI detection system detecting the different kinds of oil defects. This mechanism can detect different kinds of oil defect caused by oil overflow or material deteriorated after oil coating or driving. We had experiment our mechanism with a 6-inch Electrowetting Display panel from ITRI, using an Epson V750 scanner with 1200 dpi resolution. Two AOI algorithms were developed, which were high speed method and high precision method. In high precision method, oil jumping or non-recovered can be detected successfully. This mechanism of AOI detection system can be used to evaluate the oil uniformity in EWD panel process. In the future, our AOI detection system can be used in quality control of panel manufacturing for mass production.
Comparing Ns-DBD vs Ac-DBD plasma actuation mechanisms on a NACA 0012 airfoil
Singh, Ashish; Durasiewicz, Claudia; Little, Jesse
2017-11-01
A NACA 0012 airfoil is used to study ns-DBD and ac-DBD plasma actuators at a Reynolds number of 740,000 (U∞=40 m/s). Ns-DBD plasma actuators are hypothesized to work on the principle of joule heating whereas ac-DBD actuators add momentum to the flow. Short duration forcing at a time scale much smaller than the convective time based on model chord is employed to study the control mechanism and flow field response. 2-D PIV carried out over a convective time range of 0-10 is used to study the flow structure. The results show the breakup of shear layer vorticity at the point of actuation followed by reattachment to the suction side of the airfoil and finally stall again. These events are very similar between the two actuators and indicate a similar flow response to different perturbation types. The pulse energies are varied and the response shows little change. The results are compared to other transitory separation control studies using more conventional actuators. The detailed study of these two control mechanisms with the separated flow over an airfoil helps to shed light on the evolution of the flow control process. Additional results on a simplified model problem (low speed mixing layer) are included to provide context. Supported by U.S. Army Research Office (W911NF-14-1-0662).
Energy Technology Data Exchange (ETDEWEB)
Sato, M; Kikuchi, S; Tani, T [Science University of Tokyo, Tokyo (Japan); Kadotani, K; Imaizumi, H [Komatsu Ltd., Tokyo (Japan)
1996-10-27
The composite panel with photovoltaic-thermo module becomes higher in energy-saving than the conventional air-conditioning system by the independent radiational heating and cooling effect obtained when the generating panel using a solar cell module is combined with the heating and cooling panel using a thermo-element module. The output of a solar cell module can be directly used because the solar cell module operates in AC. This paper reports the relation between the absorbed value and power consumption of the cooling panel, while paying attention to the cooling panel. The performance coefficient of the maximum absorbed value from an non-absorbing substance to a cooling panel is 2 to 3. Assume that the cooling panel during non-adiabatic operation is operated using a solar cell module of 800 W/m{sup 2} in solar intensity and 15% in conversion efficiency. The cooling-surface temperature difference is 12.12 K, and the maximum absorbed value of a non-absorbing substance to a cooling panel is 39.12 W/m{sup 2}. The absorbed value of the outer temperature to the cooling panel is 74.4 W/m{sup 2}, and each performance coefficient is 3.26 and 0.62. The absorbed value must be calculated for evaluation from the cooling-surface temperature difference measured directly from the cooling panel. 4 refs., 8 figs., 1 tab.
Kim, S G
1999-01-01
MgO thin films were deposited on SiO sub 2 (100) substrates by using electrostatic spray pyrolysis and Mg(tmhd) sub 2 as the precursor. The growth rates of the films varyed from 34 to 87 A/min and were measured for various substrate and guide temperatures. X-ray diffraction analysis provide evidence that the MgO films deposited at temperatures as low as 400 approx 500 .deg. C had preferred orientation to (100) plane perpendicular to the substrate surface. X-ray photoelectron spectroscopy and Auger electron spectroscopy data indicated that there were few organics incorporated in the films.
International Nuclear Information System (INIS)
Son, Dang Ngoc; Van Duy, Nguyen; Jung, Sungwook; Yi, Junsin
2010-01-01
Nonvolatile memory (NVM) devices with a nitride–nitride–oxynitride stack structure on a rough poly-silicon (poly-Si) surface were fabricated using a low-temperature poly-Si (LTPS) thin film transistor technology on glass substrates for application of flat panel display (FPD). The plasma-assisted oxidation/nitridation method is used to form a uniform oxynitride with an ultrathin tunneling layer on a rough LTPS surface. The NVMs, using a Si-rich silicon nitride film as a charge-trapping layer, were proposed as one of the solutions for the improvement of device performance such as the program/erase speed, the memory window and the charge retention characteristics. To further improve the vertical scaling and charge retention characteristics of NVM devices, the high-κ high-density N-rich SiN x films are used as a blocking layer. The fabricated NVM devices have outstanding electrical properties, such as a low threshold voltage, a high ON/OFF current ratio, a low subthreshold swing, a low operating voltage of less than ±9 V and a large memory window of 3.7 V, which remained about 1.9 V over a period of 10 years. These characteristics are suitable for electrical switching and data storage with in FPD application
DC response of dust to low frequency AC signals
McKinlay, Michael; Konopka, Uwe; Thomas, Edward
2017-10-01
Macroscopic changes in the shape and equilibrium position of clouds of charged microparticles suspended in a plasma have been observed in response to low frequency AC signals. In these experiments, dusty plasmas consisting of 2-micron diameter silica microspheres suspended between an anode and cathode in an argon, DC glow discharge plasma are produced in a grounded, 6-way cross vacuum chamber. An AC signal, produced by a function generator and amplified by a bipolar op-amp, is superimposed onto the potential from the cathode. The frequencies of the applied AC signals, ranging from tens to hundreds of kHz, are comparable to the ion-neutral collision frequency; well below the ion/electron plasma frequencies, but also considerably higher than the dust plasma frequency. This presentation will detail the experimental setup, present documentation and categorization of observations of the dust response, and present an initial model of the response. This work is supported by funding from the US Dept. of Energy, Grant Number DE-SC0016330, and by the National Science Foundation, Grant Number PHY-1613087.
Wang, Ruixue; Chen, Ya; Xu, Zhenming
2015-05-19
Waste liquid crystal display (LCD) panels mainly contain inorganic materials (glass substrate) and organic materials (polarizing film and liquid crystal). The organic materials should be removed first since containing polarizing film and liquid crystal is to the disadvantage of the indium recycling process. In the present study, an efficient and environmentally friendly process to obtain acetic acid from waste LCD panels by sub/supercritical water treatments is investigated. Furthermore, a well-founded reaction mechanism is proposed. Several highlights of this study are summarized as follows: (i) 99.77% of organic matters are removed, which means the present technology is quite efficient to recycle the organic matters; (ii) a yield of 78.23% acetic acid, a quite important fossil energy based chemical product is obtained, which can reduce the consumption of fossil energy for producing acetic acid; (iii) supercritical water acts as an ideal solvent, a requisite reactant as well as an efficient acid-base catalyst, and this is quite significant in accordance with the "Principles of Green Chemistry". In a word, the organic matters of waste LCD panels are recycled without environmental pollution. Meanwhile, this study provides new opportunities for alternating fossil-based chemical products for sustainable development, converting "waste" into "fossil-based chemicals".
IEEE conference record -- Abstracts: 1996 IEEE international conference on plasma science
International Nuclear Information System (INIS)
Anon.
1996-01-01
This meeting covered the following topics: space plasmas; non-equilibrium plasma processing; computer simulation of vacuum power tubes; vacuum microelectronics; microwave systems; basic phenomena in partially ionized gases -- gaseous electronics, electrical discharges; ball lightning/spherical plasma configuration; plasma diagnostics; plasmas for lighting; dense plasma focus; intense ion and electron beams; plasma, ion, and electron sources; flat panel displays; fast z-pinches and x-ray lasers; environmental/energy issues in plasma science; thermal plasma processing; computational plasma physics; magnetic confinement fusion; microwave-plasma interactions; space plasma engineering; EM and ETH launchers; fast wave devices; intense beam microwaves; slow wave devices; space plasma measurements; basic phenomena in fully ionized plasma -- waves, instabilities, plasma theory, etc; plasma closing switches; fast opening switches; and laser-produced plasma. Separate abstracts were prepared for most papers in this conference
Autostereoscopic display technology for mobile 3DTV applications
Harrold, Jonathan; Woodgate, Graham J.
2007-02-01
Mobile TV is now a commercial reality, and an opportunity exists for the first mass market 3DTV products based on cell phone platforms with switchable 2D/3D autostereoscopic displays. Compared to conventional cell phones, TV phones need to operate for extended periods of time with the display running at full brightness, so the efficiency of the 3D optical system is key. The desire for increased viewing freedom to provide greater viewing comfort can be met by increasing the number of views presented. A four view lenticular display will have a brightness five times greater than the equivalent parallax barrier display. Therefore, lenticular displays are very strong candidates for cell phone 3DTV. Selection of Polarisation Activated Microlens TM architectures for LCD, OLED and reflective display applications is described. The technology delivers significant advantages especially for high pixel density panels and optimises device ruggedness while maintaining display brightness. A significant manufacturing breakthrough is described, enabling switchable microlenses to be fabricated using a simple coating process, which is also readily scalable to large TV panels. The 3D image performance of candidate 3DTV panels will also be compared using autostereoscopic display optical output simulations.
Electromagnetic effects in high-frequency capacitive discharges used for plasma processing
International Nuclear Information System (INIS)
Chabert, P
2007-01-01
In plasma processing, capacitive discharges have classically been operated in the electrostatic regime, for which the excitation wavelength λ is much greater than the electrode radius, and the plasma skin depth δ is much greater than the electrode spacing. However, contemporary reactors are larger and excited at higher frequencies which leads to strong electromagnetic effects. This paper gives a review of the work that has recently been carried out to carefully model and diagnose these effects, which cause major uniformity problems in plasma processing for microelectronics and flat panel displays industries. (topical review)
Combat vehicle crew helmet-mounted display: next generation high-resolution head-mounted display
Nelson, Scott A.
1994-06-01
The Combat Vehicle Crew Head-Mounted Display (CVC HMD) program is an ARPA-funded, US Army Natick Research, Development, and Engineering Center monitored effort to develop a high resolution, flat panel HMD for the M1 A2 Abrams main battle tank. CVC HMD is part of the ARPA High Definition Systems (HDS) thrust to develop and integrate small (24 micrometers square pels), high resolution (1280 X 1024 X 6-bit grey scale at 60 frame/sec) active matrix electroluminescent (AMEL) and active matrix liquid crystal displays (AMLCD) for head mounted and projection applications. The Honeywell designed CVC HMD is a next generation head-mounted display system that includes advanced flat panel image sources, advanced digital display driver electronics, high speed (> 1 Gbps) digital interconnect electronics, and light weight, high performance optical and mechanical designs. The resulting dramatic improvements in size, weight, power, and cost have already led to program spin offs for both military and commercial applications.
Polar solar panels: Arctic and Antarctic microbiomes display similar taxonomic profiles.
Tanner, Kristie; Martí, Jose Manuel; Belliure, Josabel; Fernández-Méndez, Mar; Molina-Menor, Esther; Peretó, Juli; Porcar, Manuel
2018-02-01
Solar panels located on high (Arctic and Antarctic) latitudes combine the harshness of the climate with that of the solar exposure. We report here that these polar solar panels are inhabited by similar microbial communities in taxonomic terms, dominated by Hymenobacter spp., Sphingomonas spp. and Ascomycota. Our results suggest that solar panels, even on high latitudes, can shape a microbial ecosystem adapted to irradiation and desiccation. © 2017 Society for Applied Microbiology and John Wiley & Sons Ltd.
Dc to ac field conversion due to leaky-wave excitation in a plasma slab behind an ionization front
International Nuclear Information System (INIS)
Kostin, V A; Vvedenskii, N V
2015-01-01
We present a way for generating coherent tunable electromagnetic radiation through dc to ac field conversion by an ionization front. The conversion is caused by the excitation of leaky waves behind the transversely limited ionization front propagating in a uniform electrostatic field. This differs significantly from the well-known dc-to-ac-radiation-converter models which consider Doppler-like frequency conversion by a transversely unlimited ionization front propagating in a spatially periodic electric field. We explore the dispersion properties and excitation of these leaky waves radiated through the transverse plasma boundary at the Cherenkov angle to the direction of propagation of a superluminal ionization front as dependent on the parameters of the plasma produced and on the speed of the ionization front. It is shown that not only the center frequency but also the duration and waveform of the generated pulse may significantly depend on the speed of the ionization front. The results indicate the possibility of using such converters based on planar photoconductive antennas to create sources of microwave and terahertz radiation with controllable waveforms that are transformed from video to radio pulse when the angle of incident ionizing radiation is tuned. (paper)
Projection display technology for avionics applications
Kalmanash, Michael H.; Tompkins, Richard D.
2000-08-01
Avionics displays often require custom image sources tailored to demanding program needs. Flat panel devices are attractive for cockpit installations, however recent history has shown that it is not possible to sustain a business manufacturing custom flat panels in small volume specialty runs. As the number of suppliers willing to undertake this effort shrinks, avionics programs unable to utilize commercial-off-the-shelf (COTS) flat panels are placed in serious jeopardy. Rear projection technology offers a new paradigm, enabling compact systems to be tailored to specific platform needs while using a complement of COTS components. Projection displays enable improved performance, lower cost and shorter development cycles based on inter-program commonality and the wide use of commercial components. This paper reviews the promise and challenges of projection technology and provides an overview of Kaiser Electronics' efforts in developing advanced avionics displays using this approach.
Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters
DEFF Research Database (Denmark)
Qin, Zian
. The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...
Foundations of atmospheric pressure non-equilibrium plasmas
Bruggeman, Peter J.; Iza, Felipe; Brandenburg, Ronny
2017-12-01
Non-equilibrium plasmas have been intensively studied over the past century in the context of material processing, environmental remediation, ozone generation, excimer lamps and plasma display panels. Research on atmospheric pressure non-equilibrium plasmas intensified over the last two decades leading to a large variety of plasma sources that have been developed for an extended application range including chemical conversion, medicine, chemical analysis and disinfection. The fundamental understanding of these discharges is emerging but there remain a lot of unexplained phenomena in these intrinsically complex plasmas. The properties of non-equilibrium plasmas at atmospheric pressure span over a huge range of electron densities as well as heavy particle and electron temperatures. This paper provides an overview of the key underlying processes that are important for the generation and stabilization of atmospheric pressure non-equilibrium plasmas. The unique physical and chemical properties of theses discharges are also summarized.
Energy Technology Data Exchange (ETDEWEB)
Ma, En; Xu, Zhenming, E-mail: zmxu@sjtu.edu.cn
2013-12-15
Highlights: • The vacuum pyrolysis–vacuum chlorinated separation system was proposed to recover the waste LCD panel. • The system can recycle the whole waste LCD panels efficiently without negative effects to environment. • The 82.03% of the organic materials was reclaimed. All pyrolysis products can be utilized by a reasonable way. • The separation of indium was optimized by the central composite design (CCD) under response surface methodology (RSM). • The recovery ratio of indium was further increased to 99.97%. -- Abstract: In this study, a technology process including vacuum pyrolysis and vacuum chlorinated separation was proposed to convert waste liquid crystal display (LCD) panels into useful resources using self-design apparatuses. The suitable pyrolysis temperature and pressure are determined as 300 °C and 50 Pa at first. The organic parts of the panels were converted to oil (79.10 wt%) and gas (2.93 wt%). Then the technology of separating indium was optimized by central composite design (CCD) under response surface methodology (RSM). The results indicated the indium recovery ratio was 99.97% when the particle size is less than 0.16 mm, the weight percentage of NH{sub 4}Cl to glass powder is 50 wt% and temperature is 450 °C. The research results show that the organic materials, indium and glass of LCD panel can be recovered during the recovery process efficiently and eco-friendly.
Scalable Resolution Display Walls
Leigh, Jason; Johnson, Andrew; Renambot, Luc; Peterka, Tom; Jeong, Byungil; Sandin, Daniel J.; Talandis, Jonas; Jagodic, Ratko; Nam, Sungwon; Hur, Hyejung; Sun, Yiwen
2013-01-01
This article will describe the progress since 2000 on research and development in 2-D and 3-D scalable resolution display walls that are built from tiling individual lower resolution flat panel displays. The article will describe approaches and trends in display hardware construction, middleware architecture, and user-interaction design. The article will also highlight examples of use cases and the benefits the technology has brought to their respective disciplines. © 1963-2012 IEEE.
Chabert, P.
2007-02-01
In plasma processing, capacitive discharges have classically been operated in the electrostatic regime, for which the excitation wavelength λ is much greater than the electrode radius, and the plasma skin depth δ is much greater than the electrode spacing. However, contemporary reactors are larger and excited at higher frequencies which leads to strong electromagnetic effects. This paper gives a review of the work that has recently been carried out to carefully model and diagnose these effects, which cause major uniformity problems in plasma processing for microelectronics and flat panel displays industries.
A computer graphics display technique for the examination of aircraft design data
Talcott, N. A., Jr.
1981-01-01
An interactive computer graphics technique has been developed for quickly sorting and interpreting large amounts of aerodynamic data. It utilizes a graphic representation rather than numbers. The geometry package represents the vehicle as a set of panels. These panels are ordered in groups of ascending values (e.g., equilibrium temperatures). The groups are then displayed successively on a CRT building up to the complete vehicle. A zoom feature allows for displaying only the panels with values between certain limits. The addition of color allows a one-time display thus eliminating the need for a display build up.
International Nuclear Information System (INIS)
Kim, J. S.; Kwon, B. S.; Heo, W.; Jung, C. R.; Park, J. S.; Shon, J. W.; Lee, N.-E.
2010-01-01
A multilevel resist (MLR) structure can be fabricated based on a very thin amorphous carbon (a-C) layer ( congruent with 80 nm) and Si 3 N 4 hard-mask layer ( congruent with 300 nm). The authors investigated the selective etching of the Si 3 N 4 layer using a physical-vapor-deposited (PVD) a-C mask in a dual-frequency superimposed capacitively coupled plasma etcher by varying the process parameters in the CH 2 F 2 /H 2 /Ar plasmas, viz., the etch gas flow ratio, high-frequency source power (P HF ), and low-frequency source power (P LF ). They found that under certain etch conditions they obtain infinitely high etch selectivities of the Si 3 N 4 layers to the PVD a-C on both the blanket and patterned wafers. The etch gas flow ratio played a critical role in determining the process window for infinitely high Si 3 N 4 /PVD a-C etch selectivity because of the change in the degree of polymerization. The etch results of a patterned ArF photoresisit/bottom antireflective coating/SiO x /PVD a-C/Si 3 N 4 MLR structure supported the idea of using a very thin PVD a-C layer as an etch-mask layer for the Si 3 N 4 hard-mask pattern with a pattern width of congruent with 80 nm and high aspect ratio of congruent with 5.
First results with a microcavity plasma panel detector
Energy Technology Data Exchange (ETDEWEB)
Ball, R. [University of Michigan, Department of Physics, Ann Arbor, MI 48109 (United States); Ben-Moshe, M.; Benhammou, Y.; Bensimon, R. [Tel Aviv University, School of Physics and Astronomy, Tel Aviv (Israel); Chapman, J.W. [University of Michigan, Department of Physics, Ann Arbor, MI 48109 (United States); Davies, M.; Etzion, E. [Tel Aviv University, School of Physics and Astronomy, Tel Aviv (Israel); Ferretti, C., E-mail: claudiof@umich.edu [University of Michigan, Department of Physics, Ann Arbor, MI 48109 (United States); Friedman, P.S. [Integrated Sensors, LLC, Ottawa Hills, OH 43606 (United States); Levin, D.S. [University of Michigan, Department of Physics, Ann Arbor, MI 48109 (United States); Silver, Y. [Tel Aviv University, School of Physics and Astronomy, Tel Aviv (Israel); Varner, R.L. [Oak Ridge National Laboratory, Physics Division, Oak Ridge, TN 737831 (United States); Weaverdyck, C.; Zhou, B. [University of Michigan, Department of Physics, Ann Arbor, MI 48109 (United States)
2015-06-01
A new type of gaseous micropattern particle detector based on a closed-cell microcavity plasma panel sensor is reported. The first device was fabricated with 1×1×2 mm cells. It has shown very clean signals of 0.6–2.5 V amplitude, fast rise time of approximately 2 ns and FWHM of about 2 ns with very uniform signal shapes across all pixels. From initial measurements with β particles from a radioactive source, a maximum pixel efficiency greater than 95% is calculated, for operation of the detector over a 100 V wide span of high voltages (HV). Over this same HV range, the background rate per pixel was measured to be 3–4 orders of magnitude lower than the rate with which the cell was illuminated by the β source. Pixel-to-pixel count rate uniformity is within 3% and stable within 3% for many days. The time resolution is 2.4 ns, and a very low cell-to-cell crosstalk has been measured between cells separated by 2 mm.
Bending Characteristics of Foldable Touch Display Panel with a Protection Structure Design
Directory of Open Access Journals (Sweden)
Hsien-Chie Cheng
2015-01-01
Full Text Available The study proposes and demonstrates an enhancement of a touch display panel (TDP through a polymer-based protection structure to achieve higher bendability and reliability. The bending performance of the TDP without or with the protection structure designs is addressed using three-dimensional geometry-nonlinear finite element analysis and mechanical testing. The elastic properties of the components in the TDP structure are derived from nanoindentation and uniaxial tensile/compressive testing. The calculated results are compared with each other and also against the experimental bending fatigue test data. At last, a design guideline and optimal factor setting for enhanced bending performance are sought through parametric FE analysis and Taguchi experimental design, respectively. The optimal design is compared with the original in terms of bending stress. The simulation results show that bending would create significant tensile and compressive bending stresses on the indium tin oxide/dielectric layers, which are the main cause of several commonly observed failures, such as thin film cracking and delamination, in a thin rigid film coating on a thick compliant substrate. It also turns out that a substrate with a lower stiffness has a better mechanical stability against bending stress.
Layout of 'hard' and 'soft' control panels
International Nuclear Information System (INIS)
Schulz, K.A.
1984-01-01
Large control panels, containing hundreds of indicators and controls, have long been used in process plants. The general arrangement of instruments on the panel should reflect ergonomic principles to help operators to quickly and accurately locate, identify and select controls and displays as they monitor and supervise plant systems and processes. For the multiplexed systems now displacing dedicated components, there is a corresponding set of design problems involving display-page formats and the design of display ensembles. A list of alternative organizing principles is presented, with particular emphasis on those based on plant function. Methodologies for selecting and applying the principles are discussed
Lee, Inseok; Hwang, Won-Gue
2015-01-01
A survey was conducted to examine how personal experiences affect the interpretation of the meaning of display and control colours on electric control panels (ECPs). In Korea, the red light on ECPs represents a normal state of operation, while the green light represents a stopped state of operation; this appears to contradict the general stereotypes surrounding these colours. The survey results indicated that the participants who had experience in using ECPs interpreted the colour meaning differently from the other participant group. More than half of the experienced participants regarded the coloured displays and controls as they were designed, while most participants in the other group appeared to interpret the colours in accordance with the stereotypes. It is presumed that accidents related to human errors can occur when non-experienced people use the ECPs, which are easily accessible in many buildings. Practitioner Summary: A survey was conducted to investigate how personal experiences affect the interpretation of the function meanings of coloured lights on electrical control panels. It was found that the interpretation varies according to personal experiences, which can induce accidents related to human errors while operating electrical equipment.
A virtual control panel configuration tool for the X-Window system
International Nuclear Information System (INIS)
Hill, J.O.; Dalesio, L.R.; Kerstiens, D.M.
1992-01-01
Computer Graphics Workstations are becoming increasingly popular for use as virtual process control and read back panels. The workstation's CRT, keyboard, and pointing device are used in concert to produce a display that is in essence a control panel, even if actual switches and gauges are not present. The code behind these displays is most often specific to one display and not reusable for any other display. Recently, programs have been written allowing many of these virtual control panel displays to be configured without writing additional code. This approach allows the initial programming effort to be reapplied to many different display instances with minimal effort. These programs often incorporate many of the features of a graphics editor, allowing a pictorial model of the process under control to be incorporated into the control panel. We have just finished writing a second generation software system of this type for use with the X-window system and the Experimental Physics and Industrial Control System (EPICS). This paper describes the primary features of our software, the framework of our design, and our observations after initial installation. (author)
OLED Luminaire with Panel Integrated Drivers and Advanced Controls
Energy Technology Data Exchange (ETDEWEB)
Lu, Michael [Acuity Brands Lighting, Inc., Atlanta, GA (United States); Spindler, Jeff [OLEDWorks, Rochester, NY (United States)
2017-01-31
For this DOE award, Acuity Brands Lighting developed a novel OLED luminaire system featuring panel-integrated drivers at each individual OLED panel. The luminaire has a base station that receives user commands and performs AC/DC conversion. A power line communication (PLC) protocol is used to provide both power and digital control to each panel. A 66-panel CanvisTM luminaire using state-of-art OLED panels based on this system was successfully constructed. This is a first demonstration of such a luminaire architecture. It is also the first known implementation of this number of independently addressable nodes with a PLC protocol. This luminaire system architecture has added benefits in the flexibility of using multiple panel vendors for a given product, forward compatibility with future panels, and reduced luminaire wiring complexity and assembly time.
Characterizing the reflectivity of handheld display devices.
Liu, Peter; Badano, Aldo
2014-08-01
With increased use of handheld and tablet display devices for viewing medical images, methods for consistently measuring reflectivity of the devices are needed. In this note, the authors report on the characterization of diffuse reflections for handheld display devices including mobile phones and tablets using methods recommended by the American Association of Physicists in Medicine Task Group 18 (TG18). The authors modified the diffuse reflectance coefficient measurement method outlined in the TG18 report. The authors measured seven handheld display devices (two phones and five tablets) and three workstation displays. The device was attached to a black panel with Velcro. To study the effect of the back surface on the diffuse reflectance coefficient, the authors created Styrofoam masks with different size square openings and placed it in front of the device. Overall, for each display device, measurements of illuminance and reflected luminance on the display screen were taken. The authors measured with no mask, with masks of varying size, and with display-size masks, and calculated the corresponding diffuse reflectance coefficient. For all handhelds, the diffuse reflectance coefficient measured with no back panel were lower than measurements performed with a mask. The authors found an overall increase in reflectivity as the size of the mask decreases. For workstations displays, diffuse reflectance coefficients were higher when no back panel was used, and higher than with masks. In all cases, as luminance increased, illuminance increased, but not at the same rate. Since the size of handheld displays is smaller than that of workstation devices, the TG18 method suffers from a dependency on illumination condition. The authors show that the diffuse reflection coefficients can vary depending on the nature of the back surface of the illuminating box. The variability in the diffuse coefficient can be as large as 20% depending on the size of the mask. For all measurements
Directory of Open Access Journals (Sweden)
Seraina Cooksley-Decasper
Full Text Available To date, no plaque-derived blood biomarker is available to allow diagnosis, prognosis or monitoring of atherosclerotic vascular diseases. In this study, specimens of thrombendarterectomy material from carotid and iliac arteries were incubated in protein-free medium to obtain plaque and control secretomes for subsequent subtractive phage display. The selection of nine plaque secretome-specific antibodies and the analysis of their immunopurified antigens by mass spectrometry led to the identification of 22 proteins. One of them, junction plakoglobin (JUP-81 and its smaller isoforms (referred to as JUP-63, JUP-55 and JUP-30 by molecular weight were confirmed by immunohistochemistry and immunoblotting with independent antibodies to be present in atherosclerotic plaques and their secretomes, coronary thrombi of patients with acute coronary syndrome (ACS and macrophages differentiated from peripheral blood monocytes as well as macrophage-like cells differentiated from THP1 cells. Plasma of patients with stable coronary artery disease (CAD (n = 15 and ACS (n = 11 contained JUP-81 at more than 2- and 14-fold higher median concentrations, respectively, than plasma of CAD-free individuals (n = 13. In conclusion, this proof of principle study identified and verified JUP isoforms as potential plasma biomarkers for atherosclerosis. Clinical validation studies are needed to determine its diagnostic efficacy and clinical utility as a biomarker for diagnosis, prognosis or monitoring of atherosclerotic vascular diseases.
Design study of an AC power supply system in JT-60SA
International Nuclear Information System (INIS)
Shimada, Katsuhiro; Baulaigue, Olivier; Cara, Philippe; Coletti, Alberto; Coletti, Roberto; Matsukawa, Makoto; Terakado, Tsunehisa; Yamauchi, Kunihito
2011-01-01
In the initial research phase of JT-60SA, which is the International Thermonuclear Experimental Reactor (ITER) satellite Tokamak with superconducting toroidal and poloidal magnetic field coils, the plasma heating operation of 30 MW-60 s or 20 MW-100 s is planned for 5.5 MA single null divertor plasmas. To achieve this operation, AC power source of the medium voltage of 18 kV and ∼7 GJ has to be provided in total to the poloidal field coil power supplies and additional heating devices such as neutral beam injection (NBI) and electron cyclotron radio frequency (ECRF). In this paper, the proposed AC power supply system in JT-60SA was estimated from the view point of available power, and harmonic currents based on the standard plasma operation scenario during the initial research phase. This AC power supply system consists of the reused JT-60 power supply facilities including motor generators with flywheel, AC breakers, harmonic filters, etc., to make it cost effective. In addition, the conceptual design of the upgraded AC power supply system for the ultimate heating power of 41 MW-100 s in the extended research phase is also described.
[Survival properties of ETEC surface-displayed K88ac-LT(B) on Lactobacillus casei].
Wei, Chunhua; Liu, Jiankui; Hou, Xilin; Wang, Guihua; Yu, Liyun
2009-01-01
K88ac-LT(B) gene derived from pQE30-K88ac-LT(B) was cloned into the expression vector pLA and then the recombinant vector was transformed into the competent cells Lactobacillus casei 525. The recombinant bacteria were grown at 37 degrees C, in MRS broth. Western blotting analysis with rabbit-anti-K88ac-LT(B) polyclonal serum indicated that the recombinant protein reacted with the specific antibodies. The results showed that the molecular weight of the recombinant protein was about 71.2 kD. The K88ac-LT(B) fusion protein on the cell surface was confirmed by immunofluorescence mciroscopy and flow cytometric analysis. In addition, the survival of recombinant Lactobacillus casei 525 was studied in imitative gastrointestinal environments such as artificial gastro fluid (pH 1.5-5.5), artificial intestinal fluid, bile(0.3-3.0 g/L). The results indicated that the recombinant strain survived well in artificial gastric fluids at pH 2.5-4.5 in 5 h. The recombinant Lactobacillus casei 525 could slowly grow in the artificial intestinal fluid for different time, and could survive in 0.3% bile.
Critical issues in enhancing brightness in thin film phosphors for flat-panel display applications
International Nuclear Information System (INIS)
Singh, R.K.; Chen, Z.; Kumar, D.; Cho, K.; Ollinger, M.
2002-01-01
Thin film phosphors have potential applications in field emission flat-panel displays. However, they are limited by the lower cathodoluminescent brightness in comparison to phosphor powders. In this paper, we have investigated the critical parameters that need to be optimized to increase the brightness of phosphor thin films. Specifically, we studied the role of surface roughness and optical properties of the substrate on the brightness of the phosphor films. Thin Y 2 O 3 :Eu phosphor films were deposited on various substrates (lanthanum aluminate, quartz, sapphire, and silicon) with thicknesses varying from 50 to 500 nm. A model that accounts for diffuse and specular or scattering effects has been developed to understand the effects of the microstructure on the emission characteristics of the cathodoluminescent films. The results from the model show that both the optical properties of the substrate and the surface roughness of the films play a critical role in controlling the brightness of laser deposited phosphor films
Digital Display Integration Project Project Online 2.0
Bardsley, J N
1999-01-01
The electronic display industry is changing in three important ways. First, the dominance of the cathode ray tube (CRT) is being challenged by the development of flat panel displays (FPDs). This will lead to the availability of displays of higher performance, albeit at greater cost. Secondly, the analog interfaces between displays that show data and the computers that generate the data are being replaced by digital connections. Finally, a high-resolution display is becoming the most expensive component in computer system for homes and small offices. It is therefore desirable that the useful lifetime of the display extend over several years and that the electronics allows the display to be used with many different image sources. Hopefully, the necessity of having three or four large CRTs in one office to accommodate different computer operating systems or communication protocols will soon disappear. Instead, we hope to see a set of flat panels that can be switched to show several independent images from multip...
Touch panel system for control applications
International Nuclear Information System (INIS)
Crook, K.; Johnson, R.
1976-12-01
The use of finger-sensitive touch panels in association with computer-generated displays for control and monitoring of the Stanford linear accelerator is discussed. This control concept has proven to be very effective. The hardware and software aspects of the Touch Panel portion of the control system are described
Energy Technology Data Exchange (ETDEWEB)
Matsumoto, N; Harada, M; Idogaki, T [Denso Corp., Aichi (Japan)
1997-10-01
This report explores the visibility of an Electroluminescent (EL) display for automotive use. Displays for automobiles are exposed to the direct rays of the sun and forced to operate in wide temperature range. Therefore, luminous flux density by the lighting on EL display panel and operating environment temperature must be considered for the visibility evaluation. Sensory evaluation on the visibility and physical measurements such as contrast, chromaticity difference in accordance with the viewing angle change indicate that the visibility of the EL display for automobiles is advantageous over other displays. 6 refs., 11 figs., 1 tab.
International Nuclear Information System (INIS)
Yoshida, Shigeto; Kondoh, Daisuke; Arai, Eriko; Matsuoka, Hiroyuki; Seki, Chisato; Tanaka, Takao; Okada, Masaji; Ishii, Akira
2003-01-01
The display of foreign proteins on the surface of baculovirus virions has provided a tool for the analysis of protein-protein interactions and for cell-specific targeting in gene transfer applications. To evaluate the baculovirus display system as a vaccine vehicle, we have generated a recombinant baculovirus (AcNPV-CSPsurf) that displays rodent malaria Plasmodium berghei circumsporozoite protein (PbCSP) on the virion surface as a fusion protein with the major baculovirus envelope glycoprotein gp64. The PbCSP-gp64 fusion protein was incorporated and oligomerized on the virion surface and led to a 12-fold increase in the binding activity of AcNPV-CSPsurf virions to HepG2 cells. Immunization with adjuvant-free AcNPV-CSPsurf virions induced high levels of antibodies and gamma interferon-secreting cells against PbCSP and protected 60% of mice against sporozoite challenge. These data demonstrate that AcNPV-CSPsurf displays sporozoite-like PbCSP on the virion surface and possesses dual potentials as a malaria vaccine candidate and a liver-directed gene delivery vehicle
Transparent Fingerprint Sensor System for Large Flat Panel Display.
Seo, Wonkuk; Pi, Jae-Eun; Cho, Sung Haeung; Kang, Seung-Youl; Ahn, Seong-Deok; Hwang, Chi-Sun; Jeon, Ho-Sik; Kim, Jong-Uk; Lee, Myunghee
2018-01-19
In this paper, we introduce a transparent fingerprint sensing system using a thin film transistor (TFT) sensor panel, based on a self-capacitive sensing scheme. An armorphousindium gallium zinc oxide (a-IGZO) TFT sensor array and associated custom Read-Out IC (ROIC) are implemented for the system. The sensor panel has a 200 × 200 pixel array and each pixel size is as small as 50 μm × 50 μm. The ROIC uses only eight analog front-end (AFE) amplifier stages along with a successive approximation analog-to-digital converter (SAR ADC). To get the fingerprint image data from the sensor array, the ROIC senses a capacitance, which is formed by a cover glass material between a human finger and an electrode of each pixel of the sensor array. Three methods are reviewed for estimating the self-capacitance. The measurement result demonstrates that the transparent fingerprint sensor system has an ability to differentiate a human finger's ridges and valleys through the fingerprint sensor array.
Energy Technology Data Exchange (ETDEWEB)
Uchida, S.; Sugawara, H.; Ventzek, P.; Sakai, Y. [Hokkaido University, Sapporo (Japan)
1998-06-01
Xe/Ne plasmas are important for plasma display panels and VUV light sources. However, reactions between electrons and excited particles in the mixtures are so complicated that influence of the reactions on the plasma properties is not understood well. In this work, taking account of reactions through which electrons are produced, such as cumulative and Penning ionization, and of transition between excited levels, the electron and excited particle properties in Xe/Ne plasmas are calculated using the Boltzmann equation. The ionization coefficient and electron drift velocity agreed with experimental data. The influence of laser absorption in Xe/Ne plasmas on the plasma properties is also discussed. 25 refs., 15 figs.
Antioxidant capacity of plasma after red wine intake in Human
Directory of Open Access Journals (Sweden)
M. Gianmmanco
2009-01-01
Full Text Available Aim: Antioxidant effects after consumption of red wine have been investigated in several studies but results are contradictory and the difference in the plasma antioxidant capacity (AC after intake of red wine between women and men has never been studies. This work purpose is manifold: to ascertain whether red wine intake modifies the human plasma AC; to study the behaviour of plasma AC of women in comparison with men and finally to investigate on the plasma uric acid concentration and its relationships with the plasma AC after red wine intake.
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
Silver, Yiftah
We are investigating a radiation detector based on plasma display panel technology, the principal component of plasma television displays. This Plasma Panel Sensor (PPS) technology is a variant of micro-pattern gas radiation detectors. Based on the properties of existing plasma display panels, we expect eventually to be able to build a sealed array of plasma discharge gas cells to detect ionizing radiation with fast rise time of less than 10ns and high spatial resolution using a pixel pitch of less than 100 micrometer. In this thesis I shall describe our program of testing plasma display panels as detectors, including simulations, design and the first laboratory and beam studies that demonstrate the detection of cosmic ray muons, beta rays and medium energy protons. The ATLAS detector is used to search for high-mass resonances, in particular heavy neutral gauge bosons (Z') and excited states of Kaluza-Klein γ/Z bosons decaying to an electron-positron pair or a muon-antimuon pair. Results are presented based ...
Transparent Fingerprint Sensor System for Large Flat Panel Display
Directory of Open Access Journals (Sweden)
Wonkuk Seo
2018-01-01
Full Text Available In this paper, we introduce a transparent fingerprint sensing system using a thin film transistor (TFT sensor panel, based on a self-capacitive sensing scheme. An armorphousindium gallium zinc oxide (a-IGZO TFT sensor array and associated custom Read-Out IC (ROIC are implemented for the system. The sensor panel has a 200 × 200 pixel array and each pixel size is as small as 50 μm × 50 μm. The ROIC uses only eight analog front-end (AFE amplifier stages along with a successive approximation analog-to-digital converter (SAR ADC. To get the fingerprint image data from the sensor array, the ROIC senses a capacitance, which is formed by a cover glass material between a human finger and an electrode of each pixel of the sensor array. Three methods are reviewed for estimating the self-capacitance. The measurement result demonstrates that the transparent fingerprint sensor system has an ability to differentiate a human finger’s ridges and valleys through the fingerprint sensor array.
Discharge Simulation and Fabrication Process of an Aluminum Electrode and an Alumina Layer in AC-PDP
International Nuclear Information System (INIS)
Liu Qifa; Ding Guifu; Liu Chang; Wang Yan; Yan Qun
2013-01-01
A larger space PDP cell with patterned aluminum as the addressing electrode and alumina as the dielectric layer was proposed. The aluminum electrode and the alumina dielectric layer formed on the aluminum electrode were prepared separately by magnetron sputtering and anodic oxidation for plasma display panel. The properties of the aluminum electrode and the alumina dielectric layer were tested and can meet the demand of PDP application. The resistivity of the aluminum electrode is about 5 × 10 −8 Ω·m, the voltage withstanding of the alumina dielectric layer exceeds 100 V/μm and the relative permittivity is about 3.5 at 1 MHz. With this structure, the manufacturing cost of PDP could be cut and the addressing discharge formative delay is reduced by 0.67%, which is proved by PIC-MCC simulation. (plasma technology)
Energy Technology Data Exchange (ETDEWEB)
Wang, Ruixue; Xu, Zhenming, E-mail: zmxu@sjtu.edu.cn
2016-01-25
Highlights: • Pyrolysis characteristics are conducted for a better understanding of LCDs pyrolysis. • Optimum design is developed which is significant to guide the further industrial process. • Acetic acid and TPP are recycled and separated. - Abstract: Waste liquid crystal display (LCD) panels mainly contain inorganic materials (glass substrate with indium-tin oxide film), and organic materials (polarizing film and liquid crystal). The organic materials should be removed beforehand since the organic matters would hinder the indium recycling process. In the present study, pyrolysis process is used to remove the organic materials and recycle acetic as well as and triphenyl phosphate (TPP) from waste LCD panels in an environmental friendly way. Several highlights of this study are summarized as follows: (i) Pyrolysis characteristics and pyrolysis kinetics analysis are conducted which is significant to get a better understanding of the pyrolysis process. (ii) Optimum design is developed by applying Box–Behnken Design (BBD) under response surface methodology (RSM) for engineering application which is significant to guide the further industrial recycling process. The oil yield could reach 70.53 wt% and the residue rate could reach 14.05 wt% when the pyrolysis temperature is 570 °C, nitrogen flow rate is 6 L min{sup −1} and the particle size is 0.5 mm. (iii) Furthermore, acetic acid and TPP are recycled, and then separated by rotary evaporation, which could reduce the consumption of fossil energy for producing acetic acid, and be reused in electronics manufacturing industry.
International Nuclear Information System (INIS)
Wang, Ruixue; Xu, Zhenming
2016-01-01
Highlights: • Pyrolysis characteristics are conducted for a better understanding of LCDs pyrolysis. • Optimum design is developed which is significant to guide the further industrial process. • Acetic acid and TPP are recycled and separated. - Abstract: Waste liquid crystal display (LCD) panels mainly contain inorganic materials (glass substrate with indium-tin oxide film), and organic materials (polarizing film and liquid crystal). The organic materials should be removed beforehand since the organic matters would hinder the indium recycling process. In the present study, pyrolysis process is used to remove the organic materials and recycle acetic as well as and triphenyl phosphate (TPP) from waste LCD panels in an environmental friendly way. Several highlights of this study are summarized as follows: (i) Pyrolysis characteristics and pyrolysis kinetics analysis are conducted which is significant to get a better understanding of the pyrolysis process. (ii) Optimum design is developed by applying Box–Behnken Design (BBD) under response surface methodology (RSM) for engineering application which is significant to guide the further industrial recycling process. The oil yield could reach 70.53 wt% and the residue rate could reach 14.05 wt% when the pyrolysis temperature is 570 °C, nitrogen flow rate is 6 L min"−"1 and the particle size is 0.5 mm. (iii) Furthermore, acetic acid and TPP are recycled, and then separated by rotary evaporation, which could reduce the consumption of fossil energy for producing acetic acid, and be reused in electronics manufacturing industry.
Digital Display Integration Project Project Online 2.0
International Nuclear Information System (INIS)
Bardsley, J. N.
1999-01-01
The electronic display industry is changing in three important ways. First, the dominance of the cathode ray tube (CRT) is being challenged by the development of flat panel displays (FPDs). This will lead to the availability of displays of higher performance, albeit at greater cost. Secondly, the analog interfaces between displays that show data and the computers that generate the data are being replaced by digital connections. Finally, a high-resolution display is becoming the most expensive component in computer system for homes and small offices. It is therefore desirable that the useful lifetime of the display extend over several years and that the electronics allows the display to be used with many different image sources. Hopefully, the necessity of having three or four large CRTs in one office to accommodate different computer operating systems or communication protocols will soon disappear. Instead, we hope to see a set of flat panels that can be switched to show several independent images from multiple sources or a composite image from a single source. The more rapid rate of technological improvements and the higher cost of flat panel displays raise the incentive for greater planning and guidance in the acquisition and integration of high performance displays into large organizations, such as LLNL. The goal of the Digital Display Integration Project (DDIP) is to provide such support. This will be achieved through collaboration with leading suppliers of displays, communications equipment and image-processing products, and by greater exchange of information within the Laboratory. The project will start in October 1999. During the first two years (FY2000-1), the primary focus of the program will be upon: introducing displays with high information content (over 5M pixels); facilitating the transition from analog to digital interfaces; enabling data transfer from key computer platforms; incorporating optical communications to remove length restrictions on data
Controlling the Plasma-Polymerization Process of N-Vinyl-2-pyrrolidone
DEFF Research Database (Denmark)
Norrman, Kion; Winther-Jensen, Bjørn
2005-01-01
N-vinyl-2-pyrrolidone was plasma-polymerized on glass substrates using a pulsed AC plasma. Pulsed AC plasma produces a chemical surface structure different from that produced by conventional RF plasma; this is ascribed to the different power regimes used. A high degree of control over the structure...... of the chemical surface was obtained using pulsed AC plasma, as shown by ToF-SIMS. It is demonstrated how the experimental conditions to some extent control the chemical structure of the plasma-polymerized film, e.g., film thickness, density of post-plasma-polymerized oligomeric chains, and the density of intact...
Larasati, Devi
2015-01-01
The purpose of this final project is to apply the codevision AVR ATMega 8535 to process the data on the storage accumulator battery charging current from the solar panels. Value current is processed in the microcontroller is in the current detection using current sensor ACS-712. To prevent backflow from batteries to solar panels when the solar panel voltage is less than accumulator battery voltage, current flows from the solar panels through solar charge controller to the battery before. C...
International Nuclear Information System (INIS)
Tabatabaei, M K; Ghafouri fard, H; Koohsorkhi, J; Khatami, S; Mohajerzadeh, S
2011-01-01
A novel method for growing carbon nanotubes (CNTs) on glass substrates is introduced in this study. A two-stage plasma was used to achieve low-temperature and vertically aligned CNTs. Ni deposited on indium tin oxide/glass substrate was used as the catalyst and hydrogen and acetylene were used as gas feeds. In this investigation a new technique was developed to grow vertically aligned CNTs at temperatures below 400 deg. C while CNT growth by plasma-enhanced chemical vapour deposition required high temperatures. Low-temperature growth of vertically aligned CNTs was suitable for the fabrication of micro-lens and self-oriented displays on glass substrates. Also, we have reported a new configuration for CNT-based display by means of controlling the refractive index of liquid crystal around the CNT by applying a proper voltage to the top and bottom array.
Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte
International Nuclear Information System (INIS)
García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.
2016-01-01
The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.
Energy Technology Data Exchange (ETDEWEB)
Lin, Chun-Ming, E-mail: chunming@ntut.edu.tw [Department of Mechanical Engineering, National Taipei University of Technology, Taipei 10608, Taiwan (China); Lu, Chi-Hao [Department of Mechanical Engineering, National Taiwan University of Science and Technology, Taipei 10673, Taiwan (China)
2016-10-31
This study prepared high-strength low-alloy (HSLA) D6AC weldments using a plasma arc welding (PAW) process. The PAW weldments were then tempered at temperatures of 300 °C, 450 °C, and 600 °C for 1000 min. Microstructural characteristics of the weld in as-welded HSLA-D6AC, tempered D6AC, and tensile-tested D6AC were observed via optical microscopy (OM). We also investigated the hardness, tensile strength, and V-notched tensile strength (NTS) of the tempered specimens using a Vickers hardness tester and a universal testing machine. The fracture surfaces of the specimens were observed using a scanning electron microscope (SEM). Our results show that the mechanical properties and microstructural features of the HSLA weldments are strongly dependent on tempering temperature. An increase in tempering temperature led to a decrease in the hardness and tensile strength of the weldments but led to an increase in ductility. These effects can be attributed to the transformation of the microstructure and its effect on fracture characteristics. The specimens tempered at 300 °C and 450 °C failed in a ductile-brittle manner due to the presence of inter-lath austenite in the microstructure. After tempering at a higher temperature of 600 °C, martensite embrittlement did not occur, such that specimens failure was predominantly in a ductile manner. In the NTS specimens, an increase in tempering temperature led to a reduction in tensile strength due to notch embrittlement and the effects of grain boundary thickening and sliding. Our findings provide a valuable reference for the application of HSLA-D6AC steel in engineering and other fields.
Edge dependent motion blur reduction
2010-01-01
The invention relates to a method and a circuit arrangement to reduce motion blur of images shown in non-stroboscopic display devices, in particular Liquid Crystal Display Panels (LCDs). Thin Film Transistor Displays (TFTs), Color Sequential Displays. Plasma Display Panels (PDPs), Digital Micro
Negative hydrogen ion beam extraction from an AC heated cathode driven Bernas-type ion source
Energy Technology Data Exchange (ETDEWEB)
Okano, Y.; Miyamoto, N.; Kasuya, T.; Wada, M.
2015-04-08
A plasma grid structure was installed to a Bernas-type ion source used for ion implantation equipment. A negative hydrogen (H{sup −}) ion beam was extracted by an AC driven ion source by adjusting the bias to the plasma grid. The extracted electron current was reduced by positively biasing the plasma grid, while an optimum plasma grid bias voltage for negative ion beam extraction was found to be positive 3 V with respect to the arc chamber. Source operations with AC cathode heating show extraction characteristics almost identical to that with DC cathode heating, except a minute increase in H{sup −} current at higher frequency of cathode heating current.
JDDD, a state-of-the-art solution for control panel development
International Nuclear Information System (INIS)
Sombrowski, E.; Petrosyan, A.; Rehlich, K.; Schuette
2012-01-01
Software for graphical user interfaces to control systems may be developed as a rich or thin client. The thin client approach has the advantage that anyone can create and modify control system panels without specific skills in software programming. The Java DOOCS Data Display (JDDD) is based on the thin client interaction model. It provides inclusion of panel components and channel address inheritance for the creation of generic displays. Wildcard operations and regular expression filters are used to customize the graphics content at runtime, e.g. in a dynamic list component the parameters have to be painted only once in edit mode and then are automatically displayed multiple times for all available instances in run mode. This paper will describe the benefits of using JDDD for control panel design as an alternative to rich client development
Consortium for military LCD display procurement
Echols, Gregg
2002-08-01
International Display Consortium (IDC) is the joining together of display companies to combined their buying power and obtained favorable terms with a major LCD manufacturer. Consolidating the buying power and grouping the demand enables the rugged display industry of avionics, ground vehicles, and ship based display manufacturers to have unencumbered access to high performance AMLCDs while greatly reducing risk and lowering cost. With an unrestricted supply of AMLCD displays, the consortium members have total control of their risk, cost, deliveries and added value partners. Every display manufacturer desires a very close relationship with a display vender. With IDC each consortium member achieves a close relationship. Consortium members enjoy cost effective access to high performance, industry standard sized LCD panels, and modified commercial displays with 100 degree C clearing points and portrait configurations. Consortium members also enjoy proposal support, technical support and long-term support.
Performance of PV panels for solar energy conversion at the South Pole
Peeran, Syed M.
Expanding research facilities at the Amundson-Scott South pole station require increased electric power generation. Presently, electric power generation is by diesel generators using the JP8 fuel. As the station is accessible only for a short supply period during the austral summer, there are limitations upon the supply of fuel for power generation. This makes it necessary to seriously consider the use of the renewable energy sources. Although there is no sunlight for six months in the year, abundant solar energy is available during the remaining 6 months because of the clear skies, the clarity of air and the low humidity at the south pole. As the buildings at the south pole are built either without windows or with only porthole type windows, large areas on the walls and the roof are available for mounting the photovoltaic (PV) panels. In addition there is unlimited space around the station for constructing a PV panel 'farm'. In this paper four types of PV panels are evaluated; the 2-axis tracking panels, vertical 1-axis tracking panels, fixed vertical panels on the walls of buildings and mounted outdoors, and fixed horizontal panels on the roofs of the buildings. Equations are developed for the power output in KW/sq. ft and annual energy in kWh/sq. ft for each type of panel. The equations include the effects of the inclination of the sun above the horizon, the movement of the sun around the horizon, the direct, reflected and diffused components of the solar radiation, the characteristics of the solar cells and the types of dc/ac inverters used to interface the output of the cells with the existing ac power. A conceptual design of a 150-kW PV generation system suitable for the south pole is also discussed in this paper.
Efficiency enhancement of liquid crystal projection displays using light recycle technology
Wang, Y.
2002-01-01
A new technology developed at JPL using low absorption color filters with polarization and color recycle system, is able to enhance efficiency of a single panel liquid crytal display (LCD) projector to the same efficiency of a 3 panel LCD projector.
Effects of Activated Carbon Surface Property on Structure and Activity of Ru/AC Catalysts
Xu, S. K.; Li, L. M.; Guo, N. N.
2018-05-01
The activated carbon (AC) was modified by supercritical (SC) methanol, HNO3 oxidation, or HNO3 oxidation plus SC methanol, respectively. Then, the original and the modified AC were used as supports for Ru/AC catalysts prepared via the impregnation method. The results showed that the SC methanol modification decreased the content of surface acidic groups of AC. While HNO3 oxidation displayed the opposite behavior. Furthermore, the dispersion of ruthenium and the activity of catalysts were highly dependent on the content of surface acidic groups, and the SC methanol modified sample exhibited the highest activity for hydrogenation of glucose.
The future of 2D metrology for display manufacturing
Sandstrom, Tor; Wahlsten, Mikael; Park, Youngjin
2016-10-01
The race to 800 PPI and higher in mobile devices and the transition to OLED displays are driving a dramatic development of mask quality: resolution, CDU, registration, and complexity. 2D metrology for large area masks is necessary and must follow the roadmap. Driving forces in the market place point to continued development of even more dense displays. State-of-the-art metrology has proven itself capable of overlay below 40 nm and registration below 65 nm for G6 masks. Future developments include incoming and recurrent measurements of pellicalized masks at the panel maker's factory site. Standardization of coordinate systems across supplier networks is feasible. This will enable better yield and production economy for both mask and panel maker. Better distortion correction methods will give better registration on the panels and relax the flatness requirements of the mask blanks. If panels are measured together with masks and the results are used to characterize the aligners, further quality and yield improvements are possible. Possible future developments include in-cell metrology and integration with other instruments in the same platform.
Monocular display unit for 3D display with correct depth perception
Sakamoto, Kunio; Hosomi, Takashi
2009-11-01
A study of virtual-reality system has been popular and its technology has been applied to medical engineering, educational engineering, a CAD/CAM system and so on. The 3D imaging display system has two types in the presentation method; one is a 3-D display system using a special glasses and the other is the monitor system requiring no special glasses. A liquid crystal display (LCD) recently comes into common use. It is possible for this display unit to provide the same size of displaying area as the image screen on the panel. A display system requiring no special glasses is useful for a 3D TV monitor, but this system has demerit such that the size of a monitor restricts the visual field for displaying images. Thus the conventional display can show only one screen, but it is impossible to enlarge the size of a screen, for example twice. To enlarge the display area, the authors have developed an enlarging method of display area using a mirror. Our extension method enables the observers to show the virtual image plane and to enlarge a screen area twice. In the developed display unit, we made use of an image separating technique using polarized glasses, a parallax barrier or a lenticular lens screen for 3D imaging. The mirror can generate the virtual image plane and it enlarges a screen area twice. Meanwhile the 3D display system using special glasses can also display virtual images over a wide area. In this paper, we present a monocular 3D vision system with accommodation mechanism, which is useful function for perceiving depth.
Advanced and tendencies in the development of display technologies
Kompanets, I. N.
2006-06-01
Advances and key display applications are discussed. Computer, compact mobile, TV and collective large screen displays are mentioned. Flat panel displays step on CRT devices to leave them behind in 2007. Materials, active matricies and applications of bright radiative field emission and organic LED displays are developing successively and pressing other technologies to be used in photo-cameras, cellular phones, auto-cars and avionics. Progress in flexible screens can substantially extend the display design and application soon. 3D display systems are under intensive development, and laser is an important unit in some vaiants of holographic and volumetric 3D displays. Value forecast of different display markets is presented.
International Nuclear Information System (INIS)
Fukuda, Atsushi; Koshida, Kichiro; Togashi, Atsuhiko; Matsubara, Kousuke
2004-01-01
The International Electrotechnical Commission (IEC) has stipulated that medical X-ray equipment for interventional procedures must display radiation doses such as air kerma in free air at the interventional reference point and dose area product to establish radiation safety for patients (IEC 60601-2-43). However, it is necessary to estimate entrance skin dose for the patient from air kerma for an accurate risk assessment of radiation skin injury. To estimate entrance skin dose from displayed air kerma in free air at the interventional reference point, it is necessary to consider effective energy, the ratio of the mass-energy absorption coefficient for skin and air, and the backscatter factor. In addition, since automatic exposure control is installed in medical X-ray equipment with flat panel detectors, it is necessary to know the characteristics of control to estimate exposure dose. In order to calculate entrance skin dose under various conditions, we investigated clinical parameters such as tube voltage, tube current, pulse width, additional filter, and focal spot size, as functions of patient body size. We also measured the effective energy of X-ray exposure for the patient as a function of clinical parameter settings. We found that the conversion factor from air kerma in free air to entrance skin dose is about 1.4 for protection. (author)
Man-machine enhancements to existing FFTF control panels
International Nuclear Information System (INIS)
Miller, E.M.
1984-01-01
FFTF Project enhanced existing control panels with tape and labels to mitigate operator problems and to incorporate the guidance of NUREG-0700. The enhancements grouped displays and controls into meaningful units and labelled controls and displays to facilitate their identification and efficient use. The enhancements were inexpensive and well received by the facility's operations staff
Energy Technology Data Exchange (ETDEWEB)
Althouse, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); McKannay, R. H. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-08-15
This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and ISOFLEX USA (ISOFLEX), to 1) develop and test a prototype waste destruction system ("System") using AC plasma torch technology to break down and drastically reduce the volume of Carbon-14 (C-14) contaminated medical laboratory wastes while satisfying all environmental regulations, and 2) develop and demonstrate methods for recovering 99%+ of the carbon including the C-14 allowing for possible re-use as a tagging and labeling tool in the biomedical industry.
Performance evaluation of solar photovoltaic panel driven refrigeration system
Rajoria, C. S.; Singh, Dharmendra; Gupta, Pankaj Kumar
2018-03-01
The solar photovoltaic (PV) panel driven refrigeration system employs solar PV panel and play a vital role when combined with storage batteries. The variation in performance of solar PV panel driven refrigeration system has been experimentally investigated in this paper. The change in battery voltage is analyzed with respect to panel size. Different series and parallel combinations have been applied on four solar PV panels of 35W each to get 24V. With the above combination a current in the range of 3-5 ampere has been obtained depending upon the solar intensity. A refrigerator of 110 W and 50 liters is used in the present investigation which requires 0.80 ampere AC at 230 V. The required current and voltage has been obtained from an inverter which draws about 7 ampere DC from the battery bank at 24V. The compressor of the refrigerator consumed 110W which required a PV panel size of 176 W approximately. It is important to note that the compressor consumed about 300W for first 50 milliseconds, 130 W for next five seconds and gradually comes to 110 W in 65 seconds. Thus panel size should be such that it may compensate for the initial load requirement.
CF4 plasma treatment-assisted inkjet printing for color pixel flexible display
International Nuclear Information System (INIS)
Tortissier, G; Daunay, B; Jalabert, L; Lambert, P; Kim, B; Fujita, H; Toshiyoshi, H; Ginet, P
2011-01-01
In this paper we report a MEMS flexible display device based on the color filter Fabry–Perot interferometer and fabricated on a transparent and flexible polyethylene naphthalate substrate. Targeting easy processing, fast evolution and reduced fabrication steps, inkjet printing is selected as a promising technology. CF 4 plasma surface treatment parameters' influence has been investigated through a design of experiment protocol. Important contact angle increase has led to pattern resolution between 50 and 100 µm depending on solutions and substrate nature. Finally, the designed device presents three primary color pixels with satisfying color purity (CIE 1931 chromaticity diagram—red: x = 0.52, y = 0.36; blue: x = 0.13, y = 0.20; green: x = 0.25, y = 0.57).
Survey of standards for electronic image displays
Rowe, William A.
1996-02-01
Electronic visual displays have been evolving from the 1960's basis of cathode ray tube (CRT) technology. Now, many other technologies are also available, including both flat panels and projection displays. Standards for these displays are being developed at both the national level and the international levels. Standards activity within the United States is in its infancy and is fragmented according to the inclination of each of the standards developing organizations. The latest round of flat panel display technology was primarily developed in Japan. Initially standards arose from component vendor-to-OEM customer relationships. As a result, Japanese standards for components are the best developed. The Electronics Industries Association of Japan (EIAJ) is providing their standards to the International Electrotechnical Commission (IEC) for adoption. On the international level, professional societies such as the human factors society (hfs) and the International Organization for Standardization (ISO) have completed major standards, hfs developed the first ergonomic standard hfs-100 and the ISO has developed some sections of a broader ergonomic standard ISO 9241. This paper addresses the organization of standards activity. Active organizations and their areas of focus are identified. The major standards that have been completed or are in development are described. Finally, suggestions for improving the this standards activity are proposed.
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-03-01
The project aims to develop a small, light, and inexpensive touch panel display that enables visually handicapped people to transmit information by use of their manual sensation. Information from computers or the like is exhibited on the display in arrays of hillocks and dents. For improvement on display resolution and for cost reduction, efforts are made (1) to employ micro-Peltier devices for the simplification of the hillock-dent display mechanism and for the realization of a high resolution tactile display and (2) to establish a technology for manufacturing low-cost micro-Peltier devices. In the tactile display to be developed, the hillocks and dents are formed using gas-filled tiny balloons. The balloons are 2-dimensionally arranged, with the gas therein to be expanded and contracted via micro-Peltier devices. Difference between hillock-dent arrays and changes therein with the passage of time provide information. The gas in the balloons is inflated and contracted through the operation of micro-Peltier devices. In concrete terms, efforts were made to develop (1) a prototype hillock-dent display, (2) a technology for manufacturing high-performance low-cost micro-Peltier devices, and (3) a software program for computers to drive tactile displays. (NEDO)
Development of circuit model for arcing on solar panels
International Nuclear Information System (INIS)
Mehta, Bhoomi K; Deshpande, S P; Mukherjee, S; Gupta, S B; Ranjan, M; Rane, R; Vaghela, N; Acharya, V; Sudhakar, M; Sankaran, M; Suresh, E P
2010-01-01
The increased requirements of payload capacity of the satellites have resulted in much higher power requirements of the satellites. In order to minimize the energy loss during power transmission due to cable loss, use of high voltage solar panels becomes necessary. When a satellite encounters space plasma it floats negatively with respect to the surrounding space plasma environment. At high voltage, charging and discharging on solar panels causes the power system breakdown. Once a solar panel surface is charged and potential difference between surface insulator and conductor exceeds certain value, electrostatic discharge (ESD) may occur. This ESD may trigger a secondary arc that can destroy the solar panel circuit. ESD is also called as primary or minor arc and secondary is called major arc. The energy of minor arc is supplied by the charge stored in the coverglass of solar array and is a pulse of typically several 100 ns to several 100 μs duration. The damage caused by minor arc is less compared to major arcs, but it is observed that the minor arc is cause of major arc. Therefore it is important to develop an understanding of minor arc and mitigation techniques. In this paper we present a linear circuit analysis for minor arcs on solar panels. To study arcing event, a ground experimental facility to simulate space plasma environment has been developed at Facilitation Centre for Industrial Plasma Technologies (Institute for Plasma Research) in collaboration with Indian Space Research Organization's ISRO Satellite Technology Centre (ISAC). A linear circuit model has been developed to explain the experimental results by representing the coverglass, solar cell interconnect and wiring by an LCR circuit and the primary arc by an equivalent LR circuit. The aim of the circuit analysis is to predict the arc current which flows through the arc plasma. It is established from the model that the current depends on various parameters like potential difference between insulator
Next generation smart window display using transparent organic display and light blocking screen.
Kim, Gyeong Woo; Lampande, Raju; Choe, Dong Cheol; Ko, Ik Jang; Park, Jin Hwan; Pode, Ramchandra; Kwon, Jang Hyuk
2018-04-02
Transparent organic light emitting diodes (TOLED) have widespread applications in the next-generation display devices particularly in the large size transparent window and interactive displays. Herein, we report high performance and stable attractive smart window displays using facile process. Advanced smart window display is realized by integrating the high performance light blocking screen and highly transparent white OLED panel. The full smart window display reveals a maximum transmittance as high as 64.2% at the wavelength of 600 nm and extremely good along with tunable ambient contrast ratio (171.94:1) compared to that of normal TOLED (4.54:1). Furthermore, the performance decisive light blocking screen has demonstrated an excellent optical and electrical characteristics such as i) high transmittance (85.56% at 562nm) at light-penetrating state, ii) superior absorbance (2.30 at 562nm) in light interrupting mode, iii) high optical contrast (85.50 at 562 nm), iv) high optical stability for more than 25,000 cycle of driving, v) fast switching time of 1.9 sec, and vi) low driving voltage of 1.7 V. The experimental results of smart window display are also validated using optical simulation. The proposed smart window display technology allows us to adjust the intensity of daylight entering the system quickly and conveniently.
Directory of Open Access Journals (Sweden)
Eriko Kage-Nakadai
Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.
Handbook of Visual Display Technology
Cranton, Wayne; Fihn, Mark
2012-01-01
The Handbook of Visual Display Technology is a unique work offering a comprehensive description of the science, technology, economic and human interface factors associated with the displays industry. An invaluable compilation of information, the Handbook will serve as a single reference source with expert contributions from over 150 international display professionals and academic researchers. All classes of display device are covered including LCDs, reflective displays, flexible solutions and emissive devices such as OLEDs and plasma displays, with discussion of established principles, emergent technologies, and particular areas of application. The wide-ranging content also encompasses the fundamental science of light and vision, image manipulation, core materials and processing techniques, display driving and metrology.
Evaluation of viewing experiences induced by a curved three-dimensional display
Mun, Sungchul; Park, Min-Chul; Yano, Sumio
2015-10-01
Despite an increased need for three-dimensional (3-D) functionality in curved displays, comparisons pertinent to human factors between curved and flat panel 3-D displays have rarely been tested. This study compared stereoscopic 3-D viewing experiences induced by a curved display with those of a flat panel display by evaluating subjective and objective measures. Twenty-four participants took part in the experiments and viewed 3-D content with two different displays (flat and curved 3-D display) within a counterbalanced and within-subject design. For the 30-min viewing condition, a paired t-test showed significantly reduced P300 amplitudes, which were caused by engagement rather than cognitive fatigue, in the curved 3-D viewing condition compared to the flat 3-D viewing condition at P3 and P4. No significant differences in P300 amplitudes were observed for 60-min viewing. Subjective ratings of realness and engagement were also significantly higher in the curved 3-D viewing condition than in the flat 3-D viewing condition for 30-min viewing. Our findings support that curved 3-D displays can be effective for enhancing engagement among viewers based on specific viewing times and environments.
Pregnancy-associated plasma protein-A and the vulnerable plaque
DEFF Research Database (Denmark)
Jespersen, Camilla H B; Vestergaard, Kirstine R; Schou, Morten
2014-01-01
For more than a decade, pregnancy-associated plasma protein-A (PAPP-A) has been examined for its relation to acute coronary syndrome (ACS) and the vulnerable plaque. This review summarizes the current knowledge of plasma PAPP-A in relation to nonpregnant individuals focusing on patients with ACS...
NIST display colorimeter calibration facility
Brown, Steven W.; Ohno, Yoshihiro
2003-07-01
A facility has been developed at the National Institute of Standards and Technology (NIST) to provide calibration services for color-measuring instruments to address the need for improving and certifying the measurement uncertainties of this type of instrument. While NIST has active programs in photometry, flat panel display metrology, and color and appearance measurements, these are the first services offered by NIST tailored to color-measuring instruments for displays. An overview of the facility, the calibration approach, and associated uncertainties are presented. Details of a new tunable colorimetric source and the development of new transfer standard instruments are discussed.
Visual ergonomic aspects of glare on computer displays: glossy screens and angular dependence
Brunnström, Kjell; Andrén, Börje; Konstantinides, Zacharias; Nordström, Lukas
2007-02-01
Recently flat panel computer displays and notebook computer are designed with a so called glare panel i.e. highly glossy screens, have emerged on the market. The shiny look of the display appeals to the costumers, also there are arguments that the contrast, colour saturation etc improves by using a glare panel. LCD displays suffer often from angular dependent picture quality. This has been even more pronounced by the introduction of Prism Light Guide plates into displays for notebook computers. The TCO label is the leading labelling system for computer displays. Currently about 50% of all computer displays on the market are certified according to the TCO requirements. The requirements are periodically updated to keep up with the technical development and the latest research in e.g. visual ergonomics. The gloss level of the screen and the angular dependence has recently been investigated by conducting user studies. A study of the effect of highly glossy screens compared to matt screens has been performed. The results show a slight advantage for the glossy screen when no disturbing reflexes are present, however the difference was not statistically significant. When disturbing reflexes are present the advantage is changed into a larger disadvantage and this difference is statistically significant. Another study of angular dependence has also been performed. The results indicates a linear relationship between the picture quality and the centre luminance of the screen.
Error diffusion applied to the manipulation of liquid-crystal display subpixels
Dallas, William J.; Fan, Jiahua; Roehrig, Hans; Krupinski, Elizabeth A.
2004-05-01
Flat-panel displays based on liquid crystal technology are becoming widely used in the medical imaging arena. Despite the impressive capabilities of presently-existing panels, some medical images push their boundaries. We are working with mammograms that contain up to 4800 x 6400 14-bit pixels. Stated differently, these images contain 30 mega-pixels each. In the standard environment, for film viewing, the mammograms are hung four-up, i.e. four images are located side by side. Because many of the LCD panels used for monochrome display of medical images are based on color models, the pixels of the panels are divided into sub-pixels. These sub-pixels vary in their numbers and in the degrees of independence. Manufacturers have used both spatial and temporal modulation of these sub-pixels to improve the quality of images presented by the monitors. In this presentation we show how the sub-pixel structure of some present and future displays can be used to attain higher spatial resolution than the full-pixel resolution specification would suggest while also providing increased contrast resolution. The error diffusion methods we discuss provide a natural way of controlling sub-pixels and implementing trade-offs. In smooth regions of the image contrast resolution can maximized. In rapidly-varying regions of the image spatial resolution can be favored.
Novel Human Radiation Exposure Biomarker Panel Applicable for Population Triage
Energy Technology Data Exchange (ETDEWEB)
Bazan, Jose G. [Department of Radiation Oncology, Stanford University, Stanford, California (United States); Chang, Polly; Balog, Robert; D' Andrea, Annalisa; Shaler, Thomas; Lin, Hua; Lee, Shirley; Harrison, Travis [SRI International, Menlo Park, California (United States); Shura, Lei; Schoen, Lucy; Knox, Susan J. [Department of Radiation Oncology, Stanford University, Stanford, California (United States); Cooper, David E., E-mail: david.cooper@sri.com [SRI International, Menlo Park, California (United States)
2014-11-01
Purpose: To identify a panel of radiation-responsive plasma proteins that could be used in a point-of-care biologic dosimeter to detect clinically significant levels of ionizing radiation exposure. Methods and Materials: Patients undergoing preparation for hematopoietic cell transplantation using radiation therapy (RT) with either total lymphoid irradiation or fractionated total body irradiation were eligible. Plasma was examined from patients with potentially confounding conditions and from normal individuals. Each plasma sample was analyzed for a panel of 17 proteins before RT was begun and at several time points after RT exposure. Paired and unpaired t tests between the dose and control groups were performed. Conditional inference trees were constructed based on panels of proteins to compare the non-RT group with the RT group. Results: A total of 151 patients (62 RT, 41 infection, 48 trauma) were enrolled on the study, and the plasma from an additional 24 healthy control individuals was analyzed. In comparison with to control individuals, tenascin-C was upregulated and clusterin was downregulated in patients receiving RT. Salivary amylase was strongly radiation responsive, with upregulation in total body irradiation patients and slight downregulation in total lymphoid irradiation patients compared with control individuals. A panel consisting of these 3 proteins accurately distinguished between irradiated patients and healthy control individuals within 3 days after exposure: 97% accuracy, 0.5% false negative rate, 2% false positive rate. The accuracy was diminished when patients with trauma, infection, or both were included (accuracy, 74%-84%; false positive rate, 14%-33%, false negative rate: 8%-40%). Conclusions: A panel of 3 proteins accurately distinguishes unirradiated healthy donors from those exposed to RT (0.8-9.6 Gy) within 3 days of exposure. These findings have significant implications in terms of triaging individuals in the case of nuclear or other
An IBM-Compatible 640 X 200 Electroluminescent (EL) Display Monitor
Gullick, Paul; Schmachtenberg, Richard; Laakso, Carl
1986-05-01
An electroluminescent flat-panel display has been developed and recently introduced that fills any of the needs of the portable computer market. The display is very thin, yet rugged enough for the rigors of portability. It is highly integrated, and very reliable. It has the crisp and clear display image that is typical of high quality electroluminescent displays. The unit has a pixel matrix organization and pixel dimensions that are not only asthetically and ergonomically pleasing, but also make the display compatible with the most widely used software packages run on today's personal computers (Figure 1).
Directory of Open Access Journals (Sweden)
Segovia, F.
2007-12-01
Full Text Available Plasma sprayed cermet coatings WC-Co are used in a wide range of industrial applications, mainly due to their wear resistance even in corrosive environments. The objective of this work is to analyze mechanical response of hard metal coatings by means of three- and four-points bend tests applying acoustic emission technique to determine failure critical strength. It has been observed the effect of supported charge level in structural damage by means of optical microscopy and scanning electron microscopy. Acoustic emission has allowed us to relate damage level to stresses level and then to understand coatings failure mechanism.
Los recubrimientos de cermet WC-Co proyectados por plasma se utilizan en un amplio rango de aplicaciones industriales, principalmente por su resistencia al desgaste, incluso en medio corrosivo. El objetivo de este trabajo es analizar la respuesta mecánica de los recubrimientos de metal duro mediante ensayos de flexión a 3 y 4 puntos aplicando el método de emisión acústica para determinar las tensiones críticas de fallo. Se ha observado el efecto del nivel de carga soportado en el dañado estructural mediante microscopia óptica y electrónica de barrido. La emisión acústica ha permitido relacionar el grado de dañado con el nivel de tensiones y, así, entender el mecanismo de fallo de los recubrimientos.
Automatic ranging circuit for a digital panel meter
International Nuclear Information System (INIS)
Mueller, T.R.; Ross, H.H.
1976-01-01
This invention relates to a range changing circuit that operates in conjunction with a digital panel meter of fixed sensitivity. The circuit decodes the output of the panel meter and uses that information to change the gain of an input amplifier to the panel meter in order to ensure that the maximum number of significant figures is always displayed in the meter. The circuit monitors five conditions in the meter and responds to any of four combinations of these conditions by means of logic elements to carry out the function of the circuit. The system was designed for readout of a fluorescence analyzer for uranium analysis
Dynamic voltage-current characteristics for a water jet plasma arc
International Nuclear Information System (INIS)
Yang Jiaxiang; Lan Sheng; Xu Zuoming
2008-01-01
A virtual instrument technology is used to measure arc current, arc voltage, dynamic V-I characteristics, and nonlinear conductance for a cone-shaped water jet plasma arc under ac voltage. Experimental results show that ac arc discharge mainly happens in water vapor evaporated from water when heated. However, due to water's cooling effect and its conductance, arc conductance, reignition voltage, extinguish voltage, and current zero time are very different from those for ac arc discharge in gas work fluid. These can be valuable to further studies on mechanism and characteristics of plasma ac discharge in water, and even in gas work fluid
AC/DC/pulsed-power modulator for corona-plasma generation
Ariaans, T.H.P.; Pemen, A.J.M.; Winands, G.J.J.; Heesch, van E.J.M.; Liu, Z.
2009-01-01
Gas-cleaning techniques using nonthermal plasma are slowly introduced into industry nowadays. In this paper, we present a novel power modulator for the efficient generation of large-volume corona plasma. No expensive high-voltage components are required. Switching is done at an intermediate voltage
Ortved, K F; Goodale, M B; Ober, C; Maylin, G A; Fortier, L A
2017-12-01
Orthobiologics such as autologous conditioned serum (ACS) are often used to treat joint disease in horses. Because ACS is generated from the horse's own blood, any medication administered at the time of preparation would likely be present in stored ACS, which could lead to an inadvertent positive drug test following intra-articular (IA) injection. The main objective of this study was to determine if ACS prepared from firocoxib positive horses could result in detectable plasma concentrations of the drug following IA injection. Firocoxib was administered to six horses at 0.1mg/kg PO twice at a 24h interval. Blood was obtained at 4h following the second dose and transferred to a separate syringe (Arthrex IRAP II) for ACS preparation. Plasma and ACS concentrations of firocoxib were analysed by liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS). When horses were confirmed firocoxib negative, 7.5mL of ACS was injected into both tarsocrural joints. Blood samples were collected at 0, 4, 8, 12, 24, and 48h, and firocoxib concentration was measured. Mean (±standard error of the mean, SEM) plasma concentration of firocoxib 4h following the second dose was 33.3±4.72ng/mL. Mean (±SEM) firocoxib concentration in ACS was 35.4±4.47ng/mL. Fourteen days following the second and last dose of firocoxib, mean plasma concentration was below the lower limit of detection (LOD=1ng/mL) in all horses. Following IA injection of ACS, plasma concentrations of firocoxib remained below LOD at all times in all horses. ACS generated from horses with therapeutic plasma concentrations of firocoxib did not contain sufficient firocoxib to lead to a positive plasma drug test following IA administration. Copyright © 2017 Elsevier Ltd. All rights reserved.
Concept of Advanced Back-up Control Panel Design of Digital Main Control Room
International Nuclear Information System (INIS)
Jiang, Guo Jin; Sun, Yong Bin; Tan, Ke; Zhang, Li Ming; Shi, Ji; Zhang, Xue Gang; Huang, Wei Jun; Mao, Ting; Liu Yanzi
2011-01-01
Back-up control panel (BCP) of digital main control room (DMCR) is the backup means for main computerized control means (MCM). This paper focus on technical issues for advanced design of Backup Panel (BCP) for CPR1000 using qualified computer-based video display unit to display plant process indication and alarms. HFE issues also have been considered in the BCP design. Then, mean to fulfill safety target of NPP, best ergonomic effect has been described. At last conclusion on advanced BCP design is provided
Concept of Advanced Back-up Control Panel Design of Digital Main Control Room
Energy Technology Data Exchange (ETDEWEB)
Jiang, Guo Jin; Sun, Yong Bin; Tan, Ke; Zhang, Li Ming; Shi, Ji; Zhang, Xue Gang; Huang, Wei Jun; Mao, Ting; Liu Yanzi [China Nuclear Power Engineering Company, Shenzen (China)
2011-08-15
Back-up control panel (BCP) of digital main control room (DMCR) is the backup means for main computerized control means (MCM). This paper focus on technical issues for advanced design of Backup Panel (BCP) for CPR1000 using qualified computer-based video display unit to display plant process indication and alarms. HFE issues also have been considered in the BCP design. Then, mean to fulfill safety target of NPP, best ergonomic effect has been described. At last conclusion on advanced BCP design is provided.
Human Visual Performance and Flat Panel Display Image Quality
1980-07-01
visible light energy can be described in electro- magnetic energy space as that portion of the electromagnetic wavelength (or frequency) domain to...temporal frequency domain much as one analyzes spatial information in the spatial frequency domain. As the content of a complex but periodic sound ...briefly with the more intepretive aspects of information display, those pertaining to information encoding and the design problems and parame- ters
Foil Panel Mirrors for Nonimaging Applications
Kuyper, D. J.; Castillo, A. A.
1984-01-01
Large durable, lightweight mirrors made by bonding thick aluminum foil to honeycomb panels or other rigid, flat backings. Mirrors suitable for use as infrared shields, telescope doors, solar-furnance doors, advertising displays, or other reflectors that require low thermal emissivity and high specularity but do not require precise surface figure necessary for imaging.
Filamentary and diffuse barrier discharges
International Nuclear Information System (INIS)
Kogelschatz, U.
2001-01-01
Barrier discharges, sometimes also referred to as dielectric-barrier discharges or silent discharges, are characterized by the presence of at least one insulating layer in contact with the discharge between two planar or cylindrical electrodes connected to an ac power supply. The main advantage of this type of electrical discharge is, that non-equilibrium plasma conditions in atmospheric-pressure gases can be established in an economic and reliable way. This has led to a number of important applications including industrial ozone generation, surface modification of polymers, plasma chemical vapor deposition, excitation of CO 2 lasers, excimer lamps and, most recently, large-area flat plasma display panels. Depending on the application, the width of the discharge gap can range from less than 0.1 mm to about 100 mm and the applied frequency from below line frequency to several gigahertz. Typical materials used for the insulating layer (dielectric barrier) are glass, quartz, ceramics but also thin enamel or polymer layers
A passive cooling system proposal for multifunction and high-power displays
Tari, Ilker
2013-03-01
Flat panel displays are conventionally cooled by internal natural convection, which constrains the possible rate of heat transfer from the panel. On one hand, during the last few years, the power consumption and the related cooling requirement for 1080p displays have decreased mostly due to energy savings by the switch to LED backlighting and more efficient electronics. However, on the other hand, the required cooling rate recently started to increase with new directions in the industry such as 3D displays, and ultra-high-resolution displays (recent 4K announcements and planned introduction of 8K). In addition to these trends in display technology itself, there is also a trend to integrate consumer entertainment products into displays with the ultimate goal of designing a multifunction device replacing the TV, the media player, the PC, the game console and the sound system. Considering the increasing power requirement for higher fidelity in video processing, these multifunction devices tend to generate very high heat fluxes, which are impossible to dissipate with internal natural convection. In order to overcome this obstacle, instead of active cooling with forced convection that comes with drawbacks of noise, additional power consumption, and reduced reliability, a passive cooling system relying on external natural convection and radiation is proposed here. The proposed cooling system consists of a heat spreader flat heat pipe and aluminum plate-finned heat sink with anodized surfaces. For this system, the possible maximum heat dissipation rates from the standard size panels (in 26-70 inch range) are estimated by using our recently obtained heat transfer correlations for the natural convection from aluminum plate-finned heat sinks together with the surface-to-surface radiation. With the use of the proposed passive cooling system, the possibility of dissipating very high heat rates is demonstrated, hinting a promising green alternative to active cooling.
Projection display technologies for the new millennium
Kahn, Frederic J.
2000-04-01
Although analog CRTs continue to enable most of the world's electronic projection displays such as US consumer rear projection televisions, discrete pixel (digital) active matrix LCD and DLP reflective mirror array projectors have rapidly created large nonconsumer markets--primarily for business. Recent advances in image quality, compactness and cost effectiveness of digital projectors have the potential to revolutionize major consumer and entertainment markets as well. Digital penetration of the mainstream consumer projection TV market will begin in the hear 2000. By 2005 digital projection HDTVs could take the major share of the consumer HDTV projection market. Digital projection is expected to dominate both the consumer HDTV and the cinema market by 2010, resulting in potential shipments for all projection markets exceeding 10 M units per year. Digital projection is improving at a rate 10X faster than analog CRT projectors and 5X faster than PDP flat panels. Continued rapid improvement of digital projection is expected due to its relative immaturity and due to the wide diversity of technological improvements being pursued. Key technology enablers are the imaging panels, light sources and micro-optics. Market shares of single panel projectors, MEMs panels, LCOS panels and low T p-Si TFT LCD panel variants are expected to increase.
Here Be Dragons: Characterization of ACS/WFC Scattered Light Anomalies
Porterfield, B.; Coe, D.; Gonzaga, S.; Anderson, J.; Grogin, N.
2016-11-01
We present a study characterizing scattered light anomalies that occur near the edges of Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) images. We inspected all 8,573 full-frame ACS/WFC raw images with exposure times longer than 350 seconds obtained in the F606W and F814W filters from 2002 to October 2013. We visually identified two particular scattered light artifacts known as "dragon's breath" and edge glow. Using the 2MASS point source catalog and Hubble Guide Star Catalog (GSC II), we identified the stars that caused these artifacts. The stars are all located in narrow bands ( 3" across) just outside the ACS/WFC field of view (2" - 16" away). We provide a map of these risky areas around the ACS/WFC detectors - users should avoid positioning bright stars in these regions when designing ACS/WFC imaging observations. We also provide interactive webpages which display all the image artifacts we identified, allowing users to see examples of the severity of artifacts they might expect for a given stellar magnitude at a given position relative to the ACS/WFC field of view. On average, 10th (18th) magnitude stars produce artifacts about 1,000 (100) pixels long. But the severity of these artifacts can vary strongly with small positional shifts (∼ 1"). The results are similar for both filters (F606W and F814W) when expressed in total fluence, or flux multiplied by exposure time.
Quality of Experience for Large Ultra-High-Resolution Tiled Displays with Synchronization Mismatch
Directory of Open Access Journals (Sweden)
Deshpande Sachin
2011-01-01
Full Text Available This paper relates to quality of experience when viewing images, video, or other content on large ultra-high-resolution displays made from individual display tiles. We define experiments to measure vernier acuity caused by synchronization mismatch for moving images. The experiments are used to obtain synchronization mismatch acuity threshold as a function of object velocity and as a function of occlusion or gap width. Our main motivation for measuring the synchronization mismatch vernier acuity is its relevance in the application of tiled display systems, which create a single contiguous image using individual discrete panels arranged in a matrix with each panel utilizing a distributed synchronization algorithm to display parts of the overall image. We also propose a subjective assessment method for perception evaluation of synchronization mismatch for large ultra-high-resolution tiled displays. For this, we design a synchronization mismatch measurement test video set for various tile configurations for various interpanel synchronization mismatch values. The proposed method for synchronization mismatch perception can evaluate tiled displays with or without tile bezels. The results from this work can help during design of low-cost tiled display systems, which utilize distributed synchronization mechanisms for a contiguous or bezeled image display.
Perception Of "Features" And "Objects": Applications To The Design Of Instrument Panel Displays
Poynter, Douglas; Czarnomski, Alan J.
1988-10-01
An experiment was conducted to determine whether socalled feature displays allow for faster and more accurate processing compared to object displays. Previous psychological studies indicate that features can be processed in parallel across the visual field, whereas objects must be processed one at a time with the aid of attentional focus. Numbers and letters are examples of objects; line orientation and color are examples of features. In this experiment, subjects were asked to search displays composed of up to 16 elements for the presence of specific elements. The ability to detect, localize, and identify targets was influenced by display format. Digital errors increased with the number of elements, the number of targets, and the distance of the target from the fixation point. Line orientation errors increased only with the number of targets. Several other display types were evaluated, and each produced a pattern of errors similar to either digital or line orientation format. Results of the study were discussed in terms of Feature Integration Theory, which distinguishes between elements that are processed with parallel versus serial mechanisms.
Konieczna, Lucyna; Roszkowska, Anna; Stachowicz-Stencel, Teresa; Synakiewicz, Anna; Bączek, Tomasz
2018-02-01
This paper details the quantitative analysis of neurotransmitters, including dopamine (DA), norepinephrine (NE), epinephrine (E), and serotonin (5-HT), along with their respective precursors and metabolites in children with solid tumors: Wilms' tumor (WT) and neuroblastoma (NB). A panel of neurotransmitters was determined with the use of dispersive liquid-liquid microextraction (DLLME) technique combined with liquid-chromatography mass spectrometry (LC-MS/MS) in plasma samples obtained from a group of pediatric subjects with solid tumors and a control group of healthy children. Next, statistical univariate analysis (t-test) and multivariate analysis (Principal Component Analysis) were performed using chromatographic data. The levels of tyrosine (Tyr) and tryptophan (Trp) (the precursors of analyzed neurotransmitters) as well as 3,4-dihydroxyphenylacetic acid (DOPAC) (a product of metabolism of DA) were significantly higher in the plasma samples obtained from pediatric patients with WT than in the samples taken from the control group. Moreover, statistically significant differences were observed between the levels of 5-HT and homovanillic acid (HVA) in the plasma samples from pediatric patients with solid tumors and the control group. However, elevated levels of these analytes did not facilitate a clear distinction between pediatric patients with WT and those with NB. Nonetheless, the application of advanced statistical tools allowed the healthy controls to be differentiated from the pediatric oncological patients. The identification and quantification of a panel of neurotransmitters as potential prognostic factors in selected childhood malignancies may provide clinically relevant information about ongoing metabolic alterations, and it could potentially serve as an adjunctive strategy in the effective diagnosis and treatment of solid tumors in children. Copyright © 2017 Elsevier B.V. All rights reserved.
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
Plasma carnitine concentrations after chronic alcohol intoxication
Directory of Open Access Journals (Sweden)
Alina Kępka
2013-05-01
Full Text Available Background: Carnitine transports fatty acids from the cytoplasm to the mitochondrial matrix, where the fatty acids are oxidized. Chronic alcohol consumption reduces the concentration of carnitine and interferes with oxidative processes occurring in the cell.Aim: The assessment of carnitine concentrations in plasma of chronically intoxicated alcohol dependent persons in a 49-day abstinence period.Material/Methods: The study included 31 patients (5 women and 27 men aged from 26 to 60 years (44.6± 8.9 and 32 healthy subjects (15 women and 17 men aged 22-60 years (39.8± 9.4. The patients’ alcohol dependence ranged from 2 to 30 years (13.6± 7.5. Examined subjects consumed 75-700 g of ethanol/day (226.9± 151.5. Plasma concentrations of free and total carnitine were measured three times: at the first (T0, 30th (T30 and 49th (T49 day of hospital detoxification. Free (FC and total (TC carnitine were determined by the spectrophotometric method. Plasma acylcarnitine (AC concentration was calculated from the difference between TC and FC; then the AC/FC ratio was calculated. To determine statistically significant differences for related variables, Student’s t-test was used.Results: At T0, alcoholics had significantly lower concentration of FC and TC (p < 0.05 in plasma, as compared to the control group. In comparison to controls, at T30, plasma TC and FC (p < 0.01 as well as AC (p < 0.001 were reduced. The lowest concentration of TC, FC and AC (p < 0.001was found at T49. The ratio of AC/FC at T0 had a tendency to be higher in alcoholics than in the control group (p = 0.05, whereas at T49 it was significantly lower in alcoholics as compared to the control subjects (p < 0.05.Conclusions: Chronic alcohol intoxication causes a plasma deficiency of carnitine. Forty-nine days of abstinence showed a significant decrease in the concentration of TC, FC and AC. Further research is necessary to clarify whether a low level of plasma carnitine
A full scope nuclear power plant simulator for multiple reactor types with virtual control panels
International Nuclear Information System (INIS)
Yonezawa, Hisanori; Ueda, Hiroki; Kato, Takahisa
2017-01-01
This paper summarizes a full scope nuclear power plant simulator for multiple reactor types with virtual control panels which Toshiba developed and delivered. After the Fukushima DAIICHI nuclear power plants accident, it is required that all the people who are engaged in the design, manufacturing, operation, maintenance, management and regulation for the nuclear power plant should learn the wide and deep knowledge about the nuclear power plant design including the severe accident. For this purpose, the training with a full scope simulator is one of the most suitable ways. However the existing full scope simulators which are consist of the control panels replica of the referenced plants are costly and they are hard to remodel to fit to the real plant of the latest condition. That's why Toshiba developed and delivered the new concept simulator system which covers multiple referenced plants even though they have different design like BWR and PWR. The control panels of the simulator are made by combining 69 large Liquid Crystal Display (LCD) panels with touch screen instead of a control panel replica of referenced plant. The screen size of the each panel is 42 inches and 3 displays are arranged in tandem for one unit and 23 units are connected together. Each panel displays switches, indicators, recorders and lamps with the Computer Graphics (CG) and trainees operate them with touch operations. The simulator includes a BWR and a PWR simulator model, which enable trainees to learn the wide and deep knowledge about the nuclear power plant of BWR and PWR reactor types. (author)
Kalanchosides A-C, new cytotoxic bufadienolides from the aerial parts of Kalanchoe gracilis.
Wu, Pei-Lin; Hsu, Yu-Lin; Wu, Tian-Shung; Bastow, K F; Lee, Kuo-Hsiung
2006-11-09
[Structure: see text] Three new compounds, kalanchosides A-C (1-3), as well as five known compounds, were isolated from the aerial parts of Kalanchoe gracilis. The compound structures were determined by spectroscopic methods. All eight isolated compounds showed significant cytotoxic activity against a panel of human tumor cell lines, with potency reaching the nanomolar range. However, only bryophyllin B (8) inhibited HIV replication in H9 lymphocyte cells.
Differential conductivity mapping of solar panels using a high-TC superconductor SQUID
International Nuclear Information System (INIS)
Kiwa, T.; Maeda, S.; Miyake, K.; Kataoka, N.; Tsukamoto, A.; Adachi, S.; Tanabe, K.; Kandori, A.; Tsukada, K.
2011-01-01
To visualise the distribution of the electric property of solar cells, we developed a differential conductivity mapping system using high-T C (HTS-) superconductor SQUID with a normal conducting pick-up coil. The bias ac voltage with an offset voltage was applied to a solar panel made from amorphous silicon, and the normal component of the generated magnetic field was lock-in-detected. Thus the measured signal was converted to dB/dV properties, which are inverse-proportional to the differential resistivity, as the function of the offset voltage. By scanning the pick-up coil across the panel surface, we obtained the distribution of dB/dV properties across the solar panel was obtained by scanning the pick-up coil across the panel surface. The distribution of dB/dV on the panel differed between when the light source was on and when it was off. This result suggests that the proposed system is a potential tool for diagnosing the electric properties of solar cells.
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
Influence of genetic variation on plasma protein levels in older adults using a multi-analyte panel.
Directory of Open Access Journals (Sweden)
Sungeun Kim
Full Text Available Proteins, widely studied as potential biomarkers, play important roles in numerous physiological functions and diseases. Genetic variation may modulate corresponding protein levels and point to the role of these variants in disease pathophysiology. Effects of individual single nucleotide polymorphisms (SNPs within a gene were analyzed for corresponding plasma protein levels using genome-wide association study (GWAS genotype data and proteomic panel data with 132 quality-controlled analytes from 521 Caucasian participants in the Alzheimer's Disease Neuroimaging Initiative (ADNI cohort. Linear regression analysis detected 112 significant (Bonferroni threshold p=2.44×10(-5 associations between 27 analytes and 112 SNPs. 107 out of these 112 associations were tested in the Indiana Memory and Aging Study (IMAS cohort for replication and 50 associations were replicated at uncorrected p<0.05 in the same direction of effect as those in the ADNI. We identified multiple novel associations including the association of rs7517126 with plasma complement factor H-related protein 1 (CFHR1 level at p<1.46×10(-60, accounting for 40 percent of total variation of the protein level. We serendipitously found the association of rs6677604 with the same protein at p<9.29×10(-112. Although these two SNPs were not in the strong linkage disequilibrium, 61 percent of total variation of CFHR1 was accounted for by rs6677604 without additional variation by rs7517126 when both SNPs were tested together. 78 other SNP-protein associations in the ADNI sample exceeded genome-wide significance (5×10(-8. Our results confirmed previously identified gene-protein associations for interleukin-6 receptor, chemokine CC-4, angiotensin-converting enzyme, and angiotensinogen, although the direction of effect was reversed in some cases. This study is among the first analyses of gene-protein product relationships integrating multiplex-panel proteomics and targeted genes extracted from a GWAS
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
International Nuclear Information System (INIS)
Hipp, Katharina; Rau, Peter; Schäfer, Benjamin; Pfannstiel, Jens; Jeske, Holger
2016-01-01
Plant infecting geminiviruses encode a small (A)C4 protein within the open reading frame of the replication-initiator protein. In African cassava mosaic virus, two in-frame start codons may be used for the translation of a longer and a shorter AC4 variant. Both were fused to green fluorescent protein or glutathione-S-transferase genes and expressed in fission yeast. The longer variant accumulated in discrete spots in the cytoplasm, whereas the shorter variant localized to the plasma membrane. A similar expression pattern was found in plants. A myristoylation motif may promote a targeting of the shorter variant to the plasma membrane. Mass spectrometry analysis of the yeast-expressed shorter variant detected the corresponding myristoylation. The biological relevance of the second start codon was confirmed using mutated infectious clones. Whereas mutating the first start codon had no effect on the infectivity in Nicotiana benthamiana plants, the second start codon proved to be essential. -- Highlights: •The ACMV AC4 may be translated from one or the other in-frame start codon. •Both AC4 variants are translated in fission yeast. •The long AC4 protein localizes to the cytoplasm, the short to the plasma membrane. •The short variant is myristoylated in yeast and may promote membrane localization. •Only the shorter AC4 variant has an impact on viral infections in plants.
Energy Technology Data Exchange (ETDEWEB)
Hipp, Katharina, E-mail: katharina.hipp@bio.uni-stuttgart.de [University of Stuttgart, Institute of Biomaterials and biomolecular Systems, Department of Molecular Biology and Plant Virology, Pfaffenwaldring 57, 70550 Stuttgart (Germany); Rau, Peter; Schäfer, Benjamin [University of Stuttgart, Institute of Biomaterials and biomolecular Systems, Department of Molecular Biology and Plant Virology, Pfaffenwaldring 57, 70550 Stuttgart (Germany); Pfannstiel, Jens [University of Hohenheim, Mass Spectrometry Core Facility, August-von-Hartmann-Straße 3, 70599 Stuttgart (Germany); Jeske, Holger [University of Stuttgart, Institute of Biomaterials and biomolecular Systems, Department of Molecular Biology and Plant Virology, Pfaffenwaldring 57, 70550 Stuttgart (Germany)
2016-11-15
Plant infecting geminiviruses encode a small (A)C4 protein within the open reading frame of the replication-initiator protein. In African cassava mosaic virus, two in-frame start codons may be used for the translation of a longer and a shorter AC4 variant. Both were fused to green fluorescent protein or glutathione-S-transferase genes and expressed in fission yeast. The longer variant accumulated in discrete spots in the cytoplasm, whereas the shorter variant localized to the plasma membrane. A similar expression pattern was found in plants. A myristoylation motif may promote a targeting of the shorter variant to the plasma membrane. Mass spectrometry analysis of the yeast-expressed shorter variant detected the corresponding myristoylation. The biological relevance of the second start codon was confirmed using mutated infectious clones. Whereas mutating the first start codon had no effect on the infectivity in Nicotiana benthamiana plants, the second start codon proved to be essential. -- Highlights: •The ACMV AC4 may be translated from one or the other in-frame start codon. •Both AC4 variants are translated in fission yeast. •The long AC4 protein localizes to the cytoplasm, the short to the plasma membrane. •The short variant is myristoylated in yeast and may promote membrane localization. •Only the shorter AC4 variant has an impact on viral infections in plants.
International Nuclear Information System (INIS)
Zahn, J.; Komor, Z.; Geldmeyer, H.J.
1976-01-01
A data input controller has been developed to allow the data transfer from an alphanumeric and function keyboard to the CAMAC-dataway or via the plasma display controller SIG-8AS/S and a serial transmission line to the TTY-/V.24-port of a computer. (orig.) [de
Effectiveness of a large mimic panel in an existing nuclear power plant central control board
International Nuclear Information System (INIS)
Kubota, Ryuji; Satoh, Hiroyuki; Sasajima, Katsuhiro; Kawano, Ryutaro; Shibuya Shinya
1999-01-01
We conducted the analysis of the nuclear power plant (NPP) operators' behaviors under emergency conditions by using training simulators as a joint research project by Japanese BWR groups for twelve years. In the phase-IV of this project we executed two kinds of experiments to evaluate the effectiveness of the interfaces. One was for evaluations of the interfaces such as CRTs with touch screen, a large mimic panel, and a hierarchical annunciator system introduced in the newly developed ABWR type central control board. The other was that we analyzed the operators' behaviors in emergency conditions by using the first generation BWR type central control board which was added new interfaces such as a large display screen and demarcation on the board to help operators to understand the plant. The demarcation is one of the visual interface improvements and its technique is that a line enclosing several components causes them to be perceived as a group.The result showed that both the large display panel Introduced in ABWR central control board and the large display screen in the existing BWR type central control board improved the performance of the NPP operators in the experiments. It was expected that introduction of the large mimic panel into the existing BWR type central control boards would improve operators' performance. However, in the case of actual installation of the large display board into the existing central control boards, there are spatial and hardware constraints. Therefore the size of lamps, lines connecting from symbols of the pumps or valves to the others' will have to be modified under these constraints. It is important to evaluate the displayed information on the large display board before actual installation. We made experiments to solve these problems by using TEPCO's research simulator which is added a large mimic panel. (author)
Foster, K; Datta, P; Orswell, M; Tasaico, K; Alpert, A; Bluestein, B
2000-01-01
Reported is the evaluation of a new centrifugation method, Statspin, that addresses both time and sample separation integrity. The method can successfully separate the plasma fraction from the cellular material in 2 minutes as compared to 20 minutes for the conventional centrifuge method. The Statspin, combined with the ACS:180 system, can generate test results in less than 30 minutes, exclusive of transport to the laboratory. This study demonstrated that the combined technologies offer timing-saving improvements for clinical laboratories offering STAT immunoassays for cardiac markers, endocrine molecules, and therapeutic drugs.
Simulation of the AC corona phenomenon with experimental validation
International Nuclear Information System (INIS)
Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R
2017-01-01
The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach. (paper)
Plasma Treated Active Carbon for Capacitive Deionization of Saline Water
Directory of Open Access Journals (Sweden)
Aiping Zeng
2017-01-01
Full Text Available The plasma treatment on commercial active carbon (AC was carried out in a capacitively coupled plasma system using Ar + 10% O2 at pressure of 4.0 Torr. The RF plasma power ranged from 50 W to 100 W and the processing time was 10 min. The carbon film electrode was fabricated by electrophoretic deposition. Micro-Raman spectroscopy revealed the highly increased disorder of sp2 C lattice for the AC treated at 75 W. An electrosorption capacity of 6.15 mg/g was recorded for the carbon treated at 75 W in a 0.1 mM NaCl solution when 1.5 V was applied for 5 hours, while the capacity of the untreated AC was 1.01 mg/g. The plasma treatment led to 5.09 times increase in the absorption capacity. The jump of electrosorption capacity by plasma treatment was consistent with the Raman spectra and electrochemical double layer capacitance. This work demonstrated that plasma treatment was a potentially efficient approach to activating biochar to serve as electrode material for capacitive deionization (CDI.
Charge dependence of the plasma travel length in atmospheric-pressure plasma
Energy Technology Data Exchange (ETDEWEB)
Yambe, Kiyoyuki; Konda, Kohmei; Masuda, Seiya [Graduate School of Science and Technology, Niigata University, Niigata 950-2181 (Japan)
2016-06-15
Plasma plume is generated using a quartz tube, helium gas, and foil electrode by applying AC high voltage under the atmosphere. The plasma plume is released into the atmosphere from inside of the quartz tube and is seen as the continuous movement of the plasma bullet. The travel length of plasma bullet is defined from plasma energy and force due to electric field. The drift velocity of plasma bullet has the upper limit under atmospheric-pressure because the drift velocity is determined from the balance between electric field and resistive force due to collisions between plasma and air. The plasma plume charge depends on the drift velocity. Consequently, in the laminar flow of helium gas flow state, the travel length of the plasma plume logarithmically depends on the plasma plume charge which changes with both the electric field and the resistive force.
Charge dependence of the plasma travel length in atmospheric-pressure plasma
International Nuclear Information System (INIS)
Yambe, Kiyoyuki; Konda, Kohmei; Masuda, Seiya
2016-01-01
Plasma plume is generated using a quartz tube, helium gas, and foil electrode by applying AC high voltage under the atmosphere. The plasma plume is released into the atmosphere from inside of the quartz tube and is seen as the continuous movement of the plasma bullet. The travel length of plasma bullet is defined from plasma energy and force due to electric field. The drift velocity of plasma bullet has the upper limit under atmospheric-pressure because the drift velocity is determined from the balance between electric field and resistive force due to collisions between plasma and air. The plasma plume charge depends on the drift velocity. Consequently, in the laminar flow of helium gas flow state, the travel length of the plasma plume logarithmically depends on the plasma plume charge which changes with both the electric field and the resistive force.
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
Current progress and technical challenges of flexible liquid crystal displays
Fujikake, Hideo; Sato, Hiroto
2009-02-01
We focused on several technical approaches to flexible liquid crystal (LC) display in this report. We have been developing flexible displays using plastic film substrates based on polymer-dispersed LC technology with molecular alignment control. In our representative devices, molecular-aligned polymer walls keep plastic-substrate gap constant without LC alignment disorder, and aligned polymer networks create monostable switching of fast-response ferroelectric LC (FLC) for grayscale capability. In the fabrication process, a high-viscosity FLC/monomer solution was printed, sandwiched and pressed between plastic substrates. Then the polymer walls and networks were sequentially formed based on photo-polymerization-induced phase separation in the nematic phase by two exposure processes of patterned and uniform ultraviolet light. The two flexible backlight films of direct illumination and light-guide methods using small three-primary-color light-emitting diodes were fabricated to obtain high-visibility display images. The fabricated flexible FLC panels were driven by external transistor arrays, internal organic thin film transistor (TFT) arrays, and poly-Si TFT arrays. We achieved full-color moving-image displays using the flexible FLC panel and the flexible backlight film based on field-sequential-color driving technique. Otherwise, for backlight-free flexible LC displays, flexible reflective devices of twisted guest-host nematic LC and cholesteric LC were discussed with molecular-aligned polymer walls. Singlesubstrate device structure and fabrication method using self-standing polymer-stabilized nematic LC film and polymer ceiling layer were also proposed for obtaining LC devices with excellent flexibility.
Physics and applications of micro-plasmas in dielectric barrier and hollow cathode configurations
International Nuclear Information System (INIS)
Boeuf, J. P.; Pitchford, L. C.
2005-01-01
Non-equilibrium or non-thermal plasmas operate at low gas temperatures and this property make these plasmas very attractive in a number of applications, from etching and deposition in the microelectronics industry to plasma displays and pollution control. However, although it is quite easy to generate a large volume non-equilibrium plasma at pressure on the order or below 100 Pa, this is more of a challenge around atmospheric pressure. Large area plasma sources operating at atmospheric pressure represent a very cost-effective solution for material processing, light sources and other applications, and a large research effort has been devoted to the development of such sources in the last ten years. Dielectric Barrier Discharges (DBDs), where one or both electrodes are covered with a dielectric layer are good candidates for atmospheric non-equilibrium plasma generation because of their ability to limit the current and power deposition. It is also much easier to control an atmospheric discharge in a small volume. Therefore an atmospheric plasma source often consists of a number of micro-discharges arranged in a way that depends on the application. Even in DBDs with large electrode areas, the plasma is generally not uniform and consists in a large number of micro-discharges or filaments. In this lecture we present a discussion of the physical properties of non-equilibrium plasmas generated in different configurations and operating at atmospheric pressure. This discussion is based on results from numerical models and simulations of Dielectric Barrier Discharges to Micro-Hollow Cathode Discharges. We then focus on specific applications such as surface DBDs for flow control. These discharges (which have some similarities with the surface micro-discharges used in Plasma Display Panels) are being studied for their ability to modify the properties of the boundary layer along airfoils and hence to control the transition between laminar and turbulent regimes. We will show how
Design of retinal-projection-based near-eye display with contact lens.
Wu, Yuhang; Chen, Chao Ping; Mi, Lantian; Zhang, Wenbo; Zhao, Jingxin; Lu, Yifan; Guo, Weiqian; Yu, Bing; Li, Yang; Maitlo, Nizamuddin
2018-04-30
We propose a design of a retinal-projection-based near-eye display for achieving ultra-large field of view, vision correction, and occlusion. Our solution is highlighted by a contact lens combo, a transparent organic light-emitting diode panel, and a twisted nematic liquid crystal panel. Its design rules are set forth in detail, followed by the results and discussion regarding the field of view, angular resolution, modulation transfer function, contrast ratio, distortion, and simulated imaging.
Automated Intelligent Monitoring and the Controlling Software System for Solar Panels
Nalamwar, H. S.; Ivanov, M. A.; Baidali, S. A.
2017-01-01
The inspection of the solar panels on a periodic basis is important to improve longevity and ensure performance of the solar system. To get the most solar potential of the photovoltaic (PV) system is possible through an intelligent monitoring & controlling system. The monitoring & controlling system has rapidly increased its popularity because of its user-friendly graphical interface for data acquisition, monitoring, controlling and measurements. In order to monitor the performance of the system especially for renewable energy source application such as solar photovoltaic (PV), data-acquisition systems had been used to collect all the data regarding the installed system. In this paper the development of a smart automated monitoring & controlling system for the solar panel is described, the core idea is based on IoT (the Internet of Things). The measurements of data are made using sensors, block management data acquisition modules, and a software system. Then, all the real-time data collection of the electrical output parameters of the PV plant such as voltage, current and generated electricity is displayed and stored in the block management. The proposed system is smart enough to make suggestions if the panel is not working properly, to display errors, to remind about maintenance of the system through email or SMS, and to rotate panels according to a sun position using the Ephemeral table that stored in the system. The advantages of the system are the performance of the solar panel system which can be monitored and analyzed.
Projection display industry market and technology trends
Castellano, Joseph A.; Mentley, David E.
1995-04-01
The projection display industry is diverse, embracing a variety of technologies and applications. In recent years, there has been a high level of interest in projection displays, particularly those using LCD panels or light valves because of the difficulty in making large screen, direct view displays. Many developers feel that projection displays will be the wave of the future for large screen HDTV (high-definition television), penetrating the huge existing market for direct view CRT-based televisions. Projection displays can have the images projected onto a screen either from the rear or the front; the main characteristic is their ability to be viewed by more than one person. In addition to large screen home television receivers, there are numerous other uses for projection displays including conference room presentations, video conferences, closed circuit programming, computer-aided design, and military command/control. For any given application, the user can usually choose from several alternative technologies. These include CRT front or rear projectors, LCD front or rear projectors, LCD overhead projector plate monitors, various liquid or solid-state light valve projectors, or laser-addressed systems. The overall worldwide market for projection information displays of all types and for all applications, including home television, will top DOL4.6 billion in 1995 and DOL6.45 billion in 2001.
Therapeutic plasma exchange: a paired comparison of Fresenius AS104 vs. COBE Spectra.
Burgstaler, E A; Pineda, A A
2001-01-01
For therapeutic plasma exchange (TPE), continuous flow separators are known to be efficient as exemplified by Fresenius AS104 and COBE Spectra. The AS104 uses an interface monitoring system in the centrifuge during TPE, whereas Spectra uses computer algorithms to establish the plasma-cell interface. To determine the plasma collection efficiency (PLCE), anticoagulant (AC) volumes used, and platelets (PLT) lost of the AS104 and the Spectra, we performed a prospective paired comparison of 20 TPE (each machine). The study included 17 patients, 1.3 plasma volume exchanges (without AC), equal inlet rates, and AC ratio of 13:1. Processing times did not include reinfuse mode. Platelet loss was determined by sampling the collection bags. Inlet rates were between 60-110 ml/min. Diagnosis included peripheral neuropathies, TTP and cryoglobulinemia. The AS104 had significantly (P<0.0001) lower average whole blood processed (F:6,601 vs. S:8,584 ml), AC volume (F:532 vs. S:719 ml), and processing time (F:80 vs. S:102 minutes) than Spectra. The AS104 had significantly (P<0.0001) higher average plasma flow rates (F:53 vs. S:44 ml/minute), plasma collection efficiency (F:90 vs. S:69%), and platelet loss (F:2.0 vs. S:0.14 x 10(11) plt) than Spectra. Platelet loss correlated with inlet flow rate with the AS104 but not with the Spectra. The AS104 has a significantly higher collection efficiency than Spectra allowing it to remove the same amount of plasma in significantly less time, by processing significantly less blood, using significantly less AC, but removing significantly more platelets than Spectra. Copyright 2001 Wiley-Liss, Inc.
2010-03-05
... the Commission may also be obtained by accessing its Internet server ( http://www.usitc.gov ). The... modules, and LCD televisions or professional displays containing the same that infringe claims 7 or 8 of..., LCD devices, including display panels and modules, and LCD televisions or professional displays...
International Nuclear Information System (INIS)
Liu, Y; Tanaka, M; Ikeba, T; Choi, S; Watanabe, T
2012-01-01
The high temperature provided by a 12-phase AC arc plasma is beneficial to finish vitrification reaction in milliseconds. Another heating method called “hybrid plasma” combines multi-phase AC arc and oxygen burner are expected to improve glass quality and increase productivity with minimum energy consumption. In this study, recent works on the development of in-flight particle measurement in hybrid plasma system are presented. Two-colour pyrometry offers considerable advantages for measuring particle temperatures in flight. A high-speed camera equipped with a band-pass filter system was applied to measure the in-flight temperatures of glass particles. The intensity recorded by the camera was calibrated using a tungsten halogen lamp. This technique also allows evaluating the fluctuation of the average particle temperature within millisecond in plasma region.
The Bilirubin Binding Panel: A Henderson-Hasselbalch Approach to Neonatal Hyperbilirubinemia.
Ahlfors, Charles E
2016-10-01
Poor plasma bilirubin binding increases the risk of bilirubin neurotoxicity in newborns with hyperbilirubinemia. New laboratory tests may soon make it possible to obtain a complete bilirubin binding panel when evaluating these babies. The 3 measured components of the panel are the plasma total bilirubin concentration (B Total ), which is currently used to guide clinical care; the bilirubin binding capacity (BBC); and the concentration of non-albumin bound or free bilirubin (B Free ). The fourth component is the bilirubin-albumin equilibrium dissociation constant, K D , which is calculated from B Total , BBC, and B Free The bilirubin binding panel is comparable to the panel of components used in the Henderson-Hasselbalch approach to acid-base assessment. Bilirubin binding population parameters (not prospective studies to determine whether the new bilirubin binding panel components are better predictors of bilirubin neurotoxicity than B Total ) are needed to expedite the clinical use of bilirubin binding. At any B Total , the B Free and the relative risk of bilirubin neurotoxicity increase as the K D /BBC ratio increases (ie, bilirubin binding worsens). Comparing the K D /BBC ratio of newborns with B Total of concern with that typical for the population helps determine whether the risk of bilirubin neurotoxicity varies significantly from the inherent risk at that B Total Furthermore, the bilirubin binding panel individualizes care because it helps to determine how aggressive intervention should be at any B Total , irrespective of whether it is above or below established B Total guidelines. The bilirubin binding panel may reduce anxiety, costs, unnecessary treatment, and the likelihood of undetected bilirubin neurotoxicity. Copyright © 2016 by the American Academy of Pediatrics.
Vision Algorithms Catch Defects in Screen Displays
2014-01-01
Andrew Watson, a senior scientist at Ames Research Center, developed a tool called the Spatial Standard Observer (SSO), which models human vision for use in robotic applications. Redmond, Washington-based Radiant Zemax LLC licensed the technology from NASA and combined it with its imaging colorimeter system, creating a powerful tool that high-volume manufacturers of flat-panel displays use to catch defects in screens.
Super long viewing distance light homogeneous emitting three-dimensional display
Liao, Hongen
2015-04-01
Three-dimensional (3D) display technology has continuously been attracting public attention with the progress in today's 3D television and mature display technologies. The primary characteristics of conventional glasses-free autostereoscopic displays, such as spatial resolution, image depths, and viewing angle, are often limited due to the use of optical lenses or optical gratings. We present a 3D display using MEMS-scanning-mechanism-based light homogeneous emitting (LHE) approach and demonstrate that the display can directly generate an autostereoscopic 3D image without the need for optical lenses or gratings. The generated 3D image has the advantages of non-aberration and a high-definition spatial resolution, making it the first to exhibit animated 3D images with image depth of six meters. Our LHE 3D display approach can be used to generate a natural flat-panel 3D display with super long viewing distance and alternative real-time image update.
Characterisation of five candidate genes within the ETEC F4ab/ac candidate region in pigs
DEFF Research Database (Denmark)
Jacobsen, Mette Juul; Cirera Salicio, Susanna; Joller, David
2011-01-01
by haplotype sharing to a 2.5 Mb region on pig chromosome 13, a region containing 18 annotated genes. FINDINGS: The coding regions of five candidate genes for susceptibility to ETEC F4ab/ac infection (TFRC, ACK1, MUC20, MUC4 and KIAA0226), all located in the 2.5 Mb region, were investigated for the presence...... polymorphism in exon 22 of KIAA0226. Transcriptional profiles of the five genes were investigated in a porcine tissue panel including various intestinal tissues. All five genes were expressed in intestinal tissues at different levels but none of the genes were found differentially expressed between ETEC F4ab/ac...... of the amino acids composition. However, we cannot exclude that the five tested genes are bona fide candidate genes for susceptibility to ETEC F4ab/ac infection since the identified polymorphism might affect the translational apparatus, alternative splice forms may exist and post translational mechanisms might...
International Nuclear Information System (INIS)
Calixto-Rodriguez, M.; Martinez, H.; Pena, Y.; Flores, O.; Esparza-Ponce, H.E.; Sanchez-Juarez, A.; Campos-Alvarez, J.; Reyes, P.
2010-01-01
As-deposited antimony sulfide thin films prepared by chemical bath deposition were treated with nitrogen AC plasma and thermal annealing in nitrogen atmosphere. The as-deposited, plasma treated, and thermally annealed antimony sulfide thin films have been characterized by X-ray diffraction (XRD), energy dispersive X-ray spectroscopy, scanning electron microscopy, atomic force microscopy, UV-vis spectroscopy, and electrical measurements. The results have shown that post-deposition treatments modify the crystalline structure, the morphology, and the optoelectronic properties of Sb 2 S 3 thin films. X-ray diffraction studies showed that the crystallinity of the films was improved in both cases. Atomic force microscopy studies showed that the change in the film morphology depends on the post-deposition treatment used. Optical emission spectroscopy (OES) analysis revealed the plasma etching on the surface of the film, this fact was corroborated by the energy dispersive X-ray spectroscopy analysis. The optical band gap of the films (E g ) decreased after post-deposition treatments (from 2.36 to 1.75 eV) due to the improvement in the grain sizes. The electrical resistivity of the Sb 2 S 3 thin films decreased from 10 8 to 10 6 Ω-cm after plasma treatments.
Recent progress in thin film processing by magnetron sputtering with plasma diagnostics
International Nuclear Information System (INIS)
Han, Jeon G
2009-01-01
The precise control of the structure and related properties becomes crucial for sophisticated applications of thin films deposited by magnetron sputtering in emerging industries including the flat panel display, digital electronics and nano- and bio-industries. The film structure is closely related to the total energy delivered to the substrate surface for nucleation and growth during all kinds of thin film processes, including magnetron sputtering. Therefore, the energy delivered to the surface for nucleation and growth during magnetron sputtering should be measured and analysed by integrated diagnostics of the plasma parameters which are closely associated with the process parameters and other external process conditions. This paper reviews the background of thin film nucleation and growth, the status of magnetron sputtering technology and the progress of plasma diagnostics for plasma processing. The evolution of the microstructure during magnetron sputtering is then discussed with respect to the change in the process variables in terms of the plasma parameters along with empirical data of the integrated plasma diagnostics for various magnetron sputtering conditions with conventional dc, pulsed dc and high power pulsed dc sputtering modes. Among the major energy terms to be discussed are the temperature change in the top surface region and the energies of ions and neutral species. (topical review)
Electric field strength in a Xe-Ne glow discharge
Visser, B.; Hayashi, D.; Kroesen, G.M.W.; Stoffels, W.W.
2001-01-01
Many applications of plasma physics are related to light generation. The applications range from TL-tubes until the latest flat displays. The size of discharges is decreasing further and further. At this moment the typical dimensions of a plasma display panel cell are in the order of 100 µm. A model
International Nuclear Information System (INIS)
Peacock, A.; Girlinger, A.; Vorkoeper, A.; Boscary, J.; Greuner, H.; Hurd, F.; Mendelevitch, B.; Pirsch, H.; Stadler, R.; Zangl, G.
2011-01-01
320 In-vessel water cooled stainless steel panels, poloidal closure plates and pumping gap panels, covering an area of approximately 100 m 2 , are used in Wendelstein7-X to protect the plasma vessel. The panels are manufactured at Deggendorf, Germany by MAN Diesel and Turbo SE. The panels consist of a laser welded sandwich of stainless steel plates together with a labyrinth of cooling channels and have a complicated geometry to fit the plasma vessel of Wendelstein 7-X. The hydraulic and mechanical stability requirements whilst maintaining the tight tolerances for the shape of the components are very demanding. The panels are designed to operate at up to an average heat load of 100 kW/m 2 and a maximum heat load of 200 kW/m 2 with a water velocity of approximately 2 m s -1 . High heat flux testing of an un-cooled panel at a time averaged load of 200 kW/m 2 for 10 s were successfully performed to support the start up phase of Wendelstein 7-X operation. Extensive testing both during manufacture and after delivery to IPP-Garching demonstrates the suitability of the delivered panels for their purpose.
Li, Min; Zhu, Min; Zhang, Cunzheng; Liu, Xianjin; Wan, Yakun
2014-01-01
Nanobodies are the smallest natural fragments with useful properties such as high affinity, distinct paratope and high stability, which make them an ideal tool for detecting target antigens. In this study, we generated and characterized nanobodies against the Cry1Ac toxin and applied them in a biotin-streptavidin based double antibodies (nanobodies) sandwich-ELISA (DAS-ELISA) assay. After immunizing a camel with soluble Cry1Ac toxin, a phage displayed library was constructed to generate Nbs against the Cry1Ac toxin. Through successive rounds of affinity bio-panning, four nanobodies with greatest diversity in CDR3 sequences were obtained. After affinity determination and conjugating to HRP, two nanobodies with high affinity which can recognize different epitopes of the same antigen (Cry1Ac) were selected as capture antibody (Nb61) and detection antibody (Nb44). The capture antibody (Nb61) was biotinylated in vivo for directional immobilization on wells coated with streptavidin matrix. Both results of specificity analysis and thermal stability determination add support for reliability of the following DAS-ELISA with a minimum detection limit of 0.005 μg·mL−1 and a working range 0.010–1.0 μg·mL−1. The linear curve displayed an acceptable correlation coefficient of 0.9976. These results indicated promising applications of nanobodies for detection of Cry1Ac toxin with biotin-streptavidin based DAS-ELISA system. PMID:25474492
Directory of Open Access Journals (Sweden)
Min Li
2014-12-01
Full Text Available Nanobodies are the smallest natural fragments with useful properties such as high affinity, distinct paratope and high stability, which make them an ideal tool for detecting target antigens. In this study, we generated and characterized nanobodies against the Cry1Ac toxin and applied them in a biotin-streptavidin based double antibodies (nanobodies sandwich-ELISA (DAS-ELISA assay. After immunizing a camel with soluble Cry1Ac toxin, a phage displayed library was constructed to generate Nbs against the Cry1Ac toxin. Through successive rounds of affinity bio-panning, four nanobodies with greatest diversity in CDR3 sequences were obtained. After affinity determination and conjugating to HRP, two nanobodies with high affinity which can recognize different epitopes of the same antigen (Cry1Ac were selected as capture antibody (Nb61 and detection antibody (Nb44. The capture antibody (Nb61 was biotinylated in vivo for directional immobilization on wells coated with streptavidin matrix. Both results of specificity analysis and thermal stability determination add support for reliability of the following DAS-ELISA with a minimum detection limit of 0.005 μg·mL−1 and a working range 0.010–1.0 μg·mL−1. The linear curve displayed an acceptable correlation coefficient of 0.9976. These results indicated promising applications of nanobodies for detection of Cry1Ac toxin with biotin-streptavidin based DAS-ELISA system.
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
2012-07-09
...: Glass partitions. Glass attached to the ceiling. Wall/door mounted mirrors/glass panels. Discussion The... monitor screens such as liquid crystal display (LCD) or plasma displays. These glass items may be...
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
Computer soundcard as an AC signal generator and oscilloscope for the physics laboratory
Sinlapanuntakul, Jinda; Kijamnajsuk, Puchong; Jetjamnong, Chanthawut; Chotikaprakhan, Sutharat
2018-01-01
The purpose of this paper is to develop both an AC signal generator and a dual-channel oscilloscope based on standard personal computer equipped with sound card as parts of the laboratory of the fundamental physics and the introduction to electronics classes. The setup turns the computer into the two channel measured device which can provides sample rate, simultaneous sampling, frequency range, filters and others essential capabilities required to perform amplitude, phase and frequency measurements of AC signal. The AC signal also generate from the same computer sound card output simultaneously in any waveform such as sine, square, triangle, saw-toothed pulsed, swept sine and white noise etc. These can convert an inexpensive PC sound card into powerful device, which allows the students to measure physical phenomena with their own PCs either at home or at university attendance. A graphic user interface software was developed for control and analysis, including facilities for data recording, signal processing and real time measurement display. The result is expanded utility of self-learning for the students in the field of electronics both AC and DC circuits, including the sound and vibration experiments.
Application of industrial robots in automatic disassembly line of waste LCD displays
Wang, Sujuan
2017-11-01
In the automatic disassembly line of waste LCD displays, LCD displays are disassembled into plastic shells, metal shields, circuit boards, and LCD panels. Two industrial robots are used to cut metal shields and remove circuit boards in this automatic disassembly line. The functions of these two industrial robots, and the solutions to the critical issues of model selection, the interfaces with PLCs and the workflows were described in detail in this paper.
Report of panel 3: Concept improvement
International Nuclear Information System (INIS)
Dean, S.O.; Ripin, B.H.; Batchelor, D.; Berkner, K.; Kaye, S.M.; Logan, B.G.; Marmar, E.; Navratil, G.; Ellis, W.R.; Gentle, K.W.
1992-01-01
The charge to Panel 3 was to look at the idea of concept improvements in the context of US DOE management of the magnetic fusion program. The panel suggested that if DOE were commited to the idea of concept improvement, it needed to overcome the existing impression it was not receptive to new ideas. In part the long time scale for development of fusion energy, coupled with the rate of change of scientific programs and research based on emerging knowledge, means that in general the program will be much different ten to twenty years in the future. To be able to meet this changing direction, the US program must maintain an openness to look at promising alternative ideas, spend money on developing the ideas, and consider funding some to intermediate development levels. Stellerator research was offered as one alternative to consider in light of present international work. The panel urged supporting the development of new concepts and ideas, as well as continued support for plasma physics basic research
Augmented reality glass-free three-dimensional display with the stereo camera
Pang, Bo; Sang, Xinzhu; Chen, Duo; Xing, Shujun; Yu, Xunbo; Yan, Binbin; Wang, Kuiru; Yu, Chongxiu
2017-10-01
An improved method for Augmented Reality (AR) glass-free three-dimensional (3D) display based on stereo camera used for presenting parallax contents from different angle with lenticular lens array is proposed. Compared with the previous implementation method of AR techniques based on two-dimensional (2D) panel display with only one viewpoint, the proposed method can realize glass-free 3D display of virtual objects and real scene with 32 virtual viewpoints. Accordingly, viewers can get abundant 3D stereo information from different viewing angles based on binocular parallax. Experimental results show that this improved method based on stereo camera can realize AR glass-free 3D display, and both of virtual objects and real scene have realistic and obvious stereo performance.
Toward Plasma-Assisted Ignition in Scramjets
National Research Council Canada - National Science Library
Jacobsen, Lance S; Carter, Campbell D; Baurie, Robert A; Jackson, Thomas A
2003-01-01
.... The two plasma torches currently under investigation consist of a DC constricted-arc design from the Virginia Polytechnic Institute and State University and an AC unconstricted-arc design based...
Display of a Maize cDNA library on baculovirus infected insect cells
Directory of Open Access Journals (Sweden)
Jones Ian M
2008-08-01
Full Text Available Abstract Background Maize is a good model system for cereal crop genetics and development because of its rich genetic heritage and well-characterized morphology. The sequencing of its genome is well advanced, and new technologies for efficient proteomic analysis are needed. Baculovirus expression systems have been used for the last twenty years to express in insect cells a wide variety of eukaryotic proteins that require complex folding or extensive posttranslational modification. More recently, baculovirus display technologies based on the expression of foreign sequences on the surface of Autographa californica (AcMNPV have been developed. We investigated the potential of a display methodology for a cDNA library of maize young seedlings. Results We constructed a full-length cDNA library of young maize etiolated seedlings in the transfer vector pAcTMVSVG. The library contained a total of 2.5 × 105 independent clones. Expression of two known maize proteins, calreticulin and auxin binding protein (ABP1, was shown by western blot analysis of protein extracts from insect cells infected with the cDNA library. Display of the two proteins in infected insect cells was shown by selective biopanning using magnetic cell sorting and demonstrated proof of concept that the baculovirus maize cDNA display library could be used to identify and isolate proteins. Conclusion The maize cDNA library constructed in this study relies on the novel technology of baculovirus display and is unique in currently published cDNA libraries. Produced to demonstrate proof of principle, it opens the way for the development of a eukaryotic in vivo display tool which would be ideally suited for rapid screening of the maize proteome for binding partners, such as proteins involved in hormone regulation or defence.
An Advanced Diagnostic Display for Core Protection Calculator System
Energy Technology Data Exchange (ETDEWEB)
Kim, Ji-Hyeon; Jeong, See-Chae; Sohn, Se-Do [Korea Power Engineering Company, Daejeon (Korea, Republic of)
2008-10-15
The main purpose of a Nuclear Power Plant Instrumentation and Control (I and C) Display System is to provide operator's interface for I and C systems. The CPCS display(Shin-Kori 1 and 2) provides operators with 1) plant monitoring values of field input and algorithm variables that reflect the reactor core conditions, 2) operation values that operators can change and 3) CPCS status. It will be an optimal case if operators can understand the plant (including CPCS itself) condition intuitively with the displayed values but it is not easy in CPCS. For example, if the CPCS Channel Trouble light is lit, operators need some amount of time to investigate what caused the trouble light because there are more than hundred causes that can generate the channel trouble. If a Display supports diagnostic information that shows what cause the displayed alarms, it will greatly help operators in easy understanding the CPCS status. To provide these diagnostic information, this paper suggests an active self-explanatory display mechanism. This self-explanatory diagnostic display mechanism utilizes an ontology in XML that describes parent child, sibling relationships of display variables, through which in-depth, in-breadth diagnostic tracking is possible. This paper consists of two parts. First, the key features of CPCS Flat Panel Display System (FPDS) are described. Second, the features of active self explanatory diagnostic display are discussed.
An Advanced Diagnostic Display for Core Protection Calculator System
International Nuclear Information System (INIS)
Kim, Ji-Hyeon; Jeong, See-Chae; Sohn, Se-Do
2008-01-01
The main purpose of a Nuclear Power Plant Instrumentation and Control (I and C) Display System is to provide operator's interface for I and C systems. The CPCS display(Shin-Kori 1 and 2) provides operators with 1) plant monitoring values of field input and algorithm variables that reflect the reactor core conditions, 2) operation values that operators can change and 3) CPCS status. It will be an optimal case if operators can understand the plant (including CPCS itself) condition intuitively with the displayed values but it is not easy in CPCS. For example, if the CPCS Channel Trouble light is lit, operators need some amount of time to investigate what caused the trouble light because there are more than hundred causes that can generate the channel trouble. If a Display supports diagnostic information that shows what cause the displayed alarms, it will greatly help operators in easy understanding the CPCS status. To provide these diagnostic information, this paper suggests an active self-explanatory display mechanism. This self-explanatory diagnostic display mechanism utilizes an ontology in XML that describes parent child, sibling relationships of display variables, through which in-depth, in-breadth diagnostic tracking is possible. This paper consists of two parts. First, the key features of CPCS Flat Panel Display System (FPDS) are described. Second, the features of active self explanatory diagnostic display are discussed
Energy Technology Data Exchange (ETDEWEB)
Peacock, A., E-mail: alan.peacock@ipp.mpg.de [European Commission c/o Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, 85748 Garching (Germany); Girlinger, A. [MAN Diesel and Turbo SE D-94469 Deggendorf (Germany); Vorkoeper, A. [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, 17491 Greifswald (Germany); Boscary, J.; Greuner, H. [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, 85748 Garching (Germany); Hurd, F. [European Commission c/o Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, 85748 Garching (Germany); Mendelevitch, B.; Pirsch, H.; Stadler, R.; Zangl, G. [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, 85748 Garching (Germany)
2011-10-15
320 In-vessel water cooled stainless steel panels, poloidal closure plates and pumping gap panels, covering an area of approximately 100 m{sup 2}, are used in Wendelstein7-X to protect the plasma vessel. The panels are manufactured at Deggendorf, Germany by MAN Diesel and Turbo SE. The panels consist of a laser welded sandwich of stainless steel plates together with a labyrinth of cooling channels and have a complicated geometry to fit the plasma vessel of Wendelstein 7-X. The hydraulic and mechanical stability requirements whilst maintaining the tight tolerances for the shape of the components are very demanding. The panels are designed to operate at up to an average heat load of 100 kW/m{sup 2} and a maximum heat load of 200 kW/m{sup 2} with a water velocity of approximately 2 m s{sup -1}. High heat flux testing of an un-cooled panel at a time averaged load of 200 kW/m{sup 2} for 10 s were successfully performed to support the start up phase of Wendelstein 7-X operation. Extensive testing both during manufacture and after delivery to IPP-Garching demonstrates the suitability of the delivered panels for their purpose.
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
Comparison of high-voltage ac and pulsed operation of a surface dielectric barrier discharge
Williamson, James M.; Trump, Darryl D.; Bletzinger, Peter; Ganguly, Biswa N.
2006-10-01
A surface dielectric barrier discharge (DBD) in atmospheric pressure air was excited either by low frequency (0.3-2 kHz) high-voltage ac or by short, high-voltage pulses at repetition rates from 50 to 600 pulses s-1. The short-pulse excited discharge was more diffuse and did not have the pronounced bright multiple cathode spots observed in the ac excited discharge. The discharge voltage, current and average power deposited into the discharge were calculated for both types of excitation. As a measure of plasma-chemical efficiency, the ozone number density was measured by UV absorption as a function of average deposited power. The density of ozone produced by ac excitation did not increase so rapidly as that produced by short-pulse excitation as a function of average power, with a maximum measured density of ~3 × 1015 cm-3 at 25 W. The maximum ozone production achieved by short-pulse excitation was ~8.5 × 1015 cm-3 at 20 W, which was four times greater than that achieved by ac excitation at the same power level.
Ekrami, Yasamin; Cook, Joseph S.
2011-01-01
In order to mitigate catastrophic failures on future generation space vehicles, engineers at the National Aeronautics and Space Administration have begun to integrate a novel crew abort systems that could pull a crew module away in case of an emergency at the launch pad or during ascent. The Max Launch Abort System (MLAS) is a recent test vehicle that was designed as an alternative to the baseline Orion Launch Abort System (LAS) to demonstrate the performance of a "tower-less" LAS configuration under abort conditions. The MLAS II test vehicle will execute a propulsive coast stabilization maneuver during abort to control the vehicles trajectory and thrust. To accomplish this, the spacecraft will integrate an Attitude Control System (ACS) with eight hypergolic monomethyl hydrazine liquid propulsion engines that are capable of operating in a quick pulsing mode. Two main elements of the ACS include a propellant distribution subsystem and a pressurization subsystem to regulate the flow of pressurized gas to the propellant tanks and the engines. The CAD assembly of the Attitude Control System (ACS) was configured and integrated into the Launch Abort Vehicle (LAV) design. A dynamic random vibration analysis was conducted on the Main Propulsion System (MPS) helium pressurization panels to assess the response of the panel and its components under increased gravitational acceleration loads during flight. The results indicated that the panels fundamental and natural frequencies were farther from the maximum Acceleration Spectral Density (ASD) vibrations which were in the range of 150-300 Hz. These values will direct how the components will be packaged in the vehicle to reduce the effects high gravitational loads.
Generation of radiation by intense plasma and electromagnetic undulators
Energy Technology Data Exchange (ETDEWEB)
Joshi, C.
1991-10-01
We examine the characteristics of the classical radiation emission resulting from the interaction of a relativistic electron beam that propagates perpendicularly through a large amplitude relativistic plasma wave. Such a study is useful for evaluating the feasibility of using relativistic plasma waves as extremely short wavelength undulators for generating short wavelength radiation. The electron trajectories in a plasma wave undulator and in an ac FEL undulator are obtained using perturbation techniques. The spontaneous radiation frequency spectrum and angular distribution emitted by a single electron oscillating in these two undulators are then calculated. The radiation gain of a copropagating electromagnetic wave is calculated. The approximate analytic results for the trajectories, spontaneous radiation and gain are compared with 3-D simulation results. The characteristics of the plasma wave undulator are compared with the ac FEL undulator and linearly polarized magnetic undulator. 50 refs., 26 figs., 3 tabs.
Generation of radiation by intense plasma and electromagnetic undulators
International Nuclear Information System (INIS)
Joshi, C.
1991-10-01
We examine the characteristics of the classical radiation emission resulting from the interaction of a relativistic electron beam that propagates perpendicularly through a large amplitude relativistic plasma wave. Such a study is useful for evaluating the feasibility of using relativistic plasma waves as extremely short wavelength undulators for generating short wavelength radiation. The electron trajectories in a plasma wave undulator and in an ac FEL undulator are obtained using perturbation techniques. The spontaneous radiation frequency spectrum and angular distribution emitted by a single electron oscillating in these two undulators are then calculated. The radiation gain of a copropagating electromagnetic wave is calculated. The approximate analytic results for the trajectories, spontaneous radiation and gain are compared with 3-D simulation results. The characteristics of the plasma wave undulator are compared with the ac FEL undulator and linearly polarized magnetic undulator. 50 refs., 26 figs., 3 tabs
Efficiency Enhancement in DC Pulsed Gas Discharge Memory Panel
Okamoto, Yukio
1983-01-01
Much improvement in the luminous efficiency of a dc pulsed gas discharge memory panel for color TV display was achieved by shortening the sustaining pulse duration. High energy electrons can thus be produced in the pulsed discharge with fast rise times. Calculated optimum value of E/P in a Xe gas discharge is 7-8 V/cm\\cdotTorr.
PUREX (SAMCONS) uninterruptible power supply (UPS) acceptance test procedure
International Nuclear Information System (INIS)
Blackaby, W.B.
1997-01-01
This Acceptance Test Procedure for the PUREX Surveillance and Monitoring and Control System (SAMCONS) Uninterruptible Power Supply (UPS) provides for testing and verifying the proper operation of the control panel alarms and trouble functions, the 6roper functioning of the AC inverter, ability of the battery supply to maintain the SAMCONS load for a minimum of two hours , and proper interaction with the SAMCONS Video graphic displays for alarm displays
Visualizing climate data on a tiled panel display: A user-centered approach
Zudilova-Seinstra, E.V.; Adriaanse, J.; Berg, A.
2008-01-01
Scientific experimentation related to analysis and prediction of climate changes is highly dynamic and requires various data to be processed simultaneously, including results of statistical modeling. Small displays often do not allow scientists to gain optimal access to these data due to the limited
Immobilization/hybridization of amino-modified DNA on plasma-polymerized allyl chloride
International Nuclear Information System (INIS)
Zhang Zhihong; Feng Chuanliang
2007-01-01
The present work describes the fabrication and characterization of chloride-derivatized polymer coatings prepared by continuous wave (cw) plasma polymerization as adhesion layers in DNA immobilization/hybridization. The stability of plasma-polymerized allyl chloride (ppAC) in H 2 O was characterized by variation of the thickness of polymer films and its wettability was examined by water contact angle technique. Fourier transform infrared spectroscopy (FTIR) and X-ray photoelectron spectroscopy (XPS) were used to study polymer matrix properties and oligonucleotide/DNA binding interaction. With the same carrier gas rate and process pressure, plasma polymers deposited at different input powers show various comparable immobilization properties; nevertheless, low input power plasma-polymerized films gives a lower sensitivity toward DNA binding than that from high input power plasma-deposited films. The following DNA immobilization on chloride-functionalized surfaces was found dependence on the macromolecular architecture of the plasma films. The hybridization between probe DNA and total mismatch target DNA shows no non-specific adsorption between target and ppAC
AC magnetic measurements of the ALS Booster Synchrotron Dipole Magnet engineering model
International Nuclear Information System (INIS)
Green, M.I.; Hoyer, E.; Keller, R.; Nelson, D.H.
1988-09-01
We made a minimal set of AC magnetic measurements of the engineering model of the ALS Booster Dipole Magnet as part of the process of qualifying its design for production. Magnetic induction integrals over paths approximating electron-beam trajectories were measured with long curved coils connected to an electronic integrator. Magnetic induction was measured with point coils and an integrator and independently with a Hall-effect Gaussmeter. These quantities, and magnet current, were displayed on a commercial digital storage oscilloscope as parametric functions of time. The displayed waveforms were stored, processed and redisplayed as representations of selected magnet parameters. A waveform representing the magnet's effective-length was created by dividing the integral waveform by the magnetic induction waveform. Waveforms of the transfer functions were produced by dividing both the integral waveform and the magnetic induction waveform by the current waveform. Pairs of matched coils, connected in series opposition, provided differential measurements of field uniformity. Quadrupole and sextupole coefficients were derived from the uniformity data. These magnet parameters were measured at 2 and 10 Hz frequencies. Together with measurements of the magnetic field at selected dc levels, the ac measurements demonstrated that the magnet design met specifications and qualified it for production. 7 refs., 7 figs., 3 tabs
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
Microprocessor based beam intensity and efficiency display system for the Fermilab accelerator
International Nuclear Information System (INIS)
Biwer, R.
1979-01-01
The Main Accelerator display system for the Fermilab accelerator gathers charge data and displays it including processed transfer efficiencies of each of the accelerators. To accomplish this, strategically located charge converters monitor the circulating internal beam of each of the Fermilab accelerators. Their outputs are processed via an asynchronously triggered, multiplexed analog-to-digital converter. The data is converted into a digital byte containing address code and data, then stores it into two 16-bit memories. One memory outputs the interleaved data as a data pulse train while the other interfaces directly to a local host computer for further analysis. The microprocessor based display unit synchronizes displayed data during normal operation as well as special storage modes. The display unit outputs data to the fron panel in the form of a numeric value and also makes digital-to-analog conversions of displayed data for external peripheral devices. 5 refs
International Nuclear Information System (INIS)
Kim, Hyunmyung; Lee, Ho Jung; Kim, Sung Hwan; Jang, Changheui
2016-01-01
Highlights: • Plasma thermal performance of a dual-process PVD/PS W coating was evaluated. • Steady-state heat fluxes of 1–3 MW/m 2 were applied to the W coated specimens. • Less micro-pores and grain growth were observed for the dual-process coating. • Loss of coating thickness was observed for the simple PS W coating. • Dual-process PVD/PS W coating was resistant to erosion due to the surface PVD layer. - Abstract: Various tungsten (W) coating techniques have been used for the application of plasma facing material in nuclear fusion devices, which resulted in limited success. In this study, a dual-process W coating structure was developed on a graphite substrate to improve the thermal performance of the coating structure. The dual-process coating structure consisted of a thin (∼7 μm) multilayer W/Mo physical vapor deposition (PVD) coating layer deposited on top of the relatively thick (∼160 μm) plasma spray (PS) W coating on a graphite substrate panel. Then the coated sample was exposed to plasma heat flux of 1–3 MW/m 2 for 300 s. With addition of a thin surface PVD coating layer, the microstructure change in underlying PS W coating was substantially reduced compared to the simple PS W coating structure. The thickness of overall coating structure was maintained for the dual-process PVD/PS coated samples after the thermal loading tests, while a significant reduction in thickness due to surface erosion was observed for the simple PS W coated samples. The improvement in surface erosion resistance in the dual-process coating structure was discussed in view of the characteristics of PVD and PS coating layers.
Energy Technology Data Exchange (ETDEWEB)
Kim, Hyunmyung; Lee, Ho Jung; Kim, Sung Hwan; Jang, Changheui, E-mail: chjang@kaist.ac.kr
2016-11-01
Highlights: • Plasma thermal performance of a dual-process PVD/PS W coating was evaluated. • Steady-state heat fluxes of 1–3 MW/m{sup 2} were applied to the W coated specimens. • Less micro-pores and grain growth were observed for the dual-process coating. • Loss of coating thickness was observed for the simple PS W coating. • Dual-process PVD/PS W coating was resistant to erosion due to the surface PVD layer. - Abstract: Various tungsten (W) coating techniques have been used for the application of plasma facing material in nuclear fusion devices, which resulted in limited success. In this study, a dual-process W coating structure was developed on a graphite substrate to improve the thermal performance of the coating structure. The dual-process coating structure consisted of a thin (∼7 μm) multilayer W/Mo physical vapor deposition (PVD) coating layer deposited on top of the relatively thick (∼160 μm) plasma spray (PS) W coating on a graphite substrate panel. Then the coated sample was exposed to plasma heat flux of 1–3 MW/m{sup 2} for 300 s. With addition of a thin surface PVD coating layer, the microstructure change in underlying PS W coating was substantially reduced compared to the simple PS W coating structure. The thickness of overall coating structure was maintained for the dual-process PVD/PS coated samples after the thermal loading tests, while a significant reduction in thickness due to surface erosion was observed for the simple PS W coated samples. The improvement in surface erosion resistance in the dual-process coating structure was discussed in view of the characteristics of PVD and PS coating layers.
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
Third-Generation Display Technology: Nominally Transparent Material
Directory of Open Access Journals (Sweden)
Charles Willow
2010-12-01
Full Text Available Display technology is reshaping the consumer, business, government, and even not-for-profit markets in the midst of the digital convergence, coupled with recent smart phones led by Apple, Inc. First-Generation (1G display technology was dominated by the Cathode Ray Tubes, followed by Liquid Crystal Display and Plasma in 2G. A radically innovative shift as a disruptive technology is expected to follow in 3G to utilize virtually any transparent material, which wirelessly connects to portable access points. This paper studies the feasibility of the 3G Display Technology (DT with Technology S-Curves, and presents possible business models and technology strategies which may be generated from it. Additional subsets of business models may be derived for a wide range of industry applications.
ISTTOK plasma control with the tomography diagnostic
Energy Technology Data Exchange (ETDEWEB)
Fernandes, H.; Caralho, P.J.; Duarte, P.; Pereira, T.; Coelho, R.; Silva, C. [Association Euratom/IST, Institute of Plasmas and Nuclear Fusion, Technology Graduate Institute, P-1049-001 Lisbon (Portugal)
2011-07-01
A real-time plasma position control system is mandatory to achieve long duration (up to 250 ms), Alternating Current (AC) discharges on the ISTTOK tokamak. Such a system has been used for some time supported only on magnetic field diagnostic data. However, this system does not function accurately when the plasma current is low, rendering it inoperative during the plasma current reversal. A tomography diagnostic with 3 pinhole cameras and 8 silicone photodiode channels per camera was installed and customized to supply alternative plasma position to be used for plasma position control. As no filtering is applied, most of the radiation detected is in the visible/near-UV range. This system (i) executes a tomographic reconstruction, (ii) determines the average emissivity position from it, (iii) calculates the shift from the required position and (iv) supplies the vertical field power supply unit with the desired current value, all in less than 100 {mu}s. The horizontal magnetic field power supply unit is expected to be included in the system and will have no impact in the process time. This paper presents the tomography diagnostic architecture together with results of its scientific exploitation in ISTTOK AC discharges, where it has proven to be capable of supplying an accurate plasma position during the current reversal. The use of the tomography diagnostic for plasma position overcomes some limitations of the magnetic diagnostics, but poses challenges of its own such as blindness to plasma current direction. (authors)
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
Directory of Open Access Journals (Sweden)
I. O. Zharinov
2015-05-01
Full Text Available Subject of research. The problem of software-based compensation of technological variation in chromaticity coordinates of liquid crystal panels is considered. A method of software-based compensation of technological variation in chromaticity coordinates is proposed. The method provides the color reproduction characteristics of the series-produced samples on-board indication equipment corresponding to the sample equipment, which is taken as the standard. Method. Mathematical calculation of the profile is performed for the given model of the liquid crystal panel. The coefficients that correspond to the typical values of the chromaticity coordinates for the vertices of the triangle color coverage constitute a reference mathematical model of the plate LCD panel from a specific manufacturer. At the stage of incoming inspection the sample of the liquid crystal panel, that is to be implemented within indication equipment, is mounted on the lighting test unit, where Nokia-Test control is provided by the formation of the RGB codes for display the image of a homogeneous field in the red, green, blue and white. The measurement of the (x,y-chromaticity coordinates in red, green, blue and white colors is performed using a colorimeter with the known value of absolute error. Instead of using lighting equipment, such measurements may be carried out immediately on the sample indication equipment during customizing procedure. The measured values are used to calculate individual LCD-panel profile coefficients through the use of Grassman's transformation, establishing mutual relations between the XYZ-color coordinates and RGB codes to be used for displaying the image on the liquid crystal panel. The obtained coefficients are to be set into the memory of the graphics controller together with the functional software and then used for image displaying. Main results. The efficiency of the proposed method of software-based compensation for technological variation of
CANDU 9 operator plant display system
International Nuclear Information System (INIS)
Trueman, R.; Webster, A.; MacBeth, M.J.
1997-01-01
To meet evolving client and regulatory needs, AECL has adopted an evolutionary approach to the design of the CANDU 9 control centre. That is, the design incorporates feedback from existing stations, reflects the growing diversity in the roles and responsibilities of the operating staff, and reduces costs associated with plant capital and operations, maintenance and administration (OM and A), through the appropriate introduction of new technologies. Underlying this approach is a refined engineering design process that cost-effectively integrates operational feedback and human factors engineering to define the operating staff information and information presentation requirements. Based on this approach, the CANDU 9 control centre will provide utility operating staff with the means to achieve improved operations and reduced OM and A costs. One of the design features that will contribute to the improved operational capabilities of the control centre is a new Plant Display System (PDS) that is separate from the digital control system. The PDS will be used to implement non-safety panel, and console video display systems within the CANDU 9 main control room (MCR). This paper presents a detailed description of the CANDU 9 Plant Display System and features that provide increased operational capabilities. (author)
International Nuclear Information System (INIS)
Yuan, Tao; Bae, Suk Joo; Zhu, Xiaoyan
2016-01-01
Motivated by the two-phase degradation phenomena observed in light displays (e.g., plasma display panels (PDPs), organic light emitting diodes (OLEDs)), this study proposes a new degradation-based burn-in testing plan for display products exhibiting two-phase degradation patterns. The primary focus of the burn-in test in this study is to eliminate the initial rapid degradation phase, while the major purpose of traditional burn-in tests is to detect and eliminate early failures from weak units. A hierarchical Bayesian bi-exponential model is used to capture two-phase degradation patterns of the burn-in population. Mission reliability and total cost are introduced as planning criteria. The proposed burn-in approach accounts for unit-to-unit variability within the burn-in population, and uncertainty concerning the model parameters, mainly in the hierarchical Bayesian framework. Available pre-burn-in data is conveniently incorporated into the burn-in decision-making procedure. A practical example of PDP degradation data is used to illustrate the proposed methodology. The proposed method is compared to other approaches such as the maximum likelihood method or the change-point regression. - Highlights: • We propose a degradation-based burn-in test for products with two-phase degradation. • Mission reliability and total cost are used as planning criteria. • The proposed burn-in approach is built within the hierarchical Bayesian framework. • A practical example was used to illustrate the proposed methodology.
Fukasawa, Hirotoshi; Horiuchi, Toshiyuki
2009-08-01
The patterning characteristics of matrix projection exposure using an analog liquid crystal display (LCD) panel in place of a reticle were investigated, in particular for oblique patterns. In addition, a new method for fabricating practical thick resist molds was developed. At first, an exposure system fabricated in past research was reconstructed. Changes in the illumination optics and the projection lens were the main improvements. Using fly's eye lenses, the illumination light intensity distribution was homogenized. The projection lens was changed from a common camera lens to a higher-grade telecentric lens. In addition, although the same metal halide lamp was used as an exposure light source, the central exposure wavelength was slightly shortened from 480 to 450 nm to obtain higher resist sensitivity while maintaining almost equivalent contrast between black and white. Circular and radial patterns with linewidths of approximately 6 µm were uniformly printed in all directions throughout the exposure field owing to these improvements. The patterns were smoothly printed without accompanying stepwise roughness caused by the cell matrix array. On the bases of these results, a new method of fabricating thick resist molds for electroplating was investigated. It is known that thick resist molds fabricated using the negative resist SU-8 (Micro Chem) are useful because very high aspect patterns are printable and the side walls are perpendicular to the substrate surfaces. However, the most suitable exposure wavelength of SU-8 is 365 nm, and SU-8 is insensitive to light of 450 nm wavelength, which is most appropriate for LCD matrix exposure. For this reason, a novel multilayer resist process was proposed, and micromolds of SU-8 of 50 µm thickness were successfully obtained. As a result, feasibility for fabricating complex resist molds including oblique patterns was demonstrated.
The density and velocity of plasma bullets propagating along one dielectric tube
Directory of Open Access Journals (Sweden)
Longfei Ji
2015-08-01
Full Text Available This study shows that the propagation of plasma bullets along one dielectric tube is strongly affected by many discharge parameters, such as the waveform of applied voltage (AC or pulsed DC, peak voltage, He flow rate, and the frequency of AC voltage. Analysis indicates that the density and velocity of plasma bullets are mainly determined by the electric field at the front of plasma bullets. These discharge parameters may significantly influence the distribution of plasma potential along the tube, thus control the electric field at the front of plasma bullets and their propagation. An increase in the pulsed DC voltage with its rise time of <40-50 ns can lead to an obvious improvement in the electric field at the front of plasma bullets, resulting in generation of a plasma in the high density gas and a fast propagation of plasma bullets. He flowing through the tube can contribute to the surface diffusion of charged species, and greatly increase the electric field at the front of plasma bullets. During the propagation of plasma bullets, their density is decreased due to the surface recombination of charged species, such as electrons and ions.
GOES-K solar panel inspection at Astrotech
1997-01-01
Space Systems/LORAL employees inspect solar panels for the GOES-K weather satellite in the Astrotech facility at Titusville, Fla., as they begin final testing of the imaging system, communications and power systems of the spacecraft. The GOES-K is the third spacecraft to be launched in the new advanced series of geostationary weather satellites for the National Oceanic and Atmospheric Administration (NOAA). The GOES-K is built for NASA and NOAA by Space Systems/LORAL of Palo Alto, Calif. The launch of the satellite from Launch Pad 36B at Cape Canaveral Air Station on an Atlas 1 rocket (AC-79) is currently planned for Apr. 24 at the opening of a launch window which extends from 1:56 to 3:19 a.m. EDT.
Wang, Jin-Sook; Kee, Mee-Kyung; Choi, Byeong-Sun; Kim, Chan-Wha; Kim, Hyon-Suk; Kim, Sung Soon
2012-01-01
The external quality assessment schemes (EQAS) organizer provides a suitable program to monitor and improve the quality of human immunodeficiency virus (HIV) testing laboratories with EQAS panels prepared under various conditions. The aim of the current study was to investigate the effects of human plasma samples on the EQAS results of HIV obtained from hospital-based clinical laboratories. From 2007 to 2009, HIV EQAS panels consisted of four to six samples that consisted of undiluted positive and negative samples and were provided to laboratories twice per year. Up until the first half EQAS in 2008, EQAS panel materials were obtained by converting acid citrate dextrose treated plasma to serum via chemical treatment with CaCl2. Beginning with the second EQAS in 2008, all materials were prepared without the defibrination process. Approximately 300 HIV clinical laboratories participated in this program. The overall performance of clinical laboratories was shown to be improved when using unrecalcified plasma panels compared with recalcified panels. Significant differences were observed in EIA analyses of plasma for both positive (plaboratories.
Comparison of high-voltage ac and pulsed operation of a surface dielectric barrier discharge
Energy Technology Data Exchange (ETDEWEB)
Williamson, James M [Innovative Scientific Solutions, Inc., 2766 Indian Ripple Road, Dayton, Ohio 45440-3638 (United States); Trump, Darryl D [Innovative Scientific Solutions, Inc., 2766 Indian Ripple Road, Dayton, Ohio 45440-3638 (United States); Bletzinger, Peter [Innovative Scientific Solutions, Inc., 2766 Indian Ripple Road, Dayton, Ohio 45440-3638 (United States); Ganguly, Biswa N [Air Force Research Laboratory, Wright-Patterson Air Force Base, Ohio 45433-7919 (United States)
2006-10-21
A surface dielectric barrier discharge (DBD) in atmospheric pressure air was excited either by low frequency (0.3-2 kHz) high-voltage ac or by short, high-voltage pulses at repetition rates from 50 to 600 pulses s{sup -1}. The short-pulse excited discharge was more diffuse and did not have the pronounced bright multiple cathode spots observed in the ac excited discharge. The discharge voltage, current and average power deposited into the discharge were calculated for both types of excitation. As a measure of plasma-chemical efficiency, the ozone number density was measured by UV absorption as a function of average deposited power. The density of ozone produced by ac excitation did not increase so rapidly as that produced by short-pulse excitation as a function of average power, with a maximum measured density of {approx}3 x 10{sup 15} cm{sup -3} at 25 W. The maximum ozone production achieved by short-pulse excitation was {approx}8.5 x 10{sup 15} cm{sup -3} at 20 W, which was four times greater than that achieved by ac excitation at the same power level.
Comparison of high-voltage ac and pulsed operation of a surface dielectric barrier discharge
International Nuclear Information System (INIS)
Williamson, James M; Trump, Darryl D; Bletzinger, Peter; Ganguly, Biswa N
2006-01-01
A surface dielectric barrier discharge (DBD) in atmospheric pressure air was excited either by low frequency (0.3-2 kHz) high-voltage ac or by short, high-voltage pulses at repetition rates from 50 to 600 pulses s -1 . The short-pulse excited discharge was more diffuse and did not have the pronounced bright multiple cathode spots observed in the ac excited discharge. The discharge voltage, current and average power deposited into the discharge were calculated for both types of excitation. As a measure of plasma-chemical efficiency, the ozone number density was measured by UV absorption as a function of average deposited power. The density of ozone produced by ac excitation did not increase so rapidly as that produced by short-pulse excitation as a function of average power, with a maximum measured density of ∼3 x 10 15 cm -3 at 25 W. The maximum ozone production achieved by short-pulse excitation was ∼8.5 x 10 15 cm -3 at 20 W, which was four times greater than that achieved by ac excitation at the same power level
Phage-Mediated Immuno-PCR for Ultrasensitive Detection of Cry1Ac Protein Based on Nanobody.
Liu, Yuanyuan; Jiang, Dongjian; Lu, Xin; Wang, Wei; Xu, Yang; He, Qinghua
2016-10-11
The widespread use of Cry proteins in transgenic plants for insect control has raised concerns about the environment and food safety in the public. An effective detection method for introduced Cry proteins is of significance for environmental risk assessment and product quality control. This paper describes a novel phage mediated immuno-PCR (iPCR) for the ultrasensitive determination of Cry proteins based on nanobodies. Three nanobodies against Cry1Ac protein were obtained from a naı̈ve phage displayed nanobody library without animal immunization process and were applied to the iPCR assay for Cry1Ac. The phage-mediated iPCR for Cry1Ac based on nanobodies showed a dynamic range of 0.001-100 ng/mL and a limit detection of 0.1 pg/mL. Specific measurement of this established method was performed by testing cross-reativity of other Cry1Ac analogues, and the result showed negligible cross-reactivity with other test Cry proteins (Cry1Ab, Cry1F, Cry3B). Furthermore, the phage-mediated iPCR based on nanobody should be easily applicable to the detection of many other Cry proteins.
Front panel human interface for FASTBUS
International Nuclear Information System (INIS)
Gustavson, D.B.; Holmes, T.L.; Paffrath, L.; Steffani, J.P.
1980-01-01
A human interface based on the Snoop diagnostic module has been designed to facilitate checkout of FASTBUS devices, diagnosis of system faults, and monitoring of system performance. This system, which is a generalization of the usual computer front panel or control console, includes logic analyzer functions, display and manual-control access to other modules, a microprocessor which allows the user to create and execute diagnostic programs and store them on a minifloppy disk, and a diagnostic network which allows remote console operation and coordination of information from multiple segments' Snoops
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
Qian, WANG; Feng, LIU; Chuanrun, MIAO; Bing, YAN; Zhi, FANG
2018-03-01
A coaxial dielectric barrier discharge (DBD) reactor with double layer dielectric barriers has been developed for exhaust gas treatment and excited either by AC power or nanosecond (ns) pulse to generate atmospheric pressure plasma. The comparative study on the discharge characteristics of the discharge uniformity, power deposition, energy efficiency, and operation temperature between AC and ns pulsed coaxial DBD is carried out in terms of optical and electrical characteristics and operation temperature for optimizing the coaxial DBD reactor performance. The voltages across the air gap and dielectric layer and the conduction and displacement currents are extracted from the applied voltages and measured currents of AC and ns pulsed coaxial DBDs for the calculation of the power depositions and energy efficiencies through an equivalent electrical model. The discharge uniformity and operating temperature of the coaxial DBD reactor are monitored and analyzed by optical images and infrared camera. A heat conduction model is used to calculate the temperature of the internal quartz tube. It is found that the ns pulsed coaxial DBD has a much higher instantaneous power deposition in plasma, a lower total power consumption, and a higher energy efficiency compared with that excited by AC power and is more homogeneous and stable. The temperature of the outside wall of the AC and ns pulse excited coaxial DBD reaches 158 °C and 64.3 °C after 900 s operation, respectively. The experimental results on the comparison of the discharge characteristics of coaxial DBDs excited by different powers are significant for understanding of the mechanism of DBDs, reducing energy loss, and optimizing the performance of coaxial DBD in industrial applications.
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
ATLAS Event Display: Run 2 Heavy Ion Collision
ATLAS Collaboration
2018-01-01
Event display of a lead-lead collision with a large transverse momentum photon. In this event, the expected balancing jet is not visible by eye, consistent with it being degraded by its passage through the quark-gluon plasma.
Optical characterization of display screens by speckle patterns
Pozo, Antonio M.; Castro, José J.; Rubiño, Manuel
2013-10-01
In recent years, flat-panel display (FPD) technology has undergone great development, and now FPDs appear in many devices. A significant element in FPD manufacturing is the display front surface. Manufacturers sell FPDs with different types of front surfaces, which can be matte (also called anti-glare) or glossy screens. Users who prefer glossy screens consider these displays to show more vivid colors compared with matte-screen displays. However, on the glossy screens, external light sources may cause unpleasant reflections that can be reduced by a matte treatment in the front surface. In this work, we present a method to characterize FPD screens using laser-speckle patterns. We characterize three FPDs: a Samsung XL2370 LCD monitor of 23 in. with matte screen, a Toshiba Satellite A100 LCD laptop of 15.4 in. with glossy screen, and a Grammata Papyre 6.1 electronic book reader of 6 in. with ePaper screen (E-ink technology). The results show great differences in speckle-contrast values for the three screens characterized and, therefore, this work shows the feasibility of this method for characterizing and comparing FPDs that have different types of front surfaces.
Measurement techniques of LC display systems
Kosmowski, Bogdan B.; Becker, Michael E.; Neumeier, Juergen
1993-10-01
The strong increase of applications of liquid crystal displays in various areas (measuring, medical equipment, automotive, telecommunication, office, etc.) has forced the demand for the adequate specification of the LCDs performances. The optical, electro-optical and spectral properties of LCDs are strongly dependent on viewing direction, electrical driving conditions, illumination and temperature. All these quantities have to be precisely controlled, when one of them is varied, the resulting optical response of the object is recorded. In this paper we present measuring methods proposed for LCD panels and the computer controlled measuring system (DMS) for their evaluation.
Interactive displays natural human-interface technologies
Bhowmik, Achintya K
2014-01-01
One of the first books to provide an in-depth discussion of the technologies, applications and trends in the rapidly emerging field of interactive displays (touch, gesture & voice) The book will cover the technologies, applications and trends in the field of interactive displays, namely interfaces based on touch, gesture and voice and those using a combination of these technologies. The book will be split into 4 main parts with each being dedicated to a specific user interface. Part 1 ''Touch Interfaces'' will provide a review of the currently deployed touch-screen technologies and applications. It will also cover the recent developments towards achieving thinner, lightweight and cost-reduced touch screen panels in the future via integration of touch functionalities. Part 2 ''Gesture Interfaces'' will examine techniques and applications in stereoscopic 3D computer vision, structured-light 3D computer vision and time-of-flight 3D computer vision in gesture interfaces. Part 3 ''Voice Interfaces'' will revie...
Performance analysis of multi-primary color display based on OLEDs/PLEDs
Xiong, Yan; Deng, Fei; Xu, Shan; Gao, Shufang
2017-09-01
A multi-primary color display, such as the six-primary color format, is a solution in expanding the color gamut of a full-color flat panel display. The performance of a multi-primary color display based on organic/polymer light-emitting diodes was analyzed in this study using the fitting curves of the characteristics of devices (i.e., current density, voltage, luminance). A white emitter was introduced into a six-primary color format to form a seven-primary color format that contributes to energy saving, and the ratio of power efficiency of a seven-primary color display to that of a six-primary color display would increase from 1.027 to 1.061 by using emitting diodes with different electroluminescent efficiencies. Different color matching schemes of the seven-primary color format display were compared in a uniform color space, and the scheme of the color reproduction did not significantly affect the display performance. Although seven- and six-primary color format displays benefit a full-color display with higher quality, they are less efficient than three-primary (i.e., red (R), green (G), and blue (B), RGB) and four-primary (i.e., RGB+white, RGBW) color format displays. For the seven-primary color formats considered in this study, the advantages of white-primary-added display with efficiently developed light-emitting devices were more evident than the format without a white primary.
Energy Technology Data Exchange (ETDEWEB)
Calixto-Rodriguez, M., E-mail: manuela@fis.unam.mx [Instituto de Ciencias Fisicas, Universidad Nacional Autonoma de Mexico, Apartado Postal 48-3, 62210, Cuernavaca, Morelos (Mexico); Martinez, H. [Instituto de Ciencias Fisicas, Universidad Nacional Autonoma de Mexico, Apartado Postal 48-3, 62210, Cuernavaca, Morelos (Mexico); Pena, Y. [Facultad de Ciencias Quimicas, Universidad Autonoma de Nuevo Leon, Pedro de Alba s/n, Cd. Universitaria, 66451, San Nicolas de los Garza, Nuevo Leon (Mexico); Flores, O. [Instituto de Ciencias Fisicas, Universidad Nacional Autonoma de Mexico, Apartado Postal 48-3, 62210, Cuernavaca, Morelos (Mexico); Esparza-Ponce, H.E. [Centro de Investigacion en Materiales Avanzados S.C., Laboratorio Nacional de Nanotecnologia, Miguel de Cervantes 120, Complejo Industrial Chihuahua, Chihuahua, Chihuahua 31109 (Mexico); Sanchez-Juarez, A.; Campos-Alvarez, J. [Centro de Investigacion en Energia, Universidad Nacional Autonoma de Mexico, Privada Xochicalco s/n, Col. Centro, 62580, Temixco, Morelos (Mexico); Reyes, P. [Facultad de Ciencias, Departamento de Fisica, Universidad Autonoma del Estado de Mexico, Instituto Literario 100, Col. Centro, 50000, Toluca, Estado de Mexico (Mexico)
2010-02-01
As-deposited antimony sulfide thin films prepared by chemical bath deposition were treated with nitrogen AC plasma and thermal annealing in nitrogen atmosphere. The as-deposited, plasma treated, and thermally annealed antimony sulfide thin films have been characterized by X-ray diffraction (XRD), energy dispersive X-ray spectroscopy, scanning electron microscopy, atomic force microscopy, UV-vis spectroscopy, and electrical measurements. The results have shown that post-deposition treatments modify the crystalline structure, the morphology, and the optoelectronic properties of Sb{sub 2}S{sub 3} thin films. X-ray diffraction studies showed that the crystallinity of the films was improved in both cases. Atomic force microscopy studies showed that the change in the film morphology depends on the post-deposition treatment used. Optical emission spectroscopy (OES) analysis revealed the plasma etching on the surface of the film, this fact was corroborated by the energy dispersive X-ray spectroscopy analysis. The optical band gap of the films (E{sub g}) decreased after post-deposition treatments (from 2.36 to 1.75 eV) due to the improvement in the grain sizes. The electrical resistivity of the Sb{sub 2}S{sub 3} thin films decreased from 10{sup 8} to 10{sup 6} {Omega}-cm after plasma treatments.
A Control Strategy of DC Building Microgrid Connected to the Neighborhood and AC Power Network
Directory of Open Access Journals (Sweden)
Thi Thuong Huyen Ma
2017-05-01
Full Text Available Recently, the use of DC microgrid distribution system has become more attractive than traditional AC systems due to their energy efficiency and ability to easily integrate with renewable energy sources and batteries. This paper proposes a 500 V DC microgrid which consists of a 20 kWp photovoltaic panel, batteries, and DC loads. A hierarchical control strategy to ensure balance power of the DC microgrid and the maintenance of common DC bus voltage is presented. The capability of exchanging power energy of the microgrid with the power system of neighborhood buildings is also considered. Typical operation modes are simulated in the Matlab/simulink environment to confirm the good performance of the controllers and the efficiency of appropriately controlling the charge–discharge of the battery system. This research is expected to bring benefits to the design and operation of the system, such as reducing the capacity of batteries, increasing the self-supply of buildings, and decreasing the electricity demand from the AC grid.
AC plasma induced modifications in Sb{sub 2}S{sub 3} thin films
Energy Technology Data Exchange (ETDEWEB)
Calixto-Rodriguez, M; Martinez, H [Instituto de Ciencias Fisicas, Universidad Nacional Autonoma de Mexico, Apartado Postal 48-3, 62210, Cuernavaca, Morelos (Mexico); Castillo, F [Instituto de Ciencias Nucleares, Universidad Nacional Autonoma de Mexico, Apartado Postal 70-543, 04510, Mexico D. F. (Mexico); Pena, Y [Universidad Autonoma de Nuevo Leon, Facultad de Ciencias Quimicas, Pedro de Alba s/n, Cd. Universitaria, San Nicolas de los Garza, N.L (Mexico); Sanchez-Juarez, A, E-mail: ciro@nucleares.unam.m [Centro de Investigacion en EnergIa, Universidad Nacional Autonoma de Mexico, Privada Xochicalco s/n Col. Centro, Temixco, Morelos, C.P. 62580 (Mexico)
2010-01-01
Sb{sub 2}S{sub 3} thin films, deposited by the chemical bath deposition method, were treated with N{sub 2} plasma at 3.0 Torr during several minutes. The as-prepared Sb{sub 2}S{sub 3} thin films and films treated with N{sub 2} plasma have been characterized using several techniques. X-ray diffraction studies have shown that plasma treatment induced recrystallization on the as-prepared Sb{sub 2}S{sub 3}thin films. The band gap values decreased from 2.37 to 1.82 eV after plasma treatment, and the electrical conductivity increased from 10{sup 9} to 10{sup 7} ({Omega}cm){sup -1} due to the annealing effect.
An experimental study of icing control using DBD plasma actuator
Cai, Jinsheng; Tian, Yongqiang; Meng, Xuanshi; Han, Xuzhao; Zhang, Duo; Hu, Haiyang
2017-08-01
Ice accretion on aircraft or wind turbine has been widely recognized as a big safety threat in the past decades. This study aims to develop a new approach for icing control using an AC-DBD plasma actuator. The experiments of icing control (i.e., anti-/de-icing) on a cylinder model were conducted in an icing wind tunnel with controlled wind speed (i.e., 15 m/s) and temperature (i.e., -10°C). A digital camera was used to record the dynamic processes of plasma anti-icing and de-icing whilst an infrared imaging system was utilized to map the surface temperature variations during the anti-/de-icing processes. It was found that the AC-DBD plasma actuator is very effective in both anti-icing and de-icing operations. While no ice formation was observed when the plasma actuator served as an anti-icing device, a complete removal of the ice layer with a thickness of 5 mm was achieved by activating the plasma actuator for ˜150 s. Such information demonstrated the feasibility of plasma anti-/de-icing, which could potentially provide more effective and safer icing mitigation strategies.
72-directional display having VGA resolution for high-appearance image generation
Takaki, Yasuhiro; Dairiki, Takeshi
2006-02-01
The high-density directional display, which was originally developed in order to realize a natural 3D display, is not only a 3D display but also a high-appearance display. The appearances of objects, such as glare and transparency, are the results of the reflection and the refraction of rays. The faithful reproduction of such appearances of objects is impossible using conventional 2D displays because rays diffuse on the display screen. The high-density directional display precisely controls the horizontal ray directions so that it can reproduce the appearances of objects. The fidelity of the reproduction of object appearances depends on the ray angle sampling pitch. The angle sampling pitch is determined by considering the human eye imaging system. In the present study the high-appearance display which has the resolution of 640×400 and emits rays in 72 different horizontal directions with the angle pitch of 0.38° was constructed. Two 72-directional displays were combined, each of which consisted of a high-resolution LCD panel (3,840×2,400) and a slanted lenticular sheet. Two images produced by two displays were superimposed by a half mirror. A slit array was placed at the focal plane of the lenticular sheet for each display to reduce the horizontal image crosstalk in the combined image. The impression analysis shows that the high-appearance display provides higher appearances and presence than the conventional 2D displays do.
Two Distinctive Phenotypes of AcMNPV Display Different Immune Abilities and Intracellular Destiny.
Molina, Guido N; Tavarone, Eugenia; Taboga, Oscar; Molinari, Paula
2016-01-01
The budded phenotype (BV) of the baculovirus AcMNPV has been demonstrated to have strong immunostimulatory properties that are relevant for the development of vaccines and antiviral therapies. Although the occluded phenotype (ODV) shares the main structural proteins and its genome with BV, it has been poorly studied in mammals. In this study, we assessed the capacity of ODV to induce immune responses in mice. In contrast to BVs, ODVs failed to promote the secretion of IFN-gamma, IL-6 and Il-12 and to induce antiviral activity against VSV in the short term. Furthermore, ODVs were unable to induce cellular immunity against a coadministered antigen 7 days after inoculation. By analyzing the interaction of ODVs with BMDCs, we observed that although ODVs entered the cells reaching late and acidic endosomes, they did not induce their maturation. Finally, we also analyzed if BVs and ODVs followed different routes in the cell during the infection. BVs, but not ODVs, colocalized with the protein ovalbumin in compartments with the presence of proteases. The results suggest that structural differences could be responsible for their different destinies in the dendritic cell and this could lead to a different impact on the immune response.
Lipid Panel Reference Intervals for Amazon Parrots (Amazona species).
Ravich, Michelle; Cray, Carolyn; Hess, Laurie; Arheart, Kristopher L
2014-09-01
The lipoprotein panel is a useful diagnostic tool that allows clinicians to evaluate blood lipoprotein fractions. It is a standard diagnostic test in human medicine but is poorly understood in avian medicine. Amazon parrots (Amazona species) are popular pets that frequently lead a sedentary lifestyle and are customarily fed high-fat diets. Similar to people with comparable diets and lifestyles, Amazon parrots are prone to obesity and atherosclerosis. In human medicine, these conditions are typically correlated with abnormalities in the lipoprotein panel. To establish reference intervals for the lipoprotein panel in Amazon parrots, plasma samples from 31 captive Amazon parrots were analyzed for concentrations of cholesterol, triglycerides, high-density lipoprotein (HDL), low-density lipoprotein (LDL), and very low-density lipoprotein (VLDL). The data were also grouped according to sex, diet, body condition score, and age. Aside from HDL levels, which were significantly different between male and female parrots, no intergroup differences were found for any of the lipoprotein fractions.
Integration issues of a plasma contactor Power Electronics Unit
Pinero, Luis R.; York, Kenneth W.; Bowers, Glen E.
1995-01-01
A hollow cathode-based plasma contactor is baselined on International Space Station Alpha (ISSA) for spacecraft charge control. The plasma contactor system consists of a hollow cathode assembly (HCA), a power electronics unit (PEU), and an expellant management unit (EMU). The plasma contactor has recently been required to operate in a cyclic mode to conserve xenon expellant and extend system life. Originally, a DC cathode heater converter was baselined for a continuous operation mode because only a few ignitions of the hollow cathode were expected. However, for cyclic operation, a DC heater supply can potentially result in hollow cathode heater component failure due to the DC electrostatic field. This can prevent the heater from attaining the proper cathode tip temperature for reliable ignition of the hollow cathode. To mitigate this problem, an AC cathode heater supply was therefore designed, fabricated, and installed into a modified PEU. The PEU was tested using resistive loads and then integrated with an engineering model hollow cathode to demonstrate stable steady-state operation. Integration issues such as the effect of line and load impedance on the output of the AC cathode heater supply and the characterization of the temperature profile of the heater under AC excitation were investigated.
Pilot Experience with an External Quality Assurance Scheme for Acylcarnitines in Plasma/Serum
Sala, P Ruiz; Ruijter, G; Acquaviva, C; Chabli, A; de Sain-van der Velden, M G M; Garcia-Villoria, J; Heiner-Fokkema, M R; Jeannesson-Thivisol, E; Leckstrom, K; Franzson, L; Lynes, G; Olesen, J; Onkenhout, W; Petrou, P; Drousiotou, A; Ribes, A; Vianey-Saban, C; Merinero, B
2016-01-01
The analysis of acylcarnitines (AC) in plasma/serum is established as a useful test for the biochemical diagnosis and the monitoring of treatment of organic acidurias and fatty acid oxidation defects. External quality assurance (EQA) for qualitative and quantitative AC is offered by ERNDIM and CDC
The Plasma Discharge System For Effective Sterilization Of Water And Solid Surfaces
International Nuclear Information System (INIS)
Senturk, K.
2010-01-01
The different areas such as medicine, surgery, food production need efficient sterilization system since they are directly related to human health. In this work a new plasma system is described in order to present its effectiveness in sterilization. This is a different method from conventional methods such as: chemicals and heat addition, UV irradiation etc. The developed plasma system produces cold plasma working under atmospheric pressure. To generate the plasma both AC and DC high voltage power supplies were used. The developed system is cheap and very effective for sterilization. The light emission for both AC and DC coronas for the plasmas were investigated to understand the nature of generated plasma ionization. Different parameters like temperature, voltage, application time were changed during the plasma application and the optimization for killing the micro-organisms were investigated. To understand the biological effect of plasma on the organisms comparisons were done by using the scanning electron microscope and absorption spectrometer. The plasma was applied on the bacteria like Escherichia coli, Bacillus subtilis, Streptococcus mutans , the yeasts such as Candida albicans, and green algae. The efficiency, the non toxic nature, the affordable price make this plasma discharge method a very efficient one for sterilization.
An AMOLED AC-Biased Pixel Design Compensating the Threshold Voltage and I-R Drop
Directory of Open Access Journals (Sweden)
Ching-Lin Fan
2011-01-01
Full Text Available We propose a novel pixel design and an AC bias driving method for active-matrix organic light-emitting diode (AM-OLED displays using low-temperature polycrystalline silicon thin-film transistors (LTPS-TFTs. The proposed threshold voltage and I-R drop compensation circuit, which comprised three transistors and one capacitor, have been verified to supply uniform output current by simulation work using the Automatic Integrated Circuit Modeling Simulation Program with Integrated Circuit Emphasis (AIM-SPICE simulator. The simulated results demonstrate excellent properties such as low error rate of OLED anode voltage variation (<0.7% and low voltage drop of VDD power line. The proposed pixel circuit effectively enables threshold-voltage-deviation correction of driving TFT and compensates for the voltage drop of VDD power line using AC bias on OLED cathode.
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
An evaluation of the Panasonic model UD513AC-1 Thermoluminescence Dosimetry system
International Nuclear Information System (INIS)
Durrer, R.E. Jr.
1991-12-01
An evaluation of the Panasonic UD513AC-1 Thermoluminescence Dosimetry system was performed to determine the system's capabilities as a general purpose thermoluminescence dosimeter measuring device. The tests that were performed included a critique of the user's manual, delimitation of the operating parameters, the quality of construction, and an evaluation of the features that were unique to this system. The UD513AC-1 was found to be an adequate measuring device for most dosimetric applications. It was not well suited for experimental work with thermoluminescence materials due to a low sensitivity displayed by the photomultiplier tube to commonly used materials. The system was well constructed and did not suffer hardware failure during this research. Major attributes of the UD513AC-1 were automatic data storage, highly reproducible heating ramps, an excellent infrared light filter and a unique feature to a single phosphor unit, a dose determination function. Negative aspects of the system included a limited data manipulation capability within the controlling program, a poorly written user's manual, inadequate sensitivity on the part of the photomultiplier tube, and insufficient capability to adjust the hot N 2 gas flow to desired levels
Applicability of Ion Torrent Colon and Lung sequencing panel on circulating cell-free DNA
DEFF Research Database (Denmark)
Demuth, Christina; Tranberg Madsen, Anne; Larsen, Anne Winther
of targeted sequencing have been optimised for clinical use on FFPE, e.g. the Ion Torrent Colon and Lung panel. The size of DNA extracted from FFPE tissue is comparable with that from cfDNA. We therefore investigated the performance of the clinically relevant Ion Torrent Colon and Lung panel on cfDNA. Methods...... a baseline for the panel. Lastly, the panel was tested on 52 patient samples. Patient plasma samples are from a previously collected cohort of EGFR wild-type non-small cell lung cancer patients (ClinicalTrial.gov: NCT02043002) All samples were sequenced using the Ion Torrent Oncomine Solid Tumor DNA kit...... (Colon and Lung panel) from Thermo Fisher. Sample preparation was performed using the Ion Torrent Chef and sequencing was performed on the Personal Genome Machine (PGM) system. Data was analyzed using the Torrent Suite software, and variants called by Ion Reporter. Results: No somatic mutations were...
Mechanical Stability of Flexible Graphene-Based Displays.
Anagnostopoulos, George; Pappas, Panagiotis-Nektarios; Li, Zheling; Kinloch, Ian A; Young, Robert J; Novoselov, Kostya S; Lu, Ching Yu; Pugno, Nicola; Parthenios, John; Galiotis, Costas; Papagelis, Konstantinos
2016-08-31
The mechanical behavior of a prototype touch panel display, which consists of two layers of CVD graphene embedded into PET films, is investigated in tension and under contact-stress dynamic loading. In both cases, laser Raman spectroscopy was employed to assess the stress transfer efficiency of the embedded graphene layers. The tensile behavior was found to be governed by the "island-like" microstructure of the CVD graphene, and the stress transfer efficiency was dependent on the size of graphene "islands" but also on the yielding behavior of PET at relatively high strains. Finally, the fatigue tests, which simulate real operation conditions, showed that the maximum temperature gradient developed at the point of "finger" contact after 80 000 cycles does not exceed the glass transition temperature of the PET matrix. The effect of these results on future product development and the design of new graphene-based displays are discussed.
Directory of Open Access Journals (Sweden)
Kumari S. Choudhary
2018-05-01
Full Text Available Two-component systems (TCSs consist of a histidine kinase and a response regulator. Here, we evaluated the conservation of the AgrAC TCS among 149 completely sequenced Staphylococcus aureus strains. It is composed of four genes: agrBDCA. We found that: (i AgrAC system (agr was found in all but one of the 149 strains, (ii the agr positive strains were further classified into four agr types based on AgrD protein sequences, (iii the four agr types not only specified the chromosomal arrangement of the agr genes but also the sequence divergence of AgrC histidine kinase protein, which confers signal specificity, (iv the sequence divergence was reflected in distinct structural properties especially in the transmembrane region and second extracellular binding domain, and (v there was a strong correlation between the agr type and the virulence genomic profile of the organism. Taken together, these results demonstrate that bioinformatic analysis of the agr locus leads to a classification system that correlates with the presence of virulence factors and protein structural properties.
Choudhary, Kumari S.; Mih, Nathan; Monk, Jonathan; Kavvas, Erol; Yurkovich, James T.; Sakoulas, George; Palsson, Bernhard O.
2018-01-01
Two-component systems (TCSs) consist of a histidine kinase and a response regulator. Here, we evaluated the conservation of the AgrAC TCS among 149 completely sequenced Staphylococcus aureus strains. It is composed of four genes: agrBDCA. We found that: (i) AgrAC system (agr) was found in all but one of the 149 strains, (ii) the agr positive strains were further classified into four agr types based on AgrD protein sequences, (iii) the four agr types not only specified the chromosomal arrangement of the agr genes but also the sequence divergence of AgrC histidine kinase protein, which confers signal specificity, (iv) the sequence divergence was reflected in distinct structural properties especially in the transmembrane region and second extracellular binding domain, and (v) there was a strong correlation between the agr type and the virulence genomic profile of the organism. Taken together, these results demonstrate that bioinformatic analysis of the agr locus leads to a classification system that correlates with the presence of virulence factors and protein structural properties. PMID:29887846
DEFF Research Database (Denmark)
Tetens, Inge
Following an application from Nutrilinks Sarl, submitted pursuant to Article 13(5) of Regulation (EC) No 1924/2006 via the Competent Authority of Belgium, the Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on the scientific substantiation of a health claim...... related to EffEXT™ and “helps to support joint function by maintaining low levels of plasma C‑reactive protein”. The Panel considers that EffEXT™, which is standardised pure krill oil, is sufficiently characterised. The claimed effect is “helps to support joint function by maintaining low levels of plasma...
Manufacturing of 380/220 V 63 A power supply panel on UO2 kernel coating unit
International Nuclear Information System (INIS)
Triyono; Mudjiman, Supardjono; Hidayat, Nur
2013-01-01
The panel 380/220 Volts voltage source current 63 Amperes relay AC output on UO 2 kernel coating unit has been manufactured. The activities include: installation and function panel test. The electrical installation of load includes : 220 Volts temperature monitor/controller, 220 Volts scraber pump, 220 Volts vacuum pump, 220 Volts solenoid valve gas and 380 Volts induction furnace. The component of installation includes: 380 Volts earth leakage circuit breaker, 380 Volts relay AC, 220 Volts magnetic circuit breaker, 100/5 Amperes current transformator ratio, voltmeter, ampermeter and push button normally open-close and temperature monitor/control in the box size 70x50x20 cm. The testing of voltage source has been unload and full load to determine the performance of the tool. The result of manufacture and function test voltage source 380/220 Volts at the UO 2 kernel coating unit showed that: the voltage source can work without load and full load safely. The load includes: voltage 380-382 Volts current 4-4,1 Amperes of induction furnace, voltage 223 Volts current 0,5 Amperes of vacuum pump, voltage 223 Volts current 4 Amperes of scraber pump, voltage 223 Volts current 0,3 Amperes of solenoid valve gas and 222 Volts current 0,03 Amperes temperature monitor/control. (author)
Makabe, Toshiaki
2018-03-01
A time-varying low-temperature plasma sustained by electrical powers with various kinds of fRequencies has played a key role in the historical development of new technologies, such as gas lasers, ozonizers, micro display panels, dry processing of materials, medical care, and so on, since World War II. Electrons in a time-modulated low-temperature plasma have a proper velocity spectrum, i.e. velocity distribution dependent on the microscopic quantum characteristics of the feed gas molecule and on the external field strength and the frequency. In order to solve and evaluate the time-varying velocity distribution, we have mostly two types of theoretical methods based on the classical and linear Boltzmann equations, namely, the expansion method using the orthogonal function and the procedure of non-expansional temporal evolution. Both methods have been developed discontinuously and progressively in synchronization with those technological developments. In this review, we will explore the historical development of the theoretical procedure to evaluate the electron velocity distribution in a time-varying low-temperature plasma over the past 70 years.
Electric field measurements on plasma bullets in N2 using four-wave mixing
van der Schans, M.; Böhm, P.; Nijdam, S.; IJzerman, W.L.; Czarnetzki, U.
2015-01-01
Atmospheric pressure plasma jets driven by pulsed DC or kHz AC voltages typically consist of discrete guided ionisation waves called plasma bullets. In this work, the electric field of plasma bullets generated in a pulsed DC jet with N2 as feed gas is investigated. Electric field measurements in N2
Measurement of luminance and color uniformity of displays using the large-format scanner
Mazikowski, Adam
2017-08-01
Uniformity of display luminance and color is important for comfort and good perception of the information presented on the display. Although display technology has developed and improved a lot over the past years, different types of displays still present a challenge in selected applications, e.g. in medical use or in case of multi-screen installations. A simplified 9-point method of determining uniformity does not always produce satisfactory results, so a different solution is proposed in the paper. The developed system consists of the large-format X-Y-Z ISEL scanner (isel Germany AG), Konica Minolta high sensitivity spot photometer-colorimeter (e.g. CS-200, Konica Minolta, Inc.) and PC computer. Dedicated software in LabView environment for control of the scanner, transfer the measured data to the computer, and visualization of measurement results was also prepared. Based on the developed setup measurements of plasma display and LCD-LED display were performed. A heavily wornout plasma TV unit, with several artifacts visible was selected. These tests show the advantages and drawbacks of described scanning method with comparison with 9-point simplified uniformity determining method.
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
Hazardous and Medical Waste Destruction Using the AC Plasmatron Final Report CRADA No. TC-1560-98
Energy Technology Data Exchange (ETDEWEB)
Caplan, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bucher, K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Tulupov, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-09-28
The goal of this project was to develop a prototype medical waste destruction facility based on the AC plasma torch capable of processing 150 kg of waste per hour while satisfying US EPA emission standards. The project was to provide the first opportunity for a joint U.S.-Russian project using an AC Plasma Torch in a hazardous waste destruction system to be assembled and operated in the U.S. thus promoting the commercialization in the U.S. of this joint U.S.-Russian developed technology. This project was a collaboration between the Russian Institute Soliton- NTT, the U.S industrial partner Scientific Utilization Inc. (SUI) and Lawrence Livermore National Laboratory ( LLNL). The project was funded by DOE for a total of $1.2 million with $600K for allocated for Phase I and $600K for Phase II. The Russian team received about $800K over the two (2) year period while LLNL received $400K. SUI was to provide in kind matching funds totaling $1.2 million.
A Control Method of Current Type Matrix Converter for Plasma Control Coil Power Supply
International Nuclear Information System (INIS)
Shimada, K.; Matsukawa, M.; Kurihara, K.; Jun-ichi Itoh
2006-01-01
In exploration to a tokamak fusion reactor, the control of plasma instabilities of high β plasma such as neoclassical tearing mode (NTM), resistive wall mode (RWM) etc., is the key issue for steady-state sustainment. One of the proposed methods to avoid suppressing RWM is that AC current having a phase to work for reduction the RWM growth is generated in a coil (sector coil) equipped spirally on the plasma vacuum vessel. To stabilize RWM, precise and fast real-time feedback control of magnetic field with proper amplitude and frequency is necessary. This implies that an appropriate power supply dedicated for such an application is expected to be developed. A matrix converter as one of power supply candidates for this purpose could provide a solution The matrix converter, categorized in an AC/AC direct converter composed of nine bi-directional current switches, has a great feature that a large energy storage element is unnecessary in comparison with a standard existing AC/AC indirect converter, which is composed of an AC/DC converter and a DC/AC inverter. It is also advantageous in cost and size of its applications. Fortunately, a voltage type matrix converter has come to be available at the market recently, while a current type matrix converter, which is advantageous for fast control of the large-inductance coil current, has been unavailable. On the background above mentioned, we proposed a new current type matrix converter and its control method applicable to a power supply with fast response for suppressing plasma instabilities. Since this converter is required with high accuracy control, the gate control method is adopted to three-phase switching method using middle phase to reduce voltage and current waveforms distortion. The control system is composed of VME-bus board with DSP (Digital Signal Processor) and FPGA (Field Programmable Gate Array) for high speed calculation and control. This paper describes the control method of a current type matrix converter
Viewing angle switching of patterned vertical alignment liquid crystal display
International Nuclear Information System (INIS)
Lim, Young Jin; Jeong, Eun; Chin, Mi Hyung; Lee, Seung Hee; Ji, Seunghoon; Lee, Gi-Dong
2008-01-01
Viewing angle control of a patterned vertical alignment (PVA) liquid crystal display using only one panel is investigated. In conventional PVA modes, a vertically aligned liquid crystal (LC) director tilts down in four directions making 45 deg. with respect to crossed polarizers to exhibit a wide viewing angle. In the viewing angle control device, one pixel was divided into two sub-pixels such that the LC director in the main pixel is controlled to be tilted down in multiple directions making an angle with the polarizer, playing the role of main display with the wide viewing angle, while the LC director in the sub-pixel is controlled to be tilted down to the polarizer axis, playing the role of sub-pixel to the viewing angle control for the narrow viewing angle. Using sub-pixel control, light leakage or any type of information such as characters and image can be generated in oblique viewing directions without distorting the image quality in the normal direction, which will prevent others from peeping at the displayed image by overlapping the displayed image with the made image
Ramos-Roman, Maria A; Sweetman, Lawrence; Valdez, Maressa J; Parks, Elizabeth J
2012-02-01
This study determined whether reductions in postprandial plasma nonesterified fatty acid (FFA) flux would lead to reductions in plasma acylcarnitine (AC) concentrations. Plasma AC was measured by liquid chromatography with tandem mass spectrometry in the fasting state and over 6 hours after a high-fat (50% energy) meal was fed to 16 overweight and obese subjects with a wide range of insulin sensitivities. Body composition was measured by dual-energy x-ray absorptiometry; insulin sensitivity by insulin-modified, frequently sampled intravenous glucose tolerance test; substrate oxidation by indirect calorimetry; blood metabolite and hormone concentrations biochemically; and fatty acid flux by using stable isotope tracers. Lean body mass and fasting fat oxidation correlated positively (r > 0.522, P 0.515, P Conditions that impact fatty acid flux contribute to the control of postprandial plasma AC concentrations. These data underscore the need for a better understanding of postprandial fatty acid oxidation and dietary fat delivery in the setting of adipose insulin resistance to determine how postprandial lipemia contributes to chronic disease risk. Copyright © 2012 Elsevier Inc. All rights reserved.
Interaction between electromagnetic waves and plasma waves in motional plasma
International Nuclear Information System (INIS)
Chen, S. Y.; Gao, M.; Tang, C. J.; Peng, X. D.
2009-01-01
The electromagnetic wave (EM wave) behavior and the electromagnetic instability caused by the interaction between an EM wave and a plasma wave in motional plasma are studied. The dispersion relation of EM waves and the dielectric tensor of motional plasma are derived by magnetohydrodynamics, and the wave phenomenon in motional plasma is displayed. As a result, the electromagnetic instability, which is excited by the interaction between the EM waves and the plasma waves, is revealed. The mechanism of the instability is the coupling between high frequency electromagnetic field and the transverse electron oscillation derived from the deflection of longitudinal electron oscillation due to self-magnetic field. The present research is useful with regard to the new type of plasma radiation source, ion-focusing accelerator, and plasma diagnostic technique.
Cho, Kyu-Gong
2000-12-01
utilized to optimize the thin film phosphor properties for the application of field emission flat panel displays.
DEFF Research Database (Denmark)
Brænder, Morten; Andersen, Lotte Bøgh
2014-01-01
Based on our 2013-article, ”Does Deployment to War Affect Soldiers' Public Service Motivation – A Panel Study of Soldiers Before and After their Service in Afghanistan”, we present Panel Analysis as a methodological discipline. Panels consist of multiple units of analysis, observed at two or more...... in research settings where it is not possible to distribute units of analysis randomly or where the independent variables cannot be manipulated. The greatest disadvantage in regard to using panel studies is that data may be difficult to obtain. This is most clearly vivid in regard to the use of panel surveys...... points in time. In comparison with traditional cross-sectional studies, the advantage of using panel studies is that the time dimension enables us to study effects. Whereas experimental designs may have a clear advantage in regard to causal inference, the strength of panel studies is difficult to match...
Bhagat, S A; Borghate, S V; Kalyani, N Thejo; Dhoble, S J
2015-05-01
Pure and Na(+) -doped Alq3 complexes were synthesized by a simple precipitation method at room temperature, maintaining a stoichiometric ratio. These complexes were characterized by X-ray diffraction, Fourier transform infrared (FTIR), UV/Vis absorption and photoluminescence (PL) spectra. The X-ray diffractogram exhibits well-resolved peaks, revealing the crystalline nature of the synthesized complexes, FTIR confirms the molecular structure and the completion of quinoline ring formation in the metal complex. UV/Vis absorption and PL spectra of sodium-doped Alq3 complexes exhibit high emission intensity in comparison with Alq3 phosphor, proving that when doped in Alq3 , Na(+) enhances PL emission intensity. The excitation spectra of the synthesized complexes lie in the range 242-457 nm when weak shoulders are also considered. Because the sharp excitation peak falls in the blue region of visible radiation, the complexes can be employed for blue chip excitation. The emission wavelength of all the synthesized complexes lies in the bluish green/green region ranging between 485 and 531 nm. The intensity of the emission wavelength was found to be elevated when Na(+) is doped into Alq3 . Because both the excitation and emission wavelengths fall in the visible region of electromagnetic radiation, these phosphors can also be employed to improve the power conversion efficiency of photovoltaic cells by using the solar spectral conversion principle. Thus, the synthesized phosphors can be used as bluish green/green light-emitting phosphors for organic light-emitting diodes, flat panel displays, solid-state lighting technology - a step towards the desire to reduce energy consumption and generate pollution free light. Copyright © 2014 John Wiley & Sons, Ltd.
Mechanical Stability of Flexible Graphene-Based Displays
2016-01-01
The mechanical behavior of a prototype touch panel display, which consists of two layers of CVD graphene embedded into PET films, is investigated in tension and under contact-stress dynamic loading. In both cases, laser Raman spectroscopy was employed to assess the stress transfer efficiency of the embedded graphene layers. The tensile behavior was found to be governed by the “island-like” microstructure of the CVD graphene, and the stress transfer efficiency was dependent on the size of graphene “islands” but also on the yielding behavior of PET at relatively high strains. Finally, the fatigue tests, which simulate real operation conditions, showed that the maximum temperature gradient developed at the point of “finger” contact after 80 000 cycles does not exceed the glass transition temperature of the PET matrix. The effect of these results on future product development and the design of new graphene-based displays are discussed. PMID:27494211
Consensus clinical recommendations for the management of plasma lipid disorders in the Middle East.
Al Sayed, Nasreen; Al Waili, Khalid; Alawadi, Fatheya; Al-Ghamdi, Saeed; Al Mahmeed, Wael; Al-Nouri, Fahad; Al Rukhaimi, Mona; Al-Rasadi, Khalid; Awan, Zuhier; Farghaly, Mohamed; Hassanein, Mohamed; Sabbour, Hani; Zubaid, Mohammad; Barter, Philip
2016-12-15
Plasma lipid disorders are key risk factors for the development of atherosclerotic cardiovascular disease (ASCVD) and are prevalent in the Middle East, with rates increasing in recent decades. Despite this, no region-specific guidelines for managing plasma lipids exist and there is a lack of use of guidelines developed in other regions. A multidisciplinary panel of regional experts was convened to develop consensus clinical recommendations for the management of plasma lipids in the Middle East. The panel considered existing international guidelines and regional clinical experience to develop recommendations. The panel's recommendations include plasma lipid screening, ASCVD risk calculation and treatment considerations. The panel recommend that plasma lipid levels should be measured in all at-risk patients and at regular intervals in all adults from the age of 20years. A scoring system should be used to calculate ASCVD risk that includes known lipid and non-lipid risk factors. Primary treatment targets include low-density lipoprotein cholesterol and non-high-density lipoprotein cholesterol. Lifestyle modifications should be first-line treatment for all patients; the first-line pharmacological treatment targeting plasma lipids in patients at moderate-to-high risk of ASCVD is statin therapy, with a number of adjunctive or second-line agents available. Guidance is also provided on the management of underlying conditions and special populations; of particular pertinence in the region are familial hypercholesterolaemia, diabetes and metabolic dyslipidaemia. These consensus clinical recommendations provide practicing clinicians with comprehensive, region-specific guidance to improve the detection and management of plasma lipid disorders in patients in the Middle East. Copyright © 2016 The Authors. Published by Elsevier Ireland Ltd.. All rights reserved.
Flatbed-type 3D display systems using integral imaging method
Hirayama, Yuzo; Nagatani, Hiroyuki; Saishu, Tatsuo; Fukushima, Rieko; Taira, Kazuki
2006-10-01
We have developed prototypes of flatbed-type autostereoscopic display systems using one-dimensional integral imaging method. The integral imaging system reproduces light beams similar of those produced by a real object. Our display architecture is suitable for flatbed configurations because it has a large margin for viewing distance and angle and has continuous motion parallax. We have applied our technology to 15.4-inch displays. We realized horizontal resolution of 480 with 12 parallaxes due to adoption of mosaic pixel arrangement of the display panel. It allows viewers to see high quality autostereoscopic images. Viewing the display from angle allows the viewer to experience 3-D images that stand out several centimeters from the surface of the display. Mixed reality of virtual 3-D objects and real objects are also realized on a flatbed display. In seeking reproduction of natural 3-D images on the flatbed display, we developed proprietary software. The fast playback of the CG movie contents and real-time interaction are realized with the aid of a graphics card. Realization of the safety 3-D images to the human beings is very important. Therefore, we have measured the effects on the visual function and evaluated the biological effects. For example, the accommodation and convergence were measured at the same time. The various biological effects are also measured before and after the task of watching 3-D images. We have found that our displays show better results than those to a conventional stereoscopic display. The new technology opens up new areas of application for 3-D displays, including arcade games, e-learning, simulations of buildings and landscapes, and even 3-D menus in restaurants.
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
A new AC driving circuit for a top emission AMOLED
International Nuclear Information System (INIS)
Zhang Yongwen; Chen Wenbin; Liu Haohan
2013-01-01
A new voltage programmed pixel circuit with top emission design for active-matrix organic light-emitting diode (AMOLED) displays is presented and verified by HSPICE simulations. The proposed pixel circuit consists of five poly-Si TFTs, and can effectively compensate for the threshold voltage variation of the driving TFT. Meanwhile, the proposed pixel circuit offers an AC driving mode for the OLED by the two adjacent pulse voltage sources, which can suppress the degradation of the OLED. Moreover, a high contrast ratio can be achieved by the proposed pixel circuit since the OLED does not emit any light except for the emission period. (semiconductor integrated circuits)
Siu, Theodore; Wissel, Stephanie; Guttadora, Larry; Liao, Susan; Zwicker, Andrew
2010-11-01
Since their discovery in the mid 1800's, DC glow discharge apparatuses have commonly been used for spectral analysis, the demonstration of the Frank-Hertz experiment, and to study plasma breakdown voltages following from the Paschen Curve. A DC glow discharge tube museum display was outfitted with a Helmholtz Coil electromagnet in order to demonstrate magnetic confinement for a science museum display. A device commonly known as a ``theremin'' was designed and built in order to externally control the Helmholtz Coil current and the plasma current. Originally a musical instrument, a theremin has two variable capacitors connected to two radio frequency oscillators which determine pitch and volume. Using a theremin to control current and ``play'' the plasma adds appeal and durability by providing a new innovative means of interacting with a museum exhibit. Educationally, students can use the display to not only learn about plasma properties but also electronic properties of the human body.
Reduction of nitrogen oxides from simulated exhaust gas by using plasma-catalytic process
International Nuclear Information System (INIS)
Mok, Young Sun; Koh, Dong Jun; Shin, Dong Nam; Kim, Kyong Tae
2004-01-01
Removal of nitrogen oxides (NO x ) using a nonthermal plasma reactor (dielectric-packed bed reactor) combined with monolith V 2 O 5 /TiO 2 catalyst was investigated. The effect of initial NO x concentration, feed gas flow rate (space velocity), humidity, and reaction temperature on the removal of NO x was examined. The plasma reactor used can be energized by either ac or pulse voltage. An attempt was made to utilize the electrical ignition system of an internal combustion engine as a high-voltage pulse generator for the plasma reactor. When the plasma reactor was energized by the electrical ignition system, NO was readily oxidized to NO 2 . Performance was as good as with ac energization. Increasing the fraction of NO 2 in NO x , which is the main role of the plasma reactor, largely enhanced the NO x removal efficiency. In the plasma-catalytic reactor, the increases in initial NO x concentration, space velocity (feed gas flow rate) and humidity lowered the NO x removal efficiency. However, the reaction temperature in the range up to 473 K did not significantly affect the NO x removal efficiency in the presence of plasma discharge
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
Pulsed nanocrystalline plasma electrolytic boriding as a novel ...
Indian Academy of Sciences (India)
WINTEC
borided CP-Ti, treated by a relatively new method called pulsed plasma electrolytic boriding. The results ... ratio, high stiffness and strength (Donachie 2000; Lutjer- ing and Albrecht ..... both direct current and a.c. techniques. Although the main ...
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
Experimental study on display-control stereotype and development of human factors guidelines
International Nuclear Information System (INIS)
Lee, Jung Woon; Lee, Yong Hee; Oh, In Seok; Lee, Hyun Chul; Cha, Woo Chang
2003-01-01
It is very important to develop the design guidelines which can be applicable for Korean operators for the purpose of designing the KSNP more safely. The objective of this project is to provide the standards, guidelines and bases applicable for HF-010 through the within-subject experiment for obtaining Korean operators' population stereotype for direction-of-movement of controls associated with displays on the control panels. Through the survey of researches on display compatibility and the classification of types of displays and controls in the main control room of Uljin units 3 and 4, methods for an experiment on the stereotype were established. Experimental interface prototypes for a total of 108 combinations of display and control types were implemented. Experimental data collection and analysis system was built in association with the interface prototypes. The experiment was performed with participation of 250 students as subjects. About 20 guideline items were developed based on the results obtained from our analysis of experimental data
Experimental study on display-control stereotype and development of human factors guidelines
Energy Technology Data Exchange (ETDEWEB)
Lee, Jung Woon; Lee, Yong Hee; Oh, In Seok; Lee, Hyun Chul [KAERI, Taejon (Korea, Republic of); Cha, Woo Chang [Kumoh National Univ. of Technolgy, Gumi (Korea, Republic of)
2003-01-01
It is very important to develop the design guidelines which can be applicable for Korean operators for the purpose of designing the KSNP more safely. The objective of this project is to provide the standards, guidelines and bases applicable for HF-010 through the within-subject experiment for obtaining Korean operators' population stereotype for direction-of-movement of controls associated with displays on the control panels. Through the survey of researches on display compatibility and the classification of types of displays and controls in the main control room of Uljin units 3 and 4, methods for an experiment on the stereotype were established. Experimental interface prototypes for a total of 108 combinations of display and control types were implemented. Experimental data collection and analysis system was built in association with the interface prototypes. The experiment was performed with participation of 250 students as subjects. About 20 guideline items were developed based on the results obtained from our analysis of experimental data.
Atmospheric-pressure plasma technology
International Nuclear Information System (INIS)
Kogelschatz, U
2004-01-01
Major industrial plasma processes operating close to atmospheric pressure are discussed. Applications of thermal plasmas include electric arc furnaces and plasma torches for generation of powders, for spraying refractory materials, for cutting and welding and for destruction of hazardous waste. Other applications include miniature circuit breakers and electrical discharge machining. Non-equilibrium cold plasmas at atmospheric pressure are obtained in corona discharges used in electrostatic precipitators and in dielectric-barrier discharges used for generation of ozone, for pollution control and for surface treatment. More recent applications include UV excimer lamps, mercury-free fluorescent lamps and flat plasma displays
[Current situations and problems of quality control for medical imaging display systems].
Shibutani, Takayuki; Setojima, Tsuyoshi; Ueda, Katsumi; Takada, Katsumi; Okuno, Teiichi; Onoguchi, Masahisa; Nakajima, Tadashi; Fujisawa, Ichiro
2015-04-01
Diagnostic imaging has been shifted rapidly from film to monitor diagnostic. Consequently, Japan medical imaging and radiological systems industries association (JIRA) have recommended methods of quality control (QC) for medical imaging display systems. However, in spite of its need by majority of people, executing rate is low. The purpose of this study was to validate the problem including check items about QC for medical imaging display systems. We performed acceptance test of medical imaging display monitors based on Japanese engineering standards of radiological apparatus (JESRA) X-0093*A-2005 to 2009, and performed constancy test based on JESRA X-0093*A-2010 from 2010 to 2012. Furthermore, we investigated the cause of trouble and repaired number. Medical imaging display monitors had 23 inappropriate monitors about visual estimation, and all these monitors were not criteria of JESRA about luminance uniformity. Max luminance was significantly lower year-by-year about measurement estimation, and the 29 monitors did not meet the criteria of JESRA about luminance deviation. Repaired number of medical imaging display monitors had 25, and the cause was failure liquid crystal panel. We suggested the problems about medical imaging display systems.
Directory of Open Access Journals (Sweden)
Wenhui Yang
Full Text Available Crystal proteins synthesized by Bacillus thuringiensis (Bt have been used as biopesticides because of their toxicity to the insect larval hosts. To protect the proteins from environmental stress to extend their activity, we have developed a new microcapsule formulation. Poly (acrylic acid (PAH and poly (styrene sulfonate (PSS were fabricated through layer-by-layer self-assembly based on a CaCO(3 core. Cry1Ac protoxins were loaded into microcapsules through layer-by-layer self-assembly at low pH, and the encapsulated product was stored in water at 4°C. Scanning electron microscopy (SEM was used to observe the morphology of the capsules. To confirm the successful encapsulation, the loading results were observed with a confocal laser scattering microscope (CLSM, using fluorescein-labeled Cry1Ac protoxin (FITC-Cry1Ac. The protoxins were released from the capsule under the alkaline condition corresponding to the midgut of certain insects, a condition which seldom exists elsewhere in the environment. The following bioassay experiment demonstrated that the microcapsules with Cry1Ac protoxins displayed approximately equivalent insecticidal activity to the Asian corn borer compared with free Cry1Ac protoxins, and empty capsules proved to have no effect on insects. Further result also indicated that the formulation could keep stable under the condition of heat and desiccation. These results suggest that this formulation provides a promising methodology that protects protoxins from the environment and releases them specifically in the target insects' midgut, which has shown potential as biopesticide in the field.
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
2012-05-15
... following items: Glass partitions. Glass attached to the ceiling. Wall/door mounted mirrors/glass panels... indicator protective transparencies, or monitor screens such as liquid crystal display (LCD) or plasma...
AC Electroluminescent Processes in Pr3+-Activated (Ba0.4Ca0.6TiO3 Diphase Polycrystals
Directory of Open Access Journals (Sweden)
Nan Gao
2017-05-01
Full Text Available We investigated the properties of alternating current (AC-driven electroluminescence from (Ba0.4Ca0.6TiO3:Pr3+ diphase polycrystal-based device. The results of crystal phases and micrographs, and the symmetrical dual emissions in one AC cycle, indicate the spontaneous formation of a dielectric/phosphor/dielectric sandwich microstructure in (Ba0.4Ca0.6TiO3:Pr3+. The electroluminescent device emits a red light of 617 nm, which is attributed to the 1D2-3H4 transition of Pr3+ in the phosphor phase. At a fixed AC frequency, the intensity of electroluminescence exhibits a steep enhancement when applying an increased driving electric field that is beyond a threshold. In a fixed driving electric field, the intensity of electroluminescence shows a rapid rise at low frequencies, but reaches saturation at high frequencies. Based on a double-injection model, we discussed systematically the electroluminescent processes in a whole cycle of AC electric field, which matched well with the experimental data. Our investigation is expected to expand our understanding of such a diphase electroluminescent device, thereby promoting their applications in lighting and displays.
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
Optical residual stress measurement in TFT-LCD panels
Wang, Wei-Chung; Sung, Po-Chi
2017-06-01
The residual stress of the glass substrate might be one of causes to produce the non-uniform light distribution defect, i.e. Mura, in thin film transistor-liquid crystal display (TFT-LCD) panels. Glass is a birefringent material with very low birefringence. Furthermore, the thinner and thinner thickness request from the market makes the traditional photoelasticity almost impossible to measure the residual stresses produced in thin glass plates. Recently, a low-level stress measurement method called transmissivity extremities theory of photoelasticity (TEToP) was successfully developed to measure the residual stress in glass plate. Besides, to measure the stress of the glass plate in the TFT-LCD panel whose rear surface may has different kinds of coatings, an advanced reflection photoelasticity was also developed. In this paper, three commercially available glass plates with 0.33mm nominal thickness and three glass circular disks with different coatings were inspected to verify the feasibility of the TEToP and the advanced reflection photoelasticity, respectively.
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
The first object oriented monitor for intravenous anesthesia.
Cantraine, F R; Coussaert, E J
2000-01-01
To describe the design and implementation of "INFUSION TOOLBOX," a software tool to control and monitor multiple intravenous drug infusions simultaneously using pharmacokinetic and pharmacodynamic principles. INFUSION TOOLBOX has been designed to present a graphical interface. Object Oriented design was used and the software was implemented using Smalltalk, to run on a PC. Basic tools are available to manage patient, drugs, pumps and reports. These tools are the PatientPanel, the DrugPanel, the PumpPanel and the HistoryPanel. The screen is built dynamically. The panels may be collapsed or closed to avoid a crowded display. We also built control panels such as the Target ControlPanel which calculates the best infusion sequence to bring the drug concentration in the plasma compartment to a preset value. Before drug delivery, the user enters the patient's data, selects a drug, enters its dilution factor and chooses a pharmacokinetic model. The calculated plasma concentration is continually displayed and updated. The anesthetist may ask for the history of the delivery to obtain a graphic report or to add events to the logbook. A panel targeting the effect is used when a pharmacodynamic model is known. Data files for drugs, pumps and surgery are upgradable. By creating a resizeable ControlPanel we enable the anesthetist to display the information he wishes, when he wishes it. The available panels are diverse enough to meet the anesthetist needs; they may be adapted to the drug used, pumps used and surgery. It is the anesthetist who builds dynamically its different control screens. By adopting an evolutionary solution model we have achieved considerable success in building our drug delivery monitor. In addition we have gained valuable insight into the anesthesia information domain that will allow us to further enhance and expand the system.
Volumetric three-dimensional display system with rasterization hardware
Favalora, Gregg E.; Dorval, Rick K.; Hall, Deirdre M.; Giovinco, Michael; Napoli, Joshua
2001-06-01
An 8-color multiplanar volumetric display is being developed by Actuality Systems, Inc. It will be capable of utilizing an image volume greater than 90 million voxels, which we believe is the greatest utilizable voxel set of any volumetric display constructed to date. The display is designed to be used for molecular visualization, mechanical CAD, e-commerce, entertainment, and medical imaging. As such, it contains a new graphics processing architecture, novel high-performance line- drawing algorithms, and an API similar to a current standard. Three-dimensional imagery is created by projecting a series of 2-D bitmaps ('image slices') onto a diffuse screen that rotates at 600 rpm. Persistence of vision fuses the slices into a volume-filling 3-D image. A modified three-panel Texas Instruments projector provides slices at approximately 4 kHz, resulting in 8-color 3-D imagery comprised of roughly 200 radially-disposed slices which are updated at 20 Hz. Each slice has a resolution of 768 by 768 pixels, subtending 10 inches. An unusual off-axis projection scheme incorporating tilted rotating optics is used to maintain good focus across the projection screen. The display electronics includes a custom rasterization architecture which converts the user's 3- D geometry data into image slices, as well as 6 Gbits of DDR SDRAM graphics memory.
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
Prehospital use of plasma: the blood bankers' perspective.
Hervig, Tor; Doughty, Heidi; Ness, Paul; Badloe, John F; Berseus, Olle; Glassberg, Elon; Heier, Hans E
2014-05-01
At the 2013 Traumatic Hemostasis and Oxygenation Research Network's Remote Damage Control Resuscitation symposium, a panel of senior blood bankers with both civilian and military background was invited to discuss their willingness and ability to supply prehospital plasma for resuscitation of massively bleeding casualties and to comment on the optimal preparations for such situations. Available evidence indicates that prehospital use of plasma may improve remote damage control resuscitation, although level I evidence is lacking. This practice is well established in several military services and is also being introduced in civilian settings. There are few, if any, clinical contraindications to the prehospital use of plasma, except for blood group incompatibility and the danger of transfusion-induced acute lung injury, which can be circumvented in various ways. However, the choice of plasma source, plasma preparation, and logistics including stock management require consideration. Staff training should include hemovigilance and traceability as well as recognition and management of eventual adverse effects. Prehospital use of plasma should occur within the framework of clinical algorithms and prospective clinical studies. Clinicians have an ethical responsibility to both patients and donors; therefore, the introduction of new clinical capabilities of transfusion must be safe, efficacious, and sustainable. The panel agreed that although these problems need further attention and scientific studies, now is the time for both military and civilian transfusion systems to prepare for prehospital use of plasma in massively bleeding casualties.
Charging and Heating Dynamics of Nanoparticles in Nonthermal Plasmas
Energy Technology Data Exchange (ETDEWEB)
Kortshagen, Uwe R.
2014-08-15
The focus of this award was to understand the interactions of nanometer-sized particles with ionized gases, also called plasmas. Plasmas are widely used in the fabrication of electronic circuits such as microprocessors and memory devices, in plasma display panels, as well as in medical applications. Recently, these ionized gases are finding applications in the synthesis of advanced nanomaterials with novel properties, which are based on nanometer-sized particulate (nanoparticles) building blocks. As these nanoparticles grow in the plasma environment, they interact with the plasmas species such as electrons and ions which critically determines the nanoparticle properties. The University of Minnesota researchers conducting this project performed numerical simulations and developed analytical models that described the interaction of plasma-bound nanoparticles with the plasma ions. The plasma ions bombard the nanoparticle surface with substantial energy, which can result in the rearrangement of the nanoparticles’ atoms, giving them often desirable structures at the atomic scale. Being able to tune the ion energies allows to control the properties of nanoparticles produced in order to tailor their attributes for certain applications. For instance, when used in high efficiency light emitting devices, nanoparticles produced under high fluxes of highly energetic ions may show superior light emission to particles produced under low fluxes of less energetic ions. The analytical models developed by the University of Minnesota researchers enable the research community to easily determine the energy of ions bombarding the nanoparticles. The researchers extensively tested the validity of the analytical models by comparing them to sophisticated computer simulations based on stochastic particle modeling, also called Monte Carlo modeling, which simulated the motion of hundreds of thousands of ions and their interaction with the nanoparticle surfaces. Beyond the scientific
Panel and planar experimental shear behavior of wood panels ...
African Journals Online (AJOL)
Panel shear strength along the thickness and planar shear along the length of wood panels laminated softwood oriented OSB 10 mm thick, conditioned at different moisture contents (anhydrous medium, ambient temperature and humid medium) was measured on standardized test specimens, cut in half lengthwise panel ...
Gotfried, Mark H; Horn, Karolyn; Garrity-Ryan, Lynne; Villano, Stephen; Tzanis, Evan; Chitra, Surya; Manley, Amy; Tanaka, S Ken; Rodvold, Keith A
2017-09-01
The steady-state concentrations of omadacycline and tigecycline in the plasma, epithelial lining fluid (ELF), and alveolar cells (AC) of 58 healthy adult subjects were obtained. Subjects were administered either omadacycline at 100 mg intravenously (i.v.) every 12 h for two doses followed by 100 mg i.v. every 24 h for three doses or tigecycline at an initial dose of 100 mg i.v. followed by 50 mg i.v. every 12 h for six doses. A bronchoscopy and bronchoalveolar lavage were performed once in each subject following the start of the fifth dose of omadacycline at 0.5, 1, 2, 4, 8, 12, or 24 h and after the start of the seventh dose of tigecycline at 2, 4, 6, or 12 h. The value of the area under the concentration-time curve (AUC) from time zero to 24 h postdosing (AUC 0-24 ) (based on mean concentrations) in ELF and the ratio of the ELF to total plasma omadacycline concentration based on AUC 0-24 values were 17.23 mg · h/liter and 1.47, respectively. The AUC 0-24 value in AC was 302.46 mg · h/liter, and the ratio of the AC to total plasma omadacycline concentration was 25.8. In comparison, the values of the AUC from time zero to 12 h postdosing (AUC 0-12 ) based on the mean concentrations of tigecycline in ELF and AC were 3.16 and 38.50 mg · h/liter, respectively. The ratio of the ELF and AC to total plasma concentrations of tigecycline based on AUC 0-12 values were 1.71 and 20.8, respectively. The pharmacokinetic advantages of higher and sustained concentrations of omadacycline compared to those of tigecycline in plasma, ELF, and AC suggest that omadacycline is a promising antibacterial agent for the treatment of lower respiratory tract bacterial infections caused by susceptible pathogens. Copyright © 2017 Gotfried et al.
Suetsugu, Noriyuki; Sato, Yoshikatsu; Tsuboi, Hidenori; Kasahara, Masahiro; Imaizumi, Takato; Kagawa, Takatoshi; Hiwatashi, Yuji; Hasebe, Mitsuyasu; Wada, Masamitsu
2012-11-01
Chloroplasts require association with the plasma membrane for movement in response to light and for appropriate positioning within the cell to capture photosynthetic light efficiently. In Arabidopsis, CHLOROPLAST UNUSUAL POSITIONING 1 (CHUP1), KINESIN-LIKE PROTEIN FOR ACTIN-BASED CHLOROPLAST MOVEMENT 1 (KAC1) and KAC2 are required for both the proper movement of chloroplasts and the association of chloroplasts with the plasma membrane, through the reorganization of short actin filaments located on the periphery of the chloroplasts. Here, we show that KAC and CHUP1 orthologs (AcKAC1, AcCHUP1A and AcCHUP1B, and PpKAC1 and PpKAC2) play important roles in chloroplast positioning in the fern Adiantum capillus-veneris and the moss Physcomitrella patens. The knockdown of AcKAC1 and two AcCHUP1 genes induced the aggregation of chloroplasts around the nucleus. Analyses of A. capillus-veneris mutants containing perinuclear-aggregated chloroplasts confirmed that AcKAC1 is required for chloroplast-plasma membrane association. In addition, P. patens lines in which two KAC genes had been knocked out showed an aggregated chloroplast phenotype similar to that of the fern kac1 mutants. These results indicate that chloroplast positioning and movement are mediated through the activities of KAC and CHUP1 proteins, which are conserved in land plants.
Performance specification methodology: introduction and application to displays
Hopper, Darrel G.
1998-09-01
Acquisition reform is based on the notion that DoD must rely on the commercial marketplace insofar as possible rather than solely looking inward to a military marketplace to meet its needs. This reform forces a fundamental change in the way DoD conducts business, including a heavy reliance on private sector models of change. The key to more reliance on the commercial marketplace is the performance specifications (PS). This paper introduces some PS concepts and a PS classification principal to help bring some structure to the analysis of risk (cost, schedule, capability) in weapons system development and the management of opportunities for affordable ownership (maintain/increase capability via technology insertion, reduce cost) in this new paradigm. The DoD shift toward commercial components is nowhere better exemplified than in displays. Displays are the quintessential dual-use technology and are used herein to exemplify these PS concepts and principal. The advent of flat panel displays as a successful technology is setting off an epochal shift in cockpits and other military applications. Displays are installed in every DoD weapon system, and are, thus, representative of a range of technologies where issues and concerns throughout industry and government have been raised regarding the increased DoD reliance on the commercial marketplace. Performance specifications require metrics: the overall metrics of 'information-thrust' with units of Mb/s and 'specific info- thrust' with units of Mb/s/kg are introduced to analyze value of a display to the warfighter and affordability to the taxpayer.
Human Engineering of Space Vehicle Displays and Controls
Whitmore, Mihriban; Holden, Kritina L.; Boyer, Jennifer; Stephens, John-Paul; Ezer, Neta; Sandor, Aniko
2010-01-01
Proper attention to the integration of the human needs in the vehicle displays and controls design process creates a safe and productive environment for crew. Although this integration is critical for all phases of flight, for crew interfaces that are used during dynamic phases (e.g., ascent and entry), the integration is particularly important because of demanding environmental conditions. This panel addresses the process of how human engineering involvement ensures that human-system integration occurs early in the design and development process and continues throughout the lifecycle of a vehicle. This process includes the development of requirements and quantitative metrics to measure design success, research on fundamental design questions, human-in-the-loop evaluations, and iterative design. Processes and results from research on displays and controls; the creation and validation of usability, workload, and consistency metrics; and the design and evaluation of crew interfaces for NASA's Crew Exploration Vehicle are used as case studies.
Kazunori, NOSAKA; Kei, SAKAMOTO; Mike, NEWTON; Exercise and Sports Science, Graduate School of Integrated Science, Yokohama City University:School of Biomedical and Sports Science, Edith Cowan University; Exercise and Sports Science, Graduate School of Integrated Science, Yokohama City University; School of Biomedical and Sports Science, Edith Cowan University
2002-01-01
It was hypothesized that the time course of changes in plasma creatine kinase (CK) activity following eccentric exercise was influenced by rhythmical muscle contractions performed after eccentric exercise. This study examined whether arm-cranking (AC) alters the time course of changes in plasma creatine kinase (CK) activity after eccentric exercise of the elbow flexors (ECC). Six male students performed two bouts of ECC separated by 3 weeks, and AC (25watts, 2-hours) was performed immediately...
Directory of Open Access Journals (Sweden)
Valdivia Hernan J
2011-08-01
Full Text Available Abstract Background Protein biomarker studies are currently hampered by a lack of measurement standards to demonstrate quality, reliability and comparability across multiple assay platforms. This is especially pertinent for immunoassays where multiple formats for detecting target analytes are commonly used. Findings In this pilot study a generic panel of six non-human protein standards (50 - 10^7 pg/mL of varying abundance was prepared as a quality control (QC material. Simulated "normal" and "diseased" panels of proteins were prepared in pooled human plasma and incorporated into immunoassays using the Meso Scale Discovery® (MSD® platform to illustrate reliable detection of the component proteins. The protein panel was also evaluated as a spike-in material for a model immunoassay involving detection of ovarian cancer biomarkers within individual human plasma samples. Our selected platform could discriminate between two panels of the proteins exhibiting small differences in abundance. Across distinct experiments, all component proteins exhibited reproducible signal outputs in pooled human plasma. When individual donor samples were used, half the proteins produced signals independent of matrix effects. These proteins may serve as a generic indicator of platform reliability. Each of the remaining proteins exhibit differential signals across the distinct samples, indicative of sample matrix effects, with the three proteins following the same trend. This subset of proteins may be useful for characterising the degree of matrix effects associated with the sample which may impact on the reliability of quantifying target diagnostic biomarkers. Conclusions We have demonstrated the potential utility of this panel of standards to act as a generic QC tool for evaluating the reproducibility of the platform for protein biomarker detection independent of serum matrix effects.
Impact of a narrow limiter SOL heat flux channel on the ITER first wall panel shaping
Czech Academy of Sciences Publication Activity Database
Kocan, M.; Pitts, R.A.; Arnoux, G.; Balboa, I.; de Vries, P.C.; Dejarnac, Renaud; Furno, I.; Goldston, R.J.; Gribov, Y.; Horáček, Jan; Komm, Michael; Labit, B.; LaBombard, B.; Lasnier, C.J.; Mitteau, R.; Nespoli, F.; Pace, D.; Pánek, Radomír; Stangeby, P.C.; Terry, J.L.; Tsui, C.; Vondráček, Petr
2015-01-01
Roč. 55, č. 3 (2015), 033019-033019 ISSN 0029-5515 R&D Projects: GA ČR(CZ) GAP205/12/2327; GA MŠk(CZ) LM2011021 Institutional support: RVO:61389021 Keywords : plasma * tokamak * ITER * first wall panel Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 4.040, year: 2015 http://iopscience.iop.org/0029-5515/55/3/033019/pdf/0029-5515_55_3_033019.pdf
Chow, Chi-Wai; Shiu, Ruei-Jie; Liu, Yen-Chun; Liao, Xin-Lan; Lin, Kun-Hsien; Wang, Yi-Chang; Chen, Yi-Yuan
2018-05-14
A frequency-shift-keying (FSK) visible light communication (VLC) system is proposed and demonstrated using advertisement light-panel as transmitter and mobile-phone image sensor as receiver. The developed application program (APP) in mobile-phone can retrieve the rolling shutter effect (RSE) pattern produced by the FSK VLC signal effectively. Here, we also define noise-ratio value (NRV) to evaluate the contrast of different advertisements displayed on the light-panel. Both mobile-phones under test can achieve success rate > 96% even when the transmission distance is up to 200 cm and the NRVs are low.
Development of an Evaluation Method for the Design Complexity of Computer-Based Displays
Energy Technology Data Exchange (ETDEWEB)
Kim, Hyoung Ju; Lee, Seung Woo; Kang, Hyun Gook; Seong, Poong Hyun [KAIST, Daejeon (Korea, Republic of); Park, Jin Kyun [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2011-10-15
The importance of the design of human machine interfaces (HMIs) for human performance and the safety of process industries has long been continuously recognized for many decades. Especially, in the case of nuclear power plants (NPPs), HMIs have significant implications for the safety of the NPPs because poor HMIs can impair the decision making ability of human operators. In order to support and increase the decision making ability of human operators, advanced HMIs based on the up-to-date computer technology are provided. Human operators in advanced main control room (MCR) acquire information through video display units (VDUs) and large display panel (LDP), which is required for the operation of NPPs. These computer-based displays contain a huge amount of information and present it with a variety of formats compared to those of a conventional MCR. For example, these displays contain more display elements such as abbreviations, labels, icons, symbols, coding, etc. As computer-based displays contain more information, the complexity of advanced displays becomes greater due to less distinctiveness of each display element. A greater understanding is emerging about the effectiveness of designs of computer-based displays, including how distinctively display elements should be designed. This study covers the early phase in the development of an evaluation method for the design complexity of computer-based displays. To this end, a series of existing studies were reviewed to suggest an appropriate concept that is serviceable to unravel this problem
Park, Jae-Hyeung; Kim, Hak-Rin; Kim, Yunhee; Kim, Joohwan; Hong, Jisoo; Lee, Sin-Doo; Lee, Byoungho
2004-12-01
A depth-enhanced three-dimensional-two-dimensional convertible display that uses a polymer-dispersed liquid crystal based on the principle of integral imaging is proposed. In the proposed method, a lens array is located behind a transmission-type display panel to form an array of point-light sources, and a polymer-dispersed liquid crystal is electrically controlled to pass or to scatter light coming from these point-light sources. Therefore, three-dimensional-two-dimensional conversion is accomplished electrically without any mechanical movement. Moreover, the nonimaging structure of the proposed method increases the expressible depth range considerably. We explain the method of operation and present experimental results.
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
Pandey, R. S.; Singh, Vikrant; Rani, Anju; Varughese, George; Singh, K. M.
2018-05-01
In the present paper Oblique propagating electromagnetic ion-cyclotron wave has been analyzed for anisotropic multi ion plasma (H+, He+, O+ ions) in earth magnetosphere for the Dione shell of L=7 i.e., the outer radiation belt of the magnetosphere for Loss-cone distribution function with a spectral index j in the presence of A.C. electric field. Detail for particle trajectories and dispersion relation has been derived by using the method of characteristic solution on the basis of wave particle interaction and transformation of energy. Results for the growth rate have been calculated numerically for various parameters and have been compared for different ions present in magnetosphere. It has been found that for studying the wave over wider spectrum, anisotropy for different values of j should be taken. The effect of frequency of A.C. electric field and angle which propagation vector make with magnetic field, on growth rate has been explained.
Hashmi, Jamil A; Zafar, Yusuf; Arshad, Muhammad; Mansoor, Shahid; Asad, Shaheen
2011-04-01
Several important biological processes are performed by distinct functional domains found on replication-associated protein (Rep) encoded by AC1 of geminiviruses. Two truncated forms of replicase (tAC1) gene, capable of expressing only the N-terminal 669 bp (5'AC1) and C-terminal 783 bp (3'AC1) nucleotides cloned under transcriptional control of the CaMV35S were introduced into cotton (Gossypium hirsutum L.) using LBA4404 strain of Agrobacterium tumefaciens to make use of an interference strategy for impairing cotton leaf curl virus (CLCuV) infection in transgenic cotton. Compared with nontransformed control, we observed that transgenic cotton plants overexpressing either N-terminal (5'AC1) or C-terminal (3'AC1) sequences confer resistance to CLCuV by inhibiting replication of viral genomic and β satellite DNA components. Molecular analysis by Northern blot hybridization revealed high transgene expression in early and late growth stages associated with inhibition of CLCuV replication. Of the eight T(1) transgenic lines tested, six had delayed and minor symptoms as compared to nontransformed control lines which developed disease symptoms after 2-3 weeks of whitefly-mediated viral delivery. Virus biological assay and growth of T(2) plants proved that transgenic cotton plants overexpressing 5'- and 3'AC1 displayed high resistance level up to 72, 81%, respectively, as compared to non-transformed control plants following inoculation with viruliferous whiteflies giving significantly high cotton seed yield. Progeny analysis of these plants by polymerase chain reaction (PCR), Southern blotting and virus biological assay showed stable transgene, integration, inheritance and cotton leaf curl disease (CLCuD) resistance in two of the eight transgenic lines having single or two transgene insertions. Transgenic cotton expressing partial AC1 gene of CLCuV can be used as virus resistance source in cotton breeding programs aiming to improve virus resistance in cotton crop.
Plasma Science Committee. Final progress report, July 15, 1994 - December 31, 1997
International Nuclear Information System (INIS)
1998-01-01
Organized in 1988 as a standing activity of the National Research Council (NRC), the PLSC [Plasma Science Committee] is charged with monitoring the continuing health and development of plasma science in the United States. Its goals are to identify the needs of the plasma science community, make recommendations about those needs, and provide guidance about existing research programs in plasma science. Its operating guidelines include the following tasks: (1) to provide a continuing forum for the discussion of problems in the field of plasma science; (2) to initiate, develop, and oversee special studies focused on high-priority topics; (3) to maintain a broad and unified definition of plasma science as a field; (4) to maintain a clear and comprehensive formulation of current plasma science policy issues and give guidance to decisionmakers in universities, nonprofit research centers, and government agencies; (5) to promote coordination among institutions involved in plasma science; (6) to make recommendations aimed at plasma science education; (7) to monitor the plasma-related industrial technological base; and (8) to sponsor workshops and symposia as a means of communication among different branches of the field. During this reporting period, the PLSC was involved with two major projects: a decadal assessment of the field as a whole, conducted by the Panel on Opportunities in Plasma Science and Technology (OPST), and a study of data needs in the modeling and simulation of plasma processing of materials, conducted by the Panel on Database Needs in Plasma Processing
Kim, Min Su; Bos, Philip J.; Kim, Dong-Woo; Yang, Deng-Ke; Lee, Joong Hee; Lee, Seung Hee
2016-01-01
Technology of displaying static images in portable displays, advertising panels and price tags pursues significant reduction in power consumption and in product cost. Driving at a low-frequency electric field in fringe-field switching (FFS) mode can be one of the efficient ways to save powers of the recent portable devices, but a serious drop of image-quality, so-called image-flickering, has been found in terms of the coupling of elastic deformation to not only quadratic dielectric effect but...
Discharge characteristics of plasma display panels with Si-doped MgO protective layers
Energy Technology Data Exchange (ETDEWEB)
Ram, Sanjay K., E-mail: sanjayk.ram@gmail.co [Laboratoire de Physique des Interfaces et des Couches Minces (UMR 7647 du CNRS), Ecole Polytechnique, 91128 Palaiseau Cedex (France); Department of Physics, Indian Institute of Technology Kanpur, Kanpur-208016 (India); Barik, U K [Samtel Color Limited, Ghaziabad-201009 (India); Sarkar, Surajit; Biswas, Paramananda [Department of Physics, Indian Institute of Technology Kanpur, Kanpur-208016 (India); Singh, Vandana [Laboratoire de Physique des Interfaces et des Couches Minces (UMR 7647 du CNRS), Ecole Polytechnique, 91128 Palaiseau Cedex (France); Dwivedi, H K [Samtel Color Limited, Ghaziabad-201009 (India); Kumar, Satyendra [Department of Physics, Indian Institute of Technology Kanpur, Kanpur-208016 (India)
2009-10-01
We report on our study of the influence of varying concentrations of Si doping on the secondary electron emission (SEE) yield of MgO thin films prepared by electron beam evaporation technique. The series of Si-doped MgO films were microstructurally characterized with various tools like X-ray diffraction, scanning electron microscopy and atomic force microscopy. The optimization of the concentration of Si doping is seen to enhance the SEE yield. We discuss the correlation of SEE yield in the context of different deposition and measurement conditions and crystalline orientation.
Creation of a U.S. Phosphorescent OLED Lighting Panel Manufacturing Facility
Energy Technology Data Exchange (ETDEWEB)
Hack, Michael
2013-09-30
Universal Display Corporation (UDC) has pioneered high efficacy phosphorescent OLED (PHOLED™) technology to enable the realization of an exciting new form of high quality, energy saving solid-date lighting. In laboratory test devices, we have demonstrated greater than 100 lm/W conversion efficacy. In this program, Universal Display will demonstrate the scalability of its proprietary UniversalPHOLED technology and materials for the manufacture of white OLED lighting panels that meet commercial lighting targets. Moser Baer Technologies will design and build a U.S.- based pilot facility. The objective of this project is to establish a pilot phosphorescent OLED (PHOLED) manufacturing line in the U.S. Our goal is that at the end of the project, prototype lighting panels could be provided to U.S. luminaire manufacturers for incorporation into products to facilitate the testing of design concepts and to gauge customer acceptance, so as to facilitate the growth of the embryonic U.S. OLED lighting industry. In addition, the team will provide a cost of ownership analysis to quantify production costs including OLED performance metrics which relate to OLED cost such as yield, materials usage, cycle time, substrate area, and capital depreciation. This project was part of a new DOE initiative designed to help establish and maintain U.S. leadership in this program will support key DOE objectives by showing a path to meet Department of Energy Solid-State Lighting Manufacturing Roadmap cost targets, as well as meeting its efficiency targets by demonstrating the energy saving potential of our technology through the realization of greater than 76 lm/W OLED lighting panels by 2012.
Fabrication of All Glass Bifurcation Microfluidic Chip for Blood Plasma Separation
Directory of Open Access Journals (Sweden)
Hyungjun Jang
2017-02-01
Full Text Available An all-glass bifurcation microfluidic chip for blood plasma separation was fabricated by a cost-effective glass molding process using an amorphous carbon (AC mold, which in turn was fabricated by the carbonization of a replicated furan precursor. To compensate for the shrinkage during AC mold fabrication, an enlarged photoresist pattern master was designed, and an AC mold with a dimensional error of 2.9% was achieved; the dimensional error of the master pattern was 1.6%. In the glass molding process, a glass microchannel plate with negligible shape errors (~1.5% compared to AC mold was replicated. Finally, an all-glass bifurcation microfluidic chip was realized by micro drilling and thermal fusion bonding processes. A separation efficiency of 74% was obtained using the fabricated all-glass bifurcation microfluidic chip.
Operation status display and monitoring system for BWR nuclear power plant
International Nuclear Information System (INIS)
Wakabayashi, Yasuo; Hayakawa, Hiroyasu; Kawamura, Atsuo; Kaneda, Mitsunori.
1982-01-01
Lately, the development of the system has been made for BWR plants, which monitors the operating status not only in normal operation but also in abnormal state and also for plant safety. Recently, the improvement of man-machine interface has been tried through the practical use of technique which displays data collectively on a CRT screen relating them mutually. As one of those results, the practical use of an electronic computer and color CRT display for No. 1 unit in the Fukushima No. 2 Nuclear Power Station (2F-1), Tokyo Electric Power Co., is described. Also, new centralized control panels containing such systems were used for the 1100 MWe BWR nuclear power plants now under construction, No. 3 unit of the Fukushima No. 2 Power Station and No. 1 unit of Kashiwazaki-Kariwa Nuclear Power Station (2F-3 and K-1, respectively). The display and monitoring system in 2F-1 plant is the first one in which a computer and color CRTs were practically employed for a BWR plant in Japan, and already in commercial operation. The advanced operating status monitoring system, to which the result of evaluation of the above system was added, was incorporated in the new centralized control panels presently under production for 2F-3 and K-1 plants. The outline of the system, the functions of an electronic computer, plant operating status monitor, surveillance test guide, the automation of plant operation and auxiliary operation guide are reported for these advanced monitoring system. It was confirmed that these systems are useful means to improve the man-machine communication for plant operation minitoring. (Wakatsuki, Y.)
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
Dielectric Strontium Zirconate Sprayed by a Plasma Torch.
Czech Academy of Sciences Publication Activity Database
Ctibor, Pavel; Sedláček, J.; Janata, Marek
2017-01-01
Roč. 10, č. 4 (2017), s. 225-230 ISSN 2008-2134 Institutional support: RVO:61389021 Keywords : Plasma spraying * Electrical properties * Strontium Zirconate * Insulators Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass OBOR OECD: Ceramics www.pccc.icrc.ac.ir/Articles/18/1/18/1010/
DEFF Research Database (Denmark)
Tetens, Inge
Following a request from the European Commission, the Panel on Dietetic Products, Nutrition and Allergies (NDA) derived Dietary Reference Values (DRVs) for vitamin C. The Panel concludes that an Average Requirement (AR) can be derived from indicators of vitamin C status, as well as a Population...... Reference Intake (PRI) assuming a coefficient of variation (CV) of 10 %. Several health outcomes possibly associated with vitamin C intake were also considered but data were found to be insufficient to establish DRVs. For healthy adults, the AR is determined from the quantity of vitamin C that balances...... metabolic vitamin C losses and allows the maintenance of an adequate body pool characterised by fasting plasma ascorbate concentrations at around 50 µmol/L. In men, an AR of 90 mg/day of vitamin C and a PRI of 110 mg/day are proposed. As no value for metabolic losses is available in women, the AR for women...
Silicon microelectronic field-emissive devices for advanced display technology
Morse, J. D.
1993-03-01
Field-emission displays (FED's) offer the potential advantages of high luminous efficiency, low power consumption, and low cost compared to AMLCD or CRT technologies. An LLNL team has developed silicon-point field emitters for vacuum triode structures and has also used thin-film processing techniques to demonstrate planar edge-emitter configurations. LLNL is interested in contributing its experience in this and other FED-related technologies to collaborations for commercial FED development. At LLNL, FED development is supported by computational capabilities in charge transport and surface/interface modeling in order to develop smaller, low-work-function field emitters using a variety of materials and coatings. Thin-film processing, microfabrication, and diagnostic/test labs permit experimental exploration of emitter and resistor structures. High field standoff technology is an area of long-standing expertise that guides development of low-cost spacers for FEDS. Vacuum sealing facilities are available to complete the FED production engineering process. Drivers constitute a significant fraction of the cost of any flat-panel display. LLNL has an advanced packaging group that can provide chip-on-glass technologies and three-dimensional interconnect generation permitting driver placement on either the front or the back of the display substrate.
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
International Nuclear Information System (INIS)
Slozhenkina, L.V.; Ruda, V.P.; Ushakova, T.E.; Kuzin, A.M.
1990-01-01
Basal and stimulated activity of adenylate cyclase (cyclizing ATP-pyrophosphate lyase, E.C. 4.6.1.1., AC) in plasma membranes of pumonary tissye was being studied during a year after fractionated irradiation of rats (2 Gyx3). Basal and hormone-stimulated activity of AC was shown to vary significantly from normal 6 and 12 months after irradiation. The exposed membranes responded differently to AC activation by isoproterenol and F -
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
Surface DBD for deposition of the PEO-like plasma polymers
Czech Academy of Sciences Publication Activity Database
Gordeev, Ivan; Šimek, Milan; Prukner, Václav; Choukourov, A.; Biederman, H.
2012-01-01
Roč. 9, č. 1 (2012), s. 83-89 ISSN 1612-8850 R&D Projects: GA ČR(CZ) GD104/09/H080 Institutional research plan: CEZ:AV0Z20430508 Keywords : AC barrier discharges * surface discharges * plasma polymers * poly(ethylene oxide) (PEO) * UV-vis spectroscopy Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.730, year: 2012 http://onlinelibrary.wiley.com/doi/10.1002/ppap.201100051/pdf
An experimental and numerical investigation of flat panel display cell using magnetic fluid
International Nuclear Information System (INIS)
Seo, J.-W.; Jeon, S.-M.; Park, S.J.; Lee, H.-S.
2002-01-01
Optical and fluid dynamical properties of magnetic fluid have been studied experimentally and numerically using a test device with a water-base magnetite magnetic fluid. It has been found that the 3.5 μm thick fluid film absorbs most of the incoming visible light and can be actuated fast enough to realize display devices. The computational simulation shows that the surface tension of the liquid plays the most dominant roles for the test device, and a device that can actuate the magnetic fluid magnetically is proposed
Energy Technology Data Exchange (ETDEWEB)
Anon
2001-07-01
Advantages and disadvantages of stressed skin panels, also known as structural insulated panels (SIPs), are discussed as material and labour-saving alternatives to traditional stick framing. Stressed skin panels are manufactured 'sandwich' assemblies with a rigid insulating polystyrene foam core, whose interior and exterior surfaces are bonded into panels. The skins distribute and carry the structural loading while the bonded foam core provides insulation and keeps the two skins aligned. Since there are fewer framing members, there is little thermal bridging and the R-value remains high. SIPs are usually manufactured in four feet by eight feet panels, although some manufacturers can produce panels up to eight feet by forty feet. SIPs are resource efficient as they use less wood than conventional framing (about 25 per cent less); can structurally cover large spans, requiring less supplementary framing. Use of SIPs eliminate the need for headers over small openings; provide the ability to nail anywhere; create less scrap and waste; lessen vulnerability to unfavourable weather and other job-site hazards, can reduce delays, and often can produce significant savings in material and labour costs. Limitations include the more complex approaches to plumbing and electrical systems, although this can be minimized by designers by incorporating much of the plumbing and electrical work on interior (non-panel) walls. Most stressed skin panels require one-half inch interior gypsum drywall. If become wet, stressed skin panels take a long time to dry out and may harbour mold growth. Larger stressed-skin panels used in floors and roofs, may require cranes or other machinery for handling because of their weight. Although not without some environmental impact, overall, stressed skin panels are judged to be a resource-efficient building technology with significant energy-efficiency benefits and distinct advantages over stick framing. 3 photos.
Relationship between plasma analytes and SPARE-AD defined brain atrophy patterns in ADNI.
Directory of Open Access Journals (Sweden)
Jon B Toledo
Full Text Available Different inflammatory and metabolic pathways have been associated with Alzheimeŕs disease (AD. However, only recently multi-analyte panels to study a large number of molecules in well characterized cohorts have been made available. These panels could help identify molecules that point to the affected pathways. We studied the relationship between a panel of plasma biomarkers (Human DiscoveryMAP and presence of AD-like brain atrophy patterns defined by a previously published index (SPARE-AD at baseline in subjects of the ADNI cohort. 818 subjects had MRI-derived SPARE-AD scores, of these subjects 69% had plasma biomarkers and 51% had CSF tau and Aβ measurements. Significant analyte-SPARE-AD and analytes correlations were studied in adjusted models. Plasma cortisol and chromogranin A showed a significant association that did not remain significant in the CSF signature adjusted model. Plasma macrophage inhibitory protein-1α and insulin-like growth factor binding protein 2 showed a significant association with brain atrophy in the adjusted model. Cortisol levels showed an inverse association with tests measuring processing speed. Our results indicate that stress and insulin responses and cytokines associated with recruitment of inflammatory cells in MCI-AD are associated with its characteristic AD-like brain atrophy pattern and correlate with clinical changes or CSF biomarkers.
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
Directory of Open Access Journals (Sweden)
Xin-Hua Sun
2014-08-01
Full Text Available Many heavy metals are essential for metabolic processes, but are toxic at elevated levels. Metal tolerance proteins provide resistance to this toxicity. In this study, we identified and characterized a heavy metal-associated protein, AcHMA1, from the halophyte, Atriplex canescens. Sequence analysis has revealed that AcHMA1 contains two heavy metal binding domains. Treatments with metals (Fe, Cu, Ni, Cd or Pb, PEG6000 and NaHCO3 highly induced AcHMA1 expression in A. canescens, whereas NaCl and low temperature decreased its expression. The role of AcHMA1 in metal stress tolerance was examined using a yeast expression system. Expression of the AcHMA1 gene significantly increased the ability of yeast cells to adapt to and recover from exposure to excess iron. AcHMA1 expression also provided salt, alkaline, osmotic and oxidant stress tolerance in yeast cells. Finally, subcellular localization of an AcHMA1/GFP fusion protein expressed in tobacco cells showed that AcHMA1 was localized in the plasma membrane. Thus, our results suggest that AcHMA1 encodes a membrane-localized metal tolerance protein that mediates the detoxification of iron in eukaryotes. Furthermore, AcHMA1 also participates in the response to abiotic stress.
Status of Issues in U.S. Edge-Plasma Research and Priority Topics for the Next Five Years
International Nuclear Information System (INIS)
Bateman, G.; Chang, C.; Fenstermacher, M.; Guzdar, P.; Hahm, T.S.; Krasheninnikov, S.; Kritz, A.; Rognlien, T D.; Schnack, D.; Schultz, D.; Snyder, P.; Stotler, D.; Terry, J.; Ulrickson, M.; Bolton, C.
2005-01-01
The Edge Coordinating Committee (ECC) was formed in July 14-15, 2004 when OFES Theory Team invited 14 plasma researchers to a two-day meeting in Germantown, MD to discuss the state of edge-plasma research in the U.S. with a focus on theory and modeling (see http://www.mfescience.org/ecc/ ecc/). At that time, OFES tasked the ECC with providing, in about a six month period, a report on the present status of key issues in this area together with a roadmap of what range of activities should be undertaken in the next five years to resolve these issues. This document is a response to that charge. Future edge-plasma research described here is assumed to fit into a budget constraint of a ''flat budget,'' with some additional activities cited for budget increases of as much as 50%. To obtain some measure of the relative fraction of OFES Theory funding presently devoted to edge plasma research, the OFES Theory Team informally surveyed funded work they support in this area at National Labs, Universities, and industry. John Mandrekas reported to us that approximately 10% of the present budget goes to edge-physics areas at 10 institutions, for a total of ∼$2.5M each year. While not explicitly estimated, we note that there are also important edge plasma projects in the Plasma Technology program, especially related to plasma/material sputtering interactions, near-surface plasma chemistry and transport, and impurity transport. Likewise, the Confinement Program has important efforts in interpreting edge-plasma data through modeling codes. This initial status/roadmap work of the ECC is complimentary to the Fusion Energy Science Sciences Advisory Committee (FESAC) Panel on Program Priorities (see http://www.mfescience.org/fesac/ fesac/). This Panel is charged with identifying major science and technology issues for all of controlled fusion and also with recommending campaigns to address these issues. The Panel has organized their report along six thematic areas, one of which
Geng, Xi; Shi, Zhiwei; Cheng, Keming; Dong, Hao; Zhao, Qun; Chen, Sinuo
2018-03-01
Plasma-based flow control is one of the most promising techniques for aerodynamic problems, such as delaying the boundary layer transition. The boundary layer’s characteristics induced by AC-DBD plasma actuators and applied by the actuators to delay the boundary layer transition on airfoil at Ma = 0.3 were experimentally investigated. The PIV measurement was used to study the boundary layer’s characteristics induced by the plasma actuators. The measurement plane, which was parallel to the surface of the actuators and 1 mm above the surface, was involved in the test, including the perpendicular plane. The instantaneous results showed that the induced flow field consisted of many small size unsteady vortices which were eliminated by the time average. The subsequent oil-film interferometry skin friction measurement was conducted on a NASA SC(2)-0712 airfoil at Ma = 0.3. The coefficient of skin friction demonstrates that the plasma actuators successfully delay the boundary layer transition and the efficiency is better at higher driven voltage.
Alternative Voice Switching and Control System Display Panel Format Simulation and Evaluation.
1984-02-01
hear DA statusF Dvoice FW1 3 voice FUTTER , push IA, DA statue DA Status DA Ole OFF d . ot e tI .1F S A-i 5, %P*-.*~. *.S**~ S a V * C. a6 4c Cu v V V c...UU 0 C C .4. 4c c I.. lbC (W. ki a A-2o -. ... -. - J6 ’... Ii I1N INDIMIIi A0tlS tAil.|: INIIIAIt, Hilli. IrumINAT.vs At..WlUNi’|L.. I. v’enecimon...ALTERNATIVE 2 RADIO SCREEN Displayed below is a frequency pair and its legend 127.100TM 317.7 HRM .. tI I11 I If-> M-main I It S-standby I II These appear
DEFF Research Database (Denmark)
Olesen, Laurits Højgaard; Bruus, Henrik; Ajdari, A.
2006-01-01
therefore extend the latter theories to account for three experimentally relevant effects: (i) vertical confinement of the pumping channel, (ii) Faradaic currents from electrochemical reactions at the electrodes, and (iii) nonlinear surface capacitance of the Debye layer. We report here that these effects......Recent experiments have demonstrated that ac electrokinetic micropumps permit integrable, local, and fast pumping (velocities similar to mm/s) with low driving voltage of a few volts only. However, they also displayed many quantitative and qualitative discrepancies with existing theories. We...
High-performance modeling of plasma-based acceleration and laser-plasma interactions
Vay, Jean-Luc; Blaclard, Guillaume; Godfrey, Brendan; Kirchen, Manuel; Lee, Patrick; Lehe, Remi; Lobet, Mathieu; Vincenti, Henri
2016-10-01
Large-scale numerical simulations are essential to the design of plasma-based accelerators and laser-plasma interations for ultra-high intensity (UHI) physics. The electromagnetic Particle-In-Cell (PIC) approach is the method of choice for self-consistent simulations, as it is based on first principles, and captures all kinetic effects, and also scale favorably to many cores on supercomputers. The standard PIC algorithm relies on second-order finite-difference discretization of the Maxwell and Newton-Lorentz equations. We present here novel formulations, based on very high-order pseudo-spectral Maxwell solvers, which enable near-total elimination of the numerical Cherenkov instability and increased accuracy over the standard PIC method for standard laboratory frame and Lorentz boosted frame simulations. We also present the latest implementations in the PIC modules Warp-PICSAR and FBPIC on the Intel Xeon Phi and GPU architectures. Examples of applications will be given on the simulation of laser-plasma accelerators and high-harmonic generation with plasma mirrors. Work supported by US-DOE Contracts DE-AC02-05CH11231 and by the European Commission through the Marie Slowdoska-Curie fellowship PICSSAR Grant Number 624543. Used resources of NERSC.
Metabolic panel - comprehensive; Chem-20; SMA20; Sequential multi-channel analysis with computer-20; SMAC20; Metabolic panel 20 ... Chernecky CC, Berger BJ. Comprehensive metabolic panel (CMP) - blood. In: ... Tests and Diagnostic Procedures . 6th ed. St Louis, MO: ...
Noise Reduction in Double‿Panel Structures by Cavity and Panel Resonance Control
Ho, J.; Berkhoff, Arthur P.
2011-01-01
This paper presents an investigation of the cavity and the panel resonance control in a double‿panel structure. The double‿panel structure, which consists of two panels with air in the gap, is widely adopted in many applications such as aerospace due to its light weight and effective
Noise reduction in double-panel structures by cavity and panel resonance control
Ho, J.-H.; Berkhoff, A.P
2011-01-01
This paper presents an investigation of the cavity and the panel resonance control in a double‐panel structure. The double‐panel structure, which consists of two panels with air in the gap, is widely adopted in many applications such as aerospace due to its light weight and effective
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
A Full-Color, High-Resolution Laser Projector for a Flight Simulator Visual Display
1993-08-01
Optical Engineering, 31 (11), 2300-2311. Welford, W.T., & Winston , R. (1989). High collection nonimaging optics . San Diego, CA: Academic Press. 17 ... optically combines the output from red, green, and blue LCD panels to produce color. A light valve extracts the three primaries from a single xenon... concentrated than the noncoherent light sources used in light valve, CRT, LCD, and other displays. An obvious benefit of this is the ability to
Glow discharge processing in the liquid crystal display industry
International Nuclear Information System (INIS)
Schmitt, Jacques; Elyaakoubi, Mustapha; Sansonnens, Laurent
2002-01-01
The active matrix display industry is rapidly presented. The most challenging aspect for plasma source design lies in the substrate size which is now entering the 1-2 m range. This paper focuses on the conventional planar RF capacitor at 13.56 MHz. A detailed analysis of the local perturbation due to a hole in the metal susceptor illustrates the process effects of various plasma microscopic parameters. It appears that not only the process rate must be kept uniform, but also the ion bombardment. It is also shown that very wide capacitive reactors no longer follow some classical rules: (1) plasma RF conductivity is limited, its propagation is shown to be described by a telegraph equation, in agreement with numerical modelling and electrostatic measurements, (2) the RF wavelength is no longer infinite compared to the dimensions, this leads to standing waves. The presence of the plasma is shown to worsen the effect by shortening the RF propagation wavelength
Progress in the design of Normal Heat Flux First Wall panels for ITER
Energy Technology Data Exchange (ETDEWEB)
Cicero, Tindaro, E-mail: Tindaro.Cicero@f4e.europa.eu [Fusion for Energy, Josep Pla 2, Torres Diagonal Litoral B3, 08019 Barcelona (Spain); Jimenez, Marc; D’Amico, Gabriele; Pou, Jordi Ayneto; Dellopoulos, Georges; Alvaro, Elena; Cardenes, Sabas; Banetta, Stefano; Bellin, Boris; Zacchia, Francesco [Fusion for Energy, Josep Pla 2, Torres Diagonal Litoral B3, 08019 Barcelona (Spain); Calcagno, Barbara; Chappuis, Philippe; Gicquel, Stefan; Mitteau, Raphael; Raffray, Rene [ITER Organization, Route de Vinon-sur-Verdon, CS 90 046, 13067 St., Paul Lez Durance Cedex (France)
2015-10-15
Highlights: • Improved detail design of several NHF FW panels for ITER. • Implemented design solutions to improve the manufacturing of NHF FW panels. • Performed FEM simulations for the overall assessment of NHF FW panels. • Performed detailed analyses for integration of diagnostics in the NHF FW panels. - Abstract: A typical NHF FW panel consists of a series of fingers, which represent the elementary plasma facing units and are designed to withstand 15,000 cycles at 2 MW/m{sup 2}. The fingers are mechanically joined and supported by a back structural element or “supporting beam”. The structure of a finger is made of three different materials: stainless steel for the supporting structure, copper chromium zirconium for the heat sink, and beryllium as armour material. Due to their location and to the interfaces with other systems (e.g. Diagnostics, Remote Handling), the NHF FW panels are divided in different main and minor variants. The aim of this paper is to present the design work performed towards the PA signature. CAD detailed models have been created in CATIA for main and minor variants. Examples of local design solutions, as well as design work to achieve the global configuration of specific modules are provided. Finite Element (FE) analyses have been carried out, in order to simulate the operational scenario of ITER and assess the thermo-mechanical behaviour of the most important FW panels against the required design criteria. This design and analyses activity is required to progress towards the finalization of the detailed design of the NHF FW main and minor variants.
Progress in the design of Normal Heat Flux First Wall panels for ITER
International Nuclear Information System (INIS)
Cicero, Tindaro; Jimenez, Marc; D’Amico, Gabriele; Pou, Jordi Ayneto; Dellopoulos, Georges; Alvaro, Elena; Cardenes, Sabas; Banetta, Stefano; Bellin, Boris; Zacchia, Francesco; Calcagno, Barbara; Chappuis, Philippe; Gicquel, Stefan; Mitteau, Raphael; Raffray, Rene
2015-01-01
Highlights: • Improved detail design of several NHF FW panels for ITER. • Implemented design solutions to improve the manufacturing of NHF FW panels. • Performed FEM simulations for the overall assessment of NHF FW panels. • Performed detailed analyses for integration of diagnostics in the NHF FW panels. - Abstract: A typical NHF FW panel consists of a series of fingers, which represent the elementary plasma facing units and are designed to withstand 15,000 cycles at 2 MW/m"2. The fingers are mechanically joined and supported by a back structural element or “supporting beam”. The structure of a finger is made of three different materials: stainless steel for the supporting structure, copper chromium zirconium for the heat sink, and beryllium as armour material. Due to their location and to the interfaces with other systems (e.g. Diagnostics, Remote Handling), the NHF FW panels are divided in different main and minor variants. The aim of this paper is to present the design work performed towards the PA signature. CAD detailed models have been created in CATIA for main and minor variants. Examples of local design solutions, as well as design work to achieve the global configuration of specific modules are provided. Finite Element (FE) analyses have been carried out, in order to simulate the operational scenario of ITER and assess the thermo-mechanical behaviour of the most important FW panels against the required design criteria. This design and analyses activity is required to progress towards the finalization of the detailed design of the NHF FW main and minor variants.
PERBANDINGAN UNJUK KERJA ANTARA PANEL SEL SURYA BERPENJEJAK DENGAN PANEL SEL SURYA DIAM
Directory of Open Access Journals (Sweden)
Syafaruddin Ch
2010-07-01
Full Text Available The ability to produce electrical energy at Solar Power Plant is highly dependent on the magnitude and duration of sun exposure on the solar cell panels. The movement of the sun from east to west that periodicity in every day is a problem at the optimization generation of electricity at Solar Power Plant if using solar panel that motionless. This is because the solar cell panel can not catch the maximum sun exposure. To solve the above problem then designed a solar cell panel tracker capable of follo-wing the movements of the sun. Then conducted a test to see the performance of solar cell pa-nel tracker and compare it with the performance of solar cell panel was motionless. The testing doing along 6 days, with way to irradiate the panel of solar cells tracker and panels of solar cell motionless with sun exposure along a full day. Then the electric current generated each panel were recorded. The comparison of current then generating comparison of electric power delivery. The result show that the solar cell panel tracker produce the average current is 2.19 A whereas solar-cell panel still 1.97 A. This result indicate that average power for solar cell panel tracker 39.41 W while for solar cell panel that motionless is 35.46 W. These results indicate that the performance of solar cell panel tracker better than solar cell panel motionless.
Noise Reduction in Double‿Panel Structures by Cavity and Panel Resonance Control
Ho, J.; Berkhoff, Arthur P.
2011-01-01
This paper presents an investigation of the cavity and the panel resonance control in a double‿panel structure. The double‿panel structure, which consists of two panels with air in the gap, is widely adopted in many applications such as aerospace due to its light weight and effective transmission‿loss at high frequency. However, the resonance of the cavity and the poor transmission‿loss at low frequency limit its noise control performance. Applying active control forces on the panels or utili...
Mechanical testing of a FW panel attachment system for ITER
International Nuclear Information System (INIS)
Oliva, Vladislav; Vaclavik, Jaroslav; Materna, Ales; Lorenzetto, Patrick; Furmanek, Andreas
2009-01-01
An objective of experiments and finite element simulations was to check the stiffness, the strength and the fatigue resistance of the attachment of the First Wall panels onto a shield block of blanket modules according to the ITER 2001 design. The panel has a poloidal key at the rear side (in so-called option A with the rear access bolting) and it is attached by means of special studs located on a key-way in the shield block. Special device for a test of stud tensile pre-load relaxation during a thermal cycling was developed. True-to-scale panels, the shield block mock-up and simplified studs were fabricated and the assembly was loaded alternatively by radial moment, poloidal force or poloidal moment simulating the loading during off-normal plasma operations. Thermal cycling led to an acceptable stud pre-load relaxation. Mechanical cycling caused neither the pre-load relaxation nor the loss of the contact in the key-way nor a damage of the attachment system. The combination of poloidal moment and radial force during vertical displacement events (VDEs) seems to be a most dangerous case because it could lead to the loss of the key-key-way contact.
Design Integration of Man-Machine Interface (MMI) Display Drawings and MMI Database
Energy Technology Data Exchange (ETDEWEB)
Kim, Yong Jun; Seo, Kwang Rak; Song, Jeong Woog; Kim, Dae Ho; Han, Jung A [KEPCO Engineering and Construction Co., Deajeon (Korea, Republic of)
2016-10-15
The conventional Main Control Room (MCR) was designed using hardwired controllers and analog indications mounted on control boards for control and acquisition of plant information. This is compared with advanced MCR design where Flat Panel Displays (FPDs) with soft controls and mimic displays are used. The advanced design needs MMI display drawings replacing the conventional control board layout drawings and component lists. The data is linked to related object of the MMI displays. Compilation of the data into the DB is generally done manually, which tends to introduce errors and discrepancies. Also, updating and managing is difficult due to a huge number of entries in the DB and the update must closely track the changes in the associated drawing. Therefore, automating the DB update whenever a related drawing is updated would be quite beneficial. An attempt is made to develop a new method to integrate the MMIS display drawing design and the DB management. This would significantly reduce the amount of errors and improve design quality. The design integration of the MMI Display drawing and MMI DB is explained briefly but concisely in this paper. The existing method involved individually and separately inputting design data for the MMI display drawings. This caused to the potential problem of data discrepancies and errors as well as the update time lag between related drawings and the DB. This led to development of an integration of design process which automates the design data input activity.
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
Novel polymer coatings based on plasma polymerized 2-methoxyethyl acrylate
DEFF Research Database (Denmark)
Wu, Zhenning; Jiang, Juan; Benter, Maike
2008-01-01
plasma system[4]. The system named SoftPlasma™ is equipped with unique three-phase pulsed AC voltage. Low energy plasma polymerization has almost no thermal load for sensitive polymer materials[5]. Plasma polymerized coatings are highly cross-linked, pin-hole free and provide hydrophilic or hydrophobic...... properties[4-6]. We have exploited these possibilities and prepared plasma polymerized 2-methoxyethyl acrylate (PPMEA) coatings on various polymer substrates. The PPMEA coatings were optimized using various plasma polymerization conditions and characterized by X-ray photoelectron spectroscopy......, Fouriertransform infrared spectroscopy, Atomic force spectroscopy and Water contact-angle measurements. The microstructures ofPPMEA coatings with different thicknesses were also studied. For practical applications in mind, the coating stability was tested in different media (air, water, acetone, phosphate...
Water Treatment Using Plasma Discharge with Variation of Electrode Materials
Chanan, N.; Kusumandari; Saraswati, T. E.
2018-03-01
This research studied water treatment using plasma discharge. Plasma generated in this study produced active species that played a role in organic compound decomposition. The plasma reactor consisted of two needle electrodes made from stainless steel, tungsten, aluminium and grafit. It placed approximately 2 mm above the solution and connected with high-AC voltage. A solution of methylene blue used as an organic solution model. Plasma treatment times were 2, 4, 6, 8 and 10 min. The absorbance, temperature and pH of the solution were measured before and after treatment using various electrodes. The best electrode used in plasma discharging for methylene blue absorbance reduction was the graphite electrode, which provided the highest degradation efficiency of 98% at 6 min of treatment time.
Application of the Decomposition Method to the Design Complexity of Computer-based Display
Energy Technology Data Exchange (ETDEWEB)
Kim, Hyoung Ju; Lee, Seung Woo; Seong, Poong Hyun [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of); Park, Jin Kyun [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2012-05-15
The importance of the design of human machine interfaces (HMIs) for human performance and safety has long been recognized in process industries. In case of nuclear power plants (NPPs), HMIs have significant implications for the safety of the NPPs since poor implementation of HMIs can impair the operators' information searching ability which is considered as one of the important aspects of human behavior. To support and increase the efficiency of the operators' information searching behavior, advanced HMIs based on computer technology are provided. Operators in advanced main control room (MCR) acquire information through video display units (VDUs), and large display panel (LDP) required for the operation of NPPs. These computer-based displays contain a very large quantity of information and present them in a variety of formats than conventional MCR. For example, these displays contain more elements such as abbreviations, labels, icons, symbols, coding, and highlighting than conventional ones. As computer-based displays contain more information, complexity of the elements becomes greater due to less distinctiveness of each element. A greater understanding is emerging about the effectiveness of designs of computer-based displays, including how distinctively display elements should be designed. And according to Gestalt theory, people tend to group similar elements based on attributes such as shape, color or pattern based on the principle of similarity. Therefore, it is necessary to consider not only human operator's perception but the number of element consisting of computer-based display
Application of the Decomposition Method to the Design Complexity of Computer-based Display
International Nuclear Information System (INIS)
Kim, Hyoung Ju; Lee, Seung Woo; Seong, Poong Hyun; Park, Jin Kyun
2012-01-01
The importance of the design of human machine interfaces (HMIs) for human performance and safety has long been recognized in process industries. In case of nuclear power plants (NPPs), HMIs have significant implications for the safety of the NPPs since poor implementation of HMIs can impair the operators' information searching ability which is considered as one of the important aspects of human behavior. To support and increase the efficiency of the operators' information searching behavior, advanced HMIs based on computer technology are provided. Operators in advanced main control room (MCR) acquire information through video display units (VDUs), and large display panel (LDP) required for the operation of NPPs. These computer-based displays contain a very large quantity of information and present them in a variety of formats than conventional MCR. For example, these displays contain more elements such as abbreviations, labels, icons, symbols, coding, and highlighting than conventional ones. As computer-based displays contain more information, complexity of the elements becomes greater due to less distinctiveness of each element. A greater understanding is emerging about the effectiveness of designs of computer-based displays, including how distinctively display elements should be designed. And according to Gestalt theory, people tend to group similar elements based on attributes such as shape, color or pattern based on the principle of similarity. Therefore, it is necessary to consider not only human operator's perception but the number of element consisting of computer-based display
Paneling architectural freeform surfaces
Eigensatz, Michael
2010-07-25
The emergence of large-scale freeform shapes in architecture poses big challenges to the fabrication of such structures. A key problem is the approximation of the design surface by a union of patches, so-called panels, that can be manufactured with a selected technology at reasonable cost, while meeting the design intent and achieving the desired aesthetic quality of panel layout and surface smoothness. The production of curved panels is mostly based on molds. Since the cost of mold fabrication often dominates the panel cost, there is strong incentive to use the same mold for multiple panels. We cast the major practical requirements for architectural surface paneling, including mold reuse, into a global optimization framework that interleaves discrete and continuous optimization steps to minimize production cost while meeting user-specified quality constraints. The search space for optimization is mainly generated through controlled deviation from the design surface and tolerances on positional and normal continuity between neighboring panels. A novel 6-dimensional metric space allows us to quickly compute approximate inter-panel distances, which dramatically improves the performance of the optimization and enables the handling of complex arrangements with thousands of panels. The practical relevance of our system is demonstrated by paneling solutions for real, cutting-edge architectural freeform design projects.
Paneling architectural freeform surfaces
Eigensatz, Michael
2010-07-26
The emergence of large-scale freeform shapes in architecture poses big challenges to the fabrication of such structures. A key problem is the approximation of the design surface by a union of patches, socalled panels, that can be manufactured with a selected technology at reasonable cost, while meeting the design intent and achieving the desired aesthetic quality of panel layout and surface smoothness. The production of curved panels is mostly based on molds. Since the cost of mold fabrication often dominates the panel cost, there is strong incentive to use the same mold for multiple panels. We cast the major practical requirements for architectural surface paneling, including mold reuse, into a global optimization framework that interleaves discrete and continuous optimization steps to minimize production cost while meeting user-specified quality constraints. The search space for optimization is mainly generated through controlled deviation from the design surface and tolerances on positional and normal continuity between neighboring panels. A novel 6-dimensional metric space allows us to quickly compute approximate inter-panel distances, which dramatically improves the performance of the optimization and enables the handling of complex arrangements with thousands of panels. The practical relevance of our system is demonstrated by paneling solutions for real, cutting-edge architectural freeform design projects. © 2010 ACM.
International Nuclear Information System (INIS)
Ogram, G.L.; Chang, J.; Hobson, R.M.
1979-01-01
The calibration of electrostatic triple-probe voltage and current response in a supersonic continuum plasma has been carried out using a low-pressure shock tube. The electron temperature T/sub e/ and charge number density N/sub e/ are compared to probe voltage and current response, respectively, for a useful range of plasma parameters (1 13 13 is the nondimensional probe voltage). The dependence of probe response on Debye ratio R/sub p//lambda/sub D/ and various flow parameters was investigated. The probe voltage response was found to depend significantly on the Debye ratio. Expressions for electron temperature determination by triple probe are presented
Panel 5: Microbiology and Immunology Panel
Murphy, Timothy F.; Chonmaitree, Tasnee; Barenkamp, Stephen; Kyd, Jennelle; Nokso-Koivisto, Johanna; Patel, Janak A.; Heikkinen, Terho; Yamanaka, Noboru; Ogra, Pearay; Swords, W. Edward; Sih, Tania; Pettigrew, Melinda M.
2014-01-01
Objective The objective is to perform a comprehensive review of the literature from January 2007 through June 2011 on the virology, bacteriology, and immunology related to otitis media. Data Sources PubMed database of the National Library of Medicine. Review Methods Three subpanels with co-chairs comprising experts in the virology, bacteriology, and immunology of otitis media were formed. Each of the panels reviewed the literature in their respective fields and wrote draft reviews. The reviews were shared with all panel members, and a second draft was created. The entire panel met at the 10th International Symposium on Recent Advances in Otitis Media in June 2011 and discussed the review and refined the content further. A final draft was created, circulated, and approved by the panel. Conclusion Excellent progress has been made in the past 4 years in advancing an understanding of the microbiology and immunology of otitis media. Advances include laboratory-based basic studies, cell-based assays, work in animal models, and clinical studies. Implications for Practice The advances of the past 4 years formed the basis of a series of short-term and long-term research goals in an effort to guide the field. Accomplishing these goals will provide opportunities for the development of novel interventions, including new ways to better treat and prevent otitis media. PMID:23536533
Energy Technology Data Exchange (ETDEWEB)
Garbet, X
2001-06-01
The purpose of this work is to introduce the main processes that occur in a magnetized plasma. During the last 2 decades, the understanding of turbulence has made great progress but analytical formulas and simulations are far to produce reliable predictions. The values of transport coefficients in a tokamak plasma exceed by far those predicted by the theory of collisional transport. This phenomenon is called abnormal transport and might be due to plasma fluctuations. An estimation of turbulent fluxes derived from the levels of fluctuations, is proposed. A flow description of plasma allows the understanding of most micro-instabilities. The ballooning representation deals with instabilities in a toric geometry. 3 factors play an important role to stabilize plasmas: density pinch, magnetic shear and speed shear. The flow model of plasma gives an erroneous value for the stability threshold, this is due to a bad description of the resonant interaction between wave and particle. As for dynamics, flow models can be improved by adding dissipative terms so that the linear response nears the kinetic response. The kinetic approach is more accurate but is complex because of the great number of dimensions involved. (A.C.)
Pathan, F. S.; Khan, Z.; Semwal, P.; Raval, D. C.; Joshi, K. S.; Thankey, P. L.; Dhanani, K. R.
2008-05-01
Steady State Super-conducting (SST-1) Tokamak is in commissioning stage at Institute for Plasma Research. Vacuum chamber of SST-1 Tokamak consists of 1) Vacuum vessel, an ultra high vacuum (UHV) chamber, 2) Cryostat, a high vacuum (HV) chamber. Cryostat encloses the liquid helium cooled super-conducting magnets (TF and PF), which require the thermal radiation protection against room temperature. Liquid nitrogen (LN2) cooled panels are used to provide thermal shield around super-conducting magnets. During operation, LN2 panels will be under pressurized condition and its surrounding (cryostat) will be at high vacuum. Hence, LN2 panels must have very low leak rate. This paper describes an experiment to study the behaviour of the leaks in LN2 panels during sniffer test and pressure drop test using helium gas.
Energy Technology Data Exchange (ETDEWEB)
Pathan, F S; Khan, Z; Semwal, P; Raval, D C; Joshi, K S; Thankey, P L; Dhanani, K R [Institute for Plasma Research, Bhat, Gandhinagar - 382 428, Gujarat (India)], E-mail: firose@ipr.res.in
2008-05-01
Steady State Super-conducting (SST-1) Tokamak is in commissioning stage at Institute for Plasma Research. Vacuum chamber of SST-1 Tokamak consists of 1) Vacuum vessel, an ultra high vacuum (UHV) chamber, 2) Cryostat, a high vacuum (HV) chamber. Cryostat encloses the liquid helium cooled super-conducting magnets (TF and PF), which require the thermal radiation protection against room temperature. Liquid nitrogen (LN2) cooled panels are used to provide thermal shield around super-conducting magnets. During operation, LN{sub 2} panels will be under pressurized condition and its surrounding (cryostat) will be at high vacuum. Hence, LN{sub 2} panels must have very low leak rate. This paper describes an experiment to study the behaviour of the leaks in LN{sub 2} panels during sniffer test and pressure drop test using helium gas.
International Nuclear Information System (INIS)
Pathan, F S; Khan, Z; Semwal, P; Raval, D C; Joshi, K S; Thankey, P L; Dhanani, K R
2008-01-01
Steady State Super-conducting (SST-1) Tokamak is in commissioning stage at Institute for Plasma Research. Vacuum chamber of SST-1 Tokamak consists of 1) Vacuum vessel, an ultra high vacuum (UHV) chamber, 2) Cryostat, a high vacuum (HV) chamber. Cryostat encloses the liquid helium cooled super-conducting magnets (TF and PF), which require the thermal radiation protection against room temperature. Liquid nitrogen (LN2) cooled panels are used to provide thermal shield around super-conducting magnets. During operation, LN 2 panels will be under pressurized condition and its surrounding (cryostat) will be at high vacuum. Hence, LN 2 panels must have very low leak rate. This paper describes an experiment to study the behaviour of the leaks in LN 2 panels during sniffer test and pressure drop test using helium gas
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
DEFF Research Database (Denmark)
Schoos, Mikkel; Iversen, Kasper; Teisner, Ane
2008-01-01
Objective. Pregnancy-associated plasma protein A (PAPP-A) is expressed in eroded and ruptured atheromatous plaques, and circulating levels are elevated in acute coronary syndromes (ACS). Our objective was to investigate release patterns of PAPP-A in ACS and whether they differ among different typ...
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
Light-emitting liquid-crystal displays constructed from AIE luminogens
Zhao, Dongyu; Qin, Anjun; Tang, Ben Zhong; Leung, Chris Wai Tung
2014-10-01
Liquid crystal displays (LCDs) are widely used for diverse purposes in many aspects in daily life from handle personal devices to professional applications and large-panel LCD televisions. Since LCD is a passive emission display device, it usually shows narrow viewing angle and reduced brightness. Nowadays, LCDs with light-emitting properties is suggested as a less energy consuming displays. To date, fluorescent materials with dichroic properties and strong fluorescence emission are required. However, many molecular emitters, which are highly efficient in solution, will suffer from heavy aggregation-caused quenching (ACQ) effect in the aggregate state, which has greatly limited their applications. In order to overcome these weaknesses, we have designed and synthesized a novel luminescent liquid crystalline compound consisting of a tetraphenylethene (TPE) core, TPE-PPE, as a luminogen with mesogenic moieties. As a result, the TPE-PPE exhibits both the aggregate-induced emission (AIE) and thermotropic liquid crystalline characteristics. By dissolving 1 weight% (wt%) of TPE-PPE into the nematic LC host PA0182, a linearly polarized emission was obtained on the unidirectional orientated LC cell. The photoluminescence polarization ratio of the LC cell has reached to 4.16 between the directions perpendicular and parallel to the rubbing direction. Utilizing the emissive anisotropic TPE-PPE, we have fabricated the photoluminescent liquid crystal display (PL-LCD). This approach has simplified the device design, lowered the energy consumption and increased brightness of the LCD.
Multi-physics modeling of plasma-material interactions
Lasa, Ane; Green, David; Canik, John; Younkin, Timothy; Blondel, Sophie; Wirth, Brian; Drobny, Jon; Curreli, Davide
2017-10-01
Plasma-material interactions (PMI) can degrade both plasma and material properties. Often, PMI modeling focuses on either the plasma or surface. Here, we present an integrated model with high-fidelity codes coupled within the IPS framework that self-consistently addresses PMI. The model includes, calculation of spatially resolved influx of plasma and impurities to the surface and their implantation; surface erosion and roughening; evolution of implanted species and sub-surface composition; and transport of eroded particles across the plasma and their re-deposition. The model is applied and successfully compared to dedicated PISCES linear device experiments, where a tungsten (W) target was exposed to helium (He) plasma. The present contribution will focus on the analysis of W erosion, He retention and sub-surface gas bubble and surface composition evolution, under the different He plasma conditions across the surface that are calculated by impurity transport modeling. Impact of code coupling, reflected as interplay between surface erosion, fuel / impurity implantation and retention, and evolution of target composition, as well as sensitivity of these processes to plasma exposure conditions is also analyzed in detail. This work is supported by the US DOE under contract DE-AC05-00OR22725.
Cross-current leaching of indium from end-of-life LCD panels
Energy Technology Data Exchange (ETDEWEB)
Rocchetti, Laura; Amato, Alessia; Fonti, Viviana [Department of Life and Environmental Sciences, Università Politecnica delle Marche, Via Brecce Bianche, 60131 Ancona (Italy); Ubaldini, Stefano [Institute of Environmental Geology and Geoengineering IGAG, National Research Council, Via Salaria km 29300, 00015 Montelibretti, Rome (Italy); De Michelis, Ida [Department of Industrial Engineering, Information and Economy, University of L’Aquila, Via Giovanni Gronchi 18, 67100, Zona industriale di Pile, L’Aquila (Italy); Kopacek, Bernd [ISL Kopacek KG, Beckmanngasse 51, 1140 Wien (Austria); Vegliò, Francesco [Department of Industrial Engineering, Information and Economy, University of L’Aquila, Via Giovanni Gronchi 18, 67100, Zona industriale di Pile, L’Aquila (Italy); Beolchini, Francesca, E-mail: f.beolchini@univpm.it [Department of Life and Environmental Sciences, Università Politecnica delle Marche, Via Brecce Bianche, 60131 Ancona (Italy)
2015-08-15
Graphical abstract: Display Omitted - Highlights: • End-of-life LCD panels represent a source of indium. • Several experimental conditions for indium leaching have been assessed. • Indium is completely extracted with 2 M sulfuric acid at 80 °C for 10 min. • Cross-current leaching improves indium extraction and operating costs are lowered. • Benefits to the environment come from reduction of CO{sub 2} emissions and reagents use. - Abstract: Indium is a critical element mainly produced as a by-product of zinc mining, and it is largely used in the production process of liquid crystal display (LCD) panels. End-of-life LCDs represent a possible source of indium in the field of urban mining. In the present paper, we apply, for the first time, cross-current leaching to mobilize indium from end-of-life LCD panels. We carried out a series of treatments to leach indium. The best leaching conditions for indium were 2 M sulfuric acid at 80 °C for 10 min, which allowed us to completely mobilize indium. Taking into account the low content of indium in end-of-life LCDs, of about 100 ppm, a single step of leaching is not cost-effective. We tested 6 steps of cross-current leaching: in the first step indium leaching was complete, whereas in the second step it was in the range of 85–90%, and with 6 steps it was about 50–55%. Indium concentration in the leachate was about 35 mg/L after the first step of leaching, almost 2-fold at the second step and about 3-fold at the fifth step. Then, we hypothesized to scale up the process of cross-current leaching up to 10 steps, followed by cementation with zinc to recover indium. In this simulation, the process of indium recovery was advantageous from an economic and environmental point of view. Indeed, cross-current leaching allowed to concentrate indium, save reagents, and reduce the emission of CO{sub 2} (with 10 steps we assessed that the emission of about 90 kg CO{sub 2}-Eq. could be avoided) thanks to the recovery of indium
Conversion of methane to methanol in an ac dielectric barrier discharge
International Nuclear Information System (INIS)
Aghamir, F M; Matin, N S; Jalili, A H; Esfarayeni, M H; Khodagholi, M A; Ahmadi, R
2004-01-01
A dielectric barrier discharge (DBD) has been used to investigate the conversion of methane to methanol and higher hydrocarbons in ac non-equilibrium plasmas. Experiments were carried out at atmospheric pressure and ambient temperature. A non-equilibrium plasma was generated in a DBD reactor by applying a high voltage to the reactor electrodes. Activation of methane molecules led to the production of C 2 hydrocarbons and methanol. The effect of the applied voltage, residence time and feed mixture such as helium and oxygen on the methane conversion and product selectivity was studied. Helium appears to have no effect on the conversion and selectivity at our applied voltages. The methane conversion increases significantly on introduction of oxygen in the feed stream. Inclusion of oxygen leads to the formation of methanol. Our results show that production of methanol is initiated around an applied voltage of 12 kV and the conversion of methane increases with increasing voltage and residence time, while the product selectivity is independent of the applied voltage
Comparisons between various cavity and panel noise reduction control in double-panel structures
Ho, J.H.; Kalverboer, J.; Berkhoff, A.P.
2012-01-01
This paper presents comparisons between various panel and cavity resonance control methods to reduce the transmitted sound in a double-panel structure. The double-panel, which consists of two panels with air in the gap, has the advantages of low weight and effective transmission-loss at high
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
Preparation of erosion and deposition investigations on plasma facing components in Wendelstein 7-X
Dhard, C. P.; Balden, M.; Braeuer, T.; Brezinsek, S.; Coenen, J. W.; Dudek, A.; Ehrke, G.; Hathiramani, D.; Klose, S.; König, R.; Laux, M.; Linsmeier, Ch; Manhard, A.; Masuzaki, S.; Mayer, M.; Motojima, G.; Naujoks, D.; Neu, R.; Neubauer, O.; Rack, M.; Ruset, C.; Schwarz-Selinger, T.; Pedersen, T. Sunn; Tokitani, M.; Unterberg, B.; Yajima, M.; W7-X Team1, The
2017-12-01
In the Wendelstein 7-X stellarator with its twisted magnetic geometry the investigation of plasma wall interaction processes in 3D plasma configurations is an important research subject. For the upcoming operation phase i.e. OP1.2, three different types of material probes have been installed within the plasma vessel for the erosion/deposition investigations in selected areas with largely different expected heat load levels, namely, ≤10 MW m-2 at the test divertor units (TDU), ≤500 kW m-2 at the baffles, heat shields and toroidal closures and ≤100 kW m-2 at the stainless steel wall panels. These include 18 exchangeable target elements at TDU, about 30 000 screw heads at graphite tiles and 44 wafer probes on wall panels, coated with marker layers. The layer thicknesses, surface morphologies and the impurity contents were pre-characterized by different techniques and subjected to various qualification tests. The positions of these probes were fixed based on the strike line locations on the divertor predicted by field line diffusion and EMC3/EIRENE modeling calculations for the OP1.2 plasma configurations and availability of locations on panels in direct view of the plasma. After the first half of the operation phase i.e. OP1.2a the probes will be removed to determine the erosion/deposition pattern by post-mortem analysis and replaced by a new set for the second half of the operation phase, OP1.2b.
Ko, Eun-Byul; Choi, Jae-Seok; Jung, Hyunsung; Choi, Sung-Churl; Kim, Chang-Yeoul
2016-02-01
Transparent conducting oxide (TCO) is widely used for the application of flat panel display like liquid crystal displays and plasma display panel. It is also applied in the field of touch panel, solar cell electrode, low-emissivity glass, defrost window, and anti-static material. Fluorine-doped tin oxide (FTO) thin films were fabricated by spray pyrolysis of ethanol-added FTO precursor solutions. FTO thin film by spray pyrolysis is very much investigated and normally formed at high temperature, about 500 degrees C. However, these days, flexible electronics draw many attentions in the field of IT industry and the research for flexible transparent conducting thin film is also required. In the industrial field, indium-tin oxide (ITO) film on polymer substrate is widely used for touch panel and displays. In this study, we investigated the possibility of FTO thin film formation at relatively low temperature of 250 degrees C. We found out that the control of volume of input precursor and exhaust gases could make it possible to form FTO thin film with a relatively low electrical resistance, less than 100 Ohm/sq and high optical transmittance about 88%.
Directory of Open Access Journals (Sweden)
Fitriyah Nurul Hidayati Utami
2008-12-01
Full Text Available Warmer air condition as the impact of global warming had effect to human bulding scale, i.e. the increasing of room temperature (T and relative humidity (RH. It causes an uncomfortable situation inside one building without using mechanical controlling temperature equipment, such as air conditioner (AC. Therefore, there is an alternative to improve indoor amenity by using green panel construction which appropriate with green building concept. The terninology of green panel in this research was designated a panel made by an iron material, which as a function as secondary skin (second layer that protect room inside from direct solar radiation, and also as an attempt for green building, or as a media for liana-plant growing. This research was conducted in Departemnr of Landscafe Architecture (DLA Class Room and its Corridor (Wing 13, Level VI. As a comparison location was General Laboratory which is managed by Departement of Agronomy and Horticulture (DAH located in the same wing and level, and DAH’s seminar room in the same level, but it antother wing. The effect of micro climate (T and RH in DLA’s Class Room were showed from the value of Temperature Humidity Index (THI around 25.7 to 30.6, with average 28.1 which is categorized as uncomfortable zone. The THI of DLA’s Class Room were about 25.7-27.1 (in the morning, 25.8-29.3 (in the afternoon and 25.8-30.6 (in the evening. Amenity level (THI value of DLA’s Class Room after green panel constructions were changed to 25.4 until 30.2 with average 27.7 which is still in uncomfortable category. However, THI value in the morning was in comportable category. If green panel coverage’s reach 100% the average THI value will decrease to comportable category (THI 21.0-27.0. The result of SBE test shows that the SBE value has positive correlation with green panel construction. Four photos with the highest SBE’s value were the photo after green panel constructed. This mean the construction of green
An application of the process computer and CRT display system in BWR nuclear power station
International Nuclear Information System (INIS)
Goto, Seiichiro; Aoki, Retsu; Kawahara, Haruo; Sato, Takahisa
1975-01-01
A color CRT display system was combined with a process computer in some BWR nuclear power plants in Japan. Although the present control system uses the CRT display system only as an output device of the process computer, it has various advantages over conventional control panel as an efficient plant-operator interface. Various graphic displays are classified into four categories. The first is operational guide which includes the display of control rod worth minimizer and that of rod block monitor. The second is the display of the results of core performance calculation which include axial and radial distributions of power output, exit quality, channel flow rate, CHFR (critical heat flux ratio), FLPD (fraction of linear power density), etc. The third is the display of process variables and corresponding computational values. The readings of LPRM, control rod position and the process data concerning turbines and feed water system are included in this category. The fourth category includes the differential axial power distribution between base power distribution (obtained from TIP) and the reading of each LPRM detector, and the display of various input parameters being used by the process computer. Many photographs are presented to show examples of those applications. (Aoki, K.)
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
Stereoscopic-3D display design: a new paradigm with Intel Adaptive Stable Image Technology [IA-SIT
Jain, Sunil
2012-03-01
Stereoscopic-3D (S3D) proliferation on personal computers (PC) is mired by several technical and business challenges: a) viewing discomfort due to cross-talk amongst stereo images; b) high system cost; and c) restricted content availability. Users expect S3D visual quality to be better than, or at least equal to, what they are used to enjoying on 2D in terms of resolution, pixel density, color, and interactivity. Intel Adaptive Stable Image Technology (IA-SIT) is a foundational technology, successfully developed to resolve S3D system design challenges and deliver high quality 3D visualization at PC price points. Optimizations in display driver, panel timing firmware, backlight hardware, eyewear optical stack, and synch mechanism combined can help accomplish this goal. Agnostic to refresh rate, IA-SIT will scale with shrinking of display transistors and improvements in liquid crystal and LED materials. Industry could profusely benefit from the following calls to action:- 1) Adopt 'IA-SIT S3D Mode' in panel specs (via VESA) to help panel makers monetize S3D; 2) Adopt 'IA-SIT Eyewear Universal Optical Stack' and algorithm (via CEA) to help PC peripheral makers develop stylish glasses; 3) Adopt 'IA-SIT Real Time Profile' for sub-100uS latency control (via BT Sig) to extend BT into S3D; and 4) Adopt 'IA-SIT Architecture' for Monitors and TVs to monetize via PC attach.
Plasma theory and simulation. Quarterly progress report I, II, January 1-June 30, 1984
International Nuclear Information System (INIS)
Birdsall, C.K.
1984-01-01
Our group uses theory and simulation as tools in order to increase the understanding of instabilities, heating, transport, and other phenomena in plasmas. We also work on the improvement of simulation both theoretically and practically. Research in plasma theory and simulation has centered on the following: (1) electron Bernstein wave investigations; (2) simulation of plasma-sheath region, including ion reflection; (3) single ended plasma device, general behavior dc or ac; (4) single ended plasma device, unstable states; (5) corrections to time-independent Q-machine equilibria; (6) multifluid derivation of the Alfven ion-cyclotron linear dispersion relation; and (7) potential barrier between hot and cool plasmas
Diver, Jr., Richard B.; Grossman, James W [Albuquerque, NM; Reshetnik, Michael [Boulder, CO
2006-07-18
A solar collector comprising a glass mirror, and a composite panel, wherein the back of the mirror is affixed to a front surface of the composite panel. The composite panel comprises a front sheet affixed to a surface of a core material, preferably a core material comprising a honeycomb structure, and a back sheet affixed to an opposite surface of the core material. The invention may further comprise a sealing strip, preferably comprising EPDM, positioned between the glass mirror and the front surface of the composite panel. The invention also is of methods of making such solar collectors.
Directory of Open Access Journals (Sweden)
Tiago Simão Ferreira
2015-06-01
Full Text Available Este estudo aborda a técnica de modelagem da resposta acústica de um veículo automotor. Esta pesquisa discorre sobre a construção de modelos numéricos em elementos finitos para investigar o efeito da utilização de componentes móveis (capô, portas laterais e tampa do porta malas na resposta acústica de um veículo. Para tanto, foram construídos dois modelos: um que abrange a utilização de todos os componentes móveis, e outro, que substitui cada componente móvel por elementos unidimensionais (1D, contendo apenas a massa e a inércia que representa cada um destes componentes. A resposta obtida em cada uma das etapas da simulação numérica é comparada com os resultados experimentais, a fim de validar o procedimento e compreender a significância da utilização de um modelo numérico simplificado e assim, validar um modelo simplificado capaz de reproduzir computacionalmente e de forma satisfatória a resposta acústica de um veículo. A utilização do referido modelo simplificado possibilita a indústria automotiva realizar estudos sobre a performance acústica de um veículo de forma antecipada, uma vez que não necessita esperar o desenvolvimento destes componentes. Como investigado nesta pesquisa, a influência de componentes móveis sobre a resposta acústica do modelo numérico completo é pequena quando comparado à resposta obtida pelo modelo simplificado. Por meio de uma segunda análise, “Participação de Painéis”, é visto que a contribuição na resposta acústica final dos componentes móveis somados é inferior a 3dB.Palavras-chave: Método dos Elementos Finitos. Análise Acústica. Participação de Painéis. Acústica Veicular.ABSTRACTNumerical modeling technique using the finite element method in vehicle acoustic response studyThis study examines a modeling technique of the acoustic response in automotive vehicle. This research focuses on the development of numerical models in finite elements that
Abstracts of 4. IAEA technical meeting on the theory of plasma instabilities
International Nuclear Information System (INIS)
2009-05-01
The Fourth IAEA-TM on Theory of Plasma Instabilities provided a forum for open discussion on theoretical and computational physics issues relevant to burning plasma. The meeting covered linear and non-linear theory and simulation of plasma instabilities, including core/edge turbulence, magneto-hydrodynamic (MHD) process, high energy particle driven dynamics and their effects on plasma confinement. Special attention was paid to the multi-scale interaction dynamics in better understanding the burning plasma and also to the modeling of such complex physical processes. The meeting also organized a panel session to discuss the prospect of plasma theory and simulation for future fusion research for the ITER ERA. Young scientists were enthusiastically encouraged to enjoy this session which may stimulate the research for the future. The meeting covered the following topics: (1) Overview: State of the art and importance of multi-scale physics for understanding burning plasmas; (2) Linear and nonlinear instabilities and their theoretical/computational methodologies including critical gradient problem and comparison with experiments; (3) Core/edge turbulent transport including momentum transport, turbulence-profile interaction and barrier formation, etc and their theoretical/ computational understandings; (4) Magneto-hydrodynamic (MHD) instability including energetic particle physics and their impact on confinement in burning plasmas; (5) Physics and modeling of multi-scale interactions and their impact on the plasma performance and control. Those topics were discussed with close relevance to key experimental results. A panel session 'Theoretical Plasma Physics for the ITER ERA' was organized under interdisciplinary aspects with other fields such as astrophysics and fluid dynamics. Each of the abstracts available has been indexed separately
Energy Technology Data Exchange (ETDEWEB)
Baglin, H; Brin, A; Ozias, Y; Salmon, J [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires; Delcroix, J L [Ecole Normale Superieure, 75 - Paris (France)
1960-07-01
The equation giving the distribution function of the electrons in a steady-state, for a fully ionized plasma in an a.c. field, are provided from the Fokker-Planck equation. The electric conductivity is complex and depends on the frequency. (author) [French] L'equation qui donne la fonction de distribution des electrons dans un etat stationnaire pour un plasma totalement ionise dans un champ electrique alternatif est fournie par l'equation de Fokker-Planck. La conductibilite electrique est complexe et depend de la frequence. (auteur)
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
Proficiency testing for sensory profile panels : measuring panel performance
Mcewan, J.A.; Hunter, E.A.; Gemert, L.J. van; Lea, P.
2002-01-01
Proficiency testing in sensory analysis is an important step towards demonstrating that results from one sensory panel are consistent with the results of other sensory panels. The uniqueness of sensory analysis poses some specific problems for measuring the proficiency of the human instrument
Displaying DIII-D plasma data using DEC's X window system
International Nuclear Information System (INIS)
Greene, K.L.
1992-01-01
This paper reports on the DIII-D tokamak program funded by the Department of Energy, which carries out plasma physics and fusion energy research experiments. The machine began operation in February 1986; at that time, approximately 7 Mbytes of data was collected for each shot. Since that time, the shot size has steadily increased to over 50 Mbytes with the average shot size between 35 and 45 Mbytes. Shots are fired every 12 to 15 minutes and last approximately 5 to 10 seconds. Between 30 and 40 shots are fired each day when plasma experiments are scheduled. In 1990, both programs were converted from User Interface Services (UIS) routines, which are part of the MicroVMS workstation graphics software, to DEC's X Window System using the DECWindows window manager. These modifications were required because of a move by Digital Equipment Corporation (DEC) to support Xwindows and phase out UIS. Due to the nature and purpose of each program, MFITD needed only simple graphics conversion while MFITPLAY was completely rewritten. The DECWindows version of MFITPLAY offers a number of improvements, such as a more intuitive user interface
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
Real-time graphic display utility for nuclear safety applications
International Nuclear Information System (INIS)
Yang, S.; Huang, X.; Taylor, J.; Stevens, J.; Gerardis, T.; Hsu, A.; McCreary, T.
2006-01-01
With the increasing interests in the nuclear energy, new nuclear power plants will be constructed and licensed, and older generation ones will be upgraded for assuring continuing operation. The tendency of adopting the latest proven technology and the fact of older parts becoming obsolete have made the upgrades imperative. One of the areas for upgrades is the older CRT display being replaced by the latest graphics displays running under modern real time operating system (RTOS) with safety graded modern computer. HFC has developed a graphic display utility (GDU) under the QNX RTOS. A standard off-the-shelf software with a long history of performance in industrial applications, QNX RTOS used for safety applications has been examined via a commercial dedication process that is consistent with the regulatory guidelines. Through a commercial survey, a design life cycle and an operating history evaluation, and necessary tests dictated by the dedication plan, it is reasonably confirmed that the QNX RTOS was essentially equivalent to what would be expected in the nuclear industry. The developed GDU operates and communicates with the existing equipment through a dedicated serial channel of a flat panel controller (FPC) module. The FPC module drives a flat panel display (FPD) monitor. A touch screen mounted on the FPD serves as the normal operator interface with the FPC/FPD monitor system. The GDU can be used not only for replacing older CRTs but also in new applications. The replacement of the older CRT does not disturb the function of the existing equipment. It not only provides modern proven technology upgrade but also improves human ergonomics. The FPC, which can be used as a standalone controller running with the GDU, is an integrated hardware and software module. It operates as a single board computer within a control system, and applies primarily to the graphics display, targeting, keyboard and mouse. During normal system operation, the GDU has two sources of data
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
Engineering Design of the ITER AC/DC Power Supplies
International Nuclear Information System (INIS)
Oh, B. H.; Lee, K. W.; Hwang, C. K.; Jin, J. T.; Chang, D. S.; Kim, T. S.
2009-02-01
To design high power pulse power supplies, especially in huge power supplies have not designed till now, it is necessary to analyze a system's characteristics and relations with another systems as well as to know high voltage, high current control technologies. Contents of this project are; - Study for the engineering designs changed recently by ITER Organization(IO) and writing specifications for the power supplies to reduce project risk. - Detailed analysis of the AC/DC Converters and writing subtask reports on the Task Agreement. - Study for thyristor numbers, DCR's specifications for Korea-China sharing meetings. - Study for the grounding systems of the ITER power supply system. The results may used as one of reference for practical designs of the high power coil power supplies and also may used in various field such as electroplating, plasma arc furnaces, electric furnaces
Directory of Open Access Journals (Sweden)
Shi-Jun Zhang
2016-09-01
Full Text Available Objective: To analyze the sperm quality, oxidative stress injury as well as ACP, AC and PDE expression in patients with oligoasthenozoospermia before and after qilin pill treatment. Methods: A total of 60 patients with oligoasthenozoospermia were randomly divided into observation group and control group, control group received routine western medicine treatment, observation group received qilin pill + conventional western medicine treatment, and then differences in sperm quality, oxidative stress injury, ACP, AC and PDE expression, etc. were compared between two groups after treatment. Results: Semen volume and sperm density in semen samples of observation group after qilin pill treatment were higher than those of control group; serum FSH and LH levels were lower than those of control group, and the T level was higher than that of control group; ROS and MDA levels in seminal plasma were lower than those of control group, and SOD level was higher than that of control group; ACP, AC, α-Glu and Fru levels in seminal plasma were higher than those of control group, and PDE level was lower than that of control group. Conclusion: Qilin pill can improve sperm quality and optimize testicular internal environment in patients with oligoasthenozoospermia, and it has positive clinical significance.
The Material Plasma Exposure eXperiment (MPEX)
Rapp, J.; Biewer, T. M.; Bigelow, T. S.; Canik, J.; Caughman, J. B. O.; Duckworth, R. C.; Goulding, R. H.; Hillis, D. L.; Lore, J. D.; Lumsdaine, A.; McGinnis, W. D.; Meitner, S. J.; Owen, L. W.; Shaw, G. C.; Luo, G.-N.
2014-10-01
Next generation plasma generators have to be able to access the plasma conditions expected on the divertor targets in ITER and future devices. The Material Plasma Exposure eXperiment (MPEX) will address this regime with electron temperatures of 1--10 eV and electron densities of 1021--1020 m-3. The resulting heat fluxes are about 10 MW/m2. MPEX is designed to deliver those plasma conditions with a novel Radio Frequency plasma source able to produce high density plasmas and heat electron and ions separately with Electron Bernstein Wave (EBW) heating and Ion Cyclotron Resonance Heating (ICRH). Preliminary modeling has been used for pre-design studies of MPEX. MPEX will be capable to expose neutron irradiated samples. In this concept targets will be irradiated in ORNL's High Flux Isotope Reactor (HFIR) or possibly at the Spallation Neutron Source (SNS) and then subsequently (after a sufficient long cool-down period) exposed to fusion reactor relevant plasmas in MPEX. The current state of the pre-design of MPEX including the concept of handling irradiated samples will be presented. ORNL is managed by UT-Battelle, LLC, for the U.S. DOE under Contract DE-AC-05-00OR22725.
Large thermal protection system panel
Weinberg, David J. (Inventor); Myers, Franklin K. (Inventor); Tran, Tu T. (Inventor)
2003-01-01
A protective panel for a reusable launch vehicle provides enhanced moisture protection, simplified maintenance, and increased temperature resistance. The protective panel includes an outer ceramic matrix composite (CMC) panel, and an insulative bag assembly coupled to the outer CMC panel for isolating the launch vehicle from elevated temperatures and moisture. A standoff attachment system attaches the outer CMC panel and the bag assembly to the primary structure of the launch vehicle. The insulative bag assembly includes a foil bag having a first opening shrink fitted to the outer CMC panel such that the first opening and the outer CMC panel form a water tight seal at temperatures below a desired temperature threshold. Fibrous insulation is contained within the foil bag for protecting the launch vehicle from elevated temperatures. The insulative bag assembly further includes a back panel coupled to a second opening of the foil bag such that the fibrous insulation is encapsulated by the back panel, the foil bag, and the outer CMC panel. The use of a CMC material for the outer panel in conjunction with the insulative bag assembly eliminates the need for waterproofing processes, and ultimately allows for more efficient reentry profiles.
Curtin, Francois; Bernard, Corinne; Levet, Sandrine; Perron, Hervé; Porchet, Hervé; Médina, Julie; Malpass, Sam; Lloyd, David; Simpson, Richard
2018-05-10
We describe a newly identified therapeutic target for type 1 diabetes: an envelope protein of endogenous retroviral origin called Human Endogenous Retrovirus W Envelope (HERV-W-Env). HERV-W-Env was found to be detected in the blood of around 60% of type 1 diabetes (T1D) patients and is expressed in acinar pancreatic cells of 75% of T1D patients at post-mortem examination. Preclinical experiments showed that this protein displays direct cytotoxicity on human β-islet cells. In vivo HERV-W-Env impairs the insulin and glucose metabolism in transgenic mice expressing HERV-W-Env. GNbAC1, an IgG4 monoclonal antibody has been developed to specifically target HERV-W-Env and to neutralize the effect of HERV-W-Env in vitro and in vivo. GNbAC1 is currently in clinical development for multiple sclerosis and more than 300 subjects have been administered with GNbAC1 so far. GNbAC1 is now tested in T1D in the RAINBOW-T1D study: a randomized placebo controlled study with the objective of showing the safety and pharmacodynamics response of GNbAC1 in patients suffering from T1D with a maximum duration of 4 years. GNbAC1 is tested versus placebo at the dose of 6 mg/kg in 60 patients during 6 repeated administrations during 6 months, a 6-month open-label extension will follow. The primary endpoint will assess safety and secondary endpoints the pharmacodynamic responses to GNbAC1. GNbAC1 targeting HERV-W-Env is currently in clinical development in T1D with the first safety and pharmacodynamic study. If the study results are positive, this may open the door to the development of an innovative non-immunomodulatory disease modifying treatment for T1D. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.
Reflecting variable opening insulating panel
International Nuclear Information System (INIS)
Nungesser, W.T.
1976-01-01
A description is given of a reflecting variable opening insulating panel assembly, comprising a static panel assembly of reflecting insulation sheets forming a cavity along one side of the panel and a movable panel opening out by sliding from the cavity of the static panel, and a locking device for holding the movable panel in a position extending from the cavity of the static panel. This can apply to a nuclear reactor of which the base might require maintenance and periodical checking and for which it is desirable to have available certain processes for the partial dismantling of the insulation [fr
Transparent conductive-polymer strain sensors for touch input sheets of flexible displays
International Nuclear Information System (INIS)
Takamatsu, Seiichi; Takahata, Tomoyuki; Muraki, Masato; Iwase, Eiji; Matsumoto, Kiyoshi; Shimoyama, Isao
2010-01-01
A transparent conductive polymer-based strain-sensor array, designed especially for touch input sheets of flexible displays, was developed. A transparent conductive polymer, namely poly(3, 4-ethylenedioxythiophene):polystyrenesulfonate (PEDOT:PSS), was utilized owing to its strength under repeated mechanical bending. PEDOT:PSS strain sensors with a thickness of 130 nm exhibited light transmittance of 92%, which is the same as the transmittance of ITO electrodes widely used in flat panel displays. We demonstrated that the sensor array on a flexible sheet was able to sustain mechanical bending 300 times at a bending radius of 5 mm. The strain sensor shows a gauge factor of 5.2. The touch point on a flexible sheet could be detected from histograms of the outputs of the strain sensors when the sheet was pushed with an input force of 5 N. The touch input could be detected on the flexible sheet with a curved surface (radius of curvature of 20 mm). These results show that the developed transparent conductive polymer-based strain-sensor array is applicable to touch input sheets of mechanically bendable displays.
Industrial Applications of Low Temperature Plasmas
International Nuclear Information System (INIS)
Bardsley, J N
2001-01-01
The use of low temperature plasmas in industry is illustrated by the discussion of four applications, to lighting, displays, semiconductor manufacturing and pollution control. The type of plasma required for each application is described and typical materials are identified. The need to understand radical formation, ionization and metastable excitation within the discharge and the importance of surface reactions are stressed
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
International Nuclear Information System (INIS)
Glass, R.E.; Longenbaugh, R.S.
1986-01-01
Sandia National Laboratories developed the TRansUranic PACkage Transporter (TRUPACT) to transport defense contact-handled transuranic wastes. The package has been designed to meet the normal and hypothetical accident conditions in 10CFR71 which includes the demonstrated ability to survive a 1-meter drop onto a mild steel pin. The puncture protection is provided by puncture resistant panels. In conjunction with the development of TRUPACT, a series of experiments has been conducted to reduce the weight of the puncture resistant panels. The initial scoping tests resulted in a preliminary design incorporating 30 layers of Kevlar. This design has been shown to meet the regulatory puncture test. To reduce the weight of this panel, subscale tests were conducted on panels utilizing Kevlar yarns with varying mass per unit length (denier) as well as different resins. This paper reviews the testing undertaken in the original panel development and discusses the results obtained from the recent subscale and full-scale optimization tests
Dielectric properties of plasma sprayed silicates subjected to additional annealing
Czech Academy of Sciences Publication Activity Database
Ctibor, Pavel; Sedláček, J.; Nevrlá, Barbara; Neufuss, Karel
2017-01-01
Roč. 10, č. 2 (2017), s. 105-114 ISSN 2008-2134 Institutional support: RVO:61389021 Keywords : Annealing * Dielectric properties * Plasma spraying * Silicates * Electrical properties * Insulators Subject RIV: JK - Corrosion ; Surface Treatment of Materials OBOR OECD: Coating and films http://pccc.icrc.ac.ir/Articles/1/18/990/
Ho, J.; Kalverboer, J.; Berkhoff, Arthur P.
2012-01-01
Investigation and comparisons of the cavity control and the panel control in a double-panel structure are presented in this paper. The double-panel structure, which comprises two panels with air in the gap, provides the advantages of low sound-transmission at high frequency, low heat-transmission
Hepatic (Liver) Function Panel
... Educators Search English Español Blood Test: Hepatic (Liver) Function Panel KidsHealth / For Parents / Blood Test: Hepatic (Liver) ... kidneys ) is working. What Is a Hepatic (Liver) Function Panel? A liver function panel is a blood ...
High-beta plasma effects in a low-pressure helicon plasma
International Nuclear Information System (INIS)
Corr, C. S.; Boswell, R. W.
2007-01-01
In this work, high-beta plasma effects are investigated in a low-pressure helicon plasma source attached to a large volume diffusion chamber. When operating above an input power of 900 W and a magnetic field of 30 G a narrow column of bright blue light (due to Ar II radiation) is observed along the axis of the diffusion chamber. With this blue mode, the plasma density is axially very uniform in the diffusion chamber; however, the radial profiles are not, suggesting that a large diamagnetic current might be induced. The diamagnetic behavior of the plasma has been investigated by measuring the temporal evolution of the magnetic field (B z ) and the plasma kinetic pressure when operating in a pulsed discharge mode. It is found that although the electron pressure can exceed the magnetic field pressure by a factor of 2, a complete expulsion of the magnetic field from the plasma interior is not observed. In fact, under our operating conditions with magnetized ions, the maximum diamagnetism observed is ∼2%. It is observed that the magnetic field displays the strongest change at the plasma centre, which corresponds to the maximum in the plasma kinetic pressure. These results suggest that the magnetic field diffuses into the plasma sufficiently quickly that on a long time scale only a slight perturbation of the magnetic field is ever observed
Directory of Open Access Journals (Sweden)
Dongchul Choi
2014-11-01
Full Text Available In this study, indium-tin-oxide (ITO nanoparticles were simply recovered from the thin film transistor-liquid crystal display (TFT-LCD panel scraps by means of lift-off method. This can be done by dissolving color filter (CF layer which is located between ITO layer and glass substrate. In this way the ITO layer was easily lifted off the glass substrate of the panel scrap without panel crushing. Over 90% of the ITO on the TFT-LCD panel was recovered by using this method. After separating, the ITO was obtained as particle form and their characteristics were investigated. The recovered product appeared as aggregates of particles less than 100 nm in size. The weight ratio of In/Sn is very close to 91/9. XRD analysis showed that the ITO nanoparticles have well crystallized structures with (222 preferred orientation even after recovery. The method described in this paper could be applied to the industrial recovery business for large size LCD scraps from TV easily without crushing the glass substrate.
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
Nowak, Izabela; Bylińska, Aleksandra; Wilczyńska, Karolina; Wiśniewski, Andrzej; Malinowski, Andrzej; Wilczyński, Jacek R; Radwan, Paweł; Radwan, Michał; Barcz, Ewa; Płoski, Rafał; Motak-Pochrzęst, Hanna; Banasik, Małgorzata; Sobczyński, Maciej; Kuśnierczyk, Piotr
2017-01-01
Almost 1600 individuals from the Polish population were recruited to this study. Among them 319 were fertile couples, 289 were recurrent spontaneous abortion (RSA) couples, and 131 were in the group of recurrent implantation failure (RIF) following in vitro fertilization. The aim of this study was to evaluate the MTHFR c.c.677 C>T and c.c.1298 A>C polymorphisms' association with RSA and RIF. We used PCR-RFLP with HinfI (677 C>T) and MboII (1298 A>C) digestion. We observed a protective effect of the female AC genotype (OR = 0.64, p = 0.01) and the C allele (AC+CC genotypes; OR = 0.65, p = 0.009) against RSA. Moreover, 1298 AA/677 CT women were more frequent in RSA (31.14%) and RIF (25.20%) groups in comparison to fertile women (22.88%), although this difference was significant only in the case of RSA (p = 0.022, OR = 1.52). Male combined genotype analysis revealed no association with reproductive failure of their partners. Nevertheless, the female/male combination AA/AC of the 1298 polymorphism was more frequent in RSA couples (p = 0.049, OR = 1.49). However, the significant results became insignificant after Bonferroni correction. In addition, analysis of haplotypes showed significantly higher frequency of the C/C haplotype (1298 C/677 C) in the female control group than in the female RSA group (p = 0.03, OR = 0.77). Moreover, the association between elevated homocysteine (Hcy) level in plasma of RSA and RIF women and MTHFR polymorphisms was investigated but did not reveal significant differences. In conclusion, for clinical practice, it is better to check the homocysteine level in plasma and, if the Hcy level is increased, to recommend patients to take folic acid supplements rather than undergo screening of MTHFR for 1298 A>C and 677 C>T polymorphisms.
Panel Resonance Control and Cavity Control in Double-Panel Structures for Active Noise Reduction
Ho, J.; Berkhoff, Arthur P.
2011-01-01
An analytical and experimental investigation of panel resonance control and cavity control in a double-panel structure is presented in this paper. The double-panel structure, which consists of two panels with air in the gap, is widely adopted in many applications such as aerospace due to its low
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
Surface cleaning of metal wire by atmospheric pressure plasma
International Nuclear Information System (INIS)
Nakamura, T.; Buttapeng, C.; Furuya, S.; Harada, N.
2009-01-01
In this study, the possible application of atmospheric pressure dielectric barrier discharge plasma for the annealing of metallic wire is examined and presented. The main purpose of the current study is to examine the surface cleaning effect for a cylindrical object by atmospheric pressure plasma. The experimental setup consists of a gas tank, plasma reactor, and power supply with control panel. The gas assists in the generation of plasma. Copper wire was used as an experimental cylindrical object. This copper wire was irradiated with the plasma, and the cleaning effect was confirmed. The result showed that it is possible to remove the tarnish which exists on the copper wire surface. The experiment reveals that atmospheric pressure plasma is usable for the surface cleaning of metal wire. However, it is necessary to examine the method for preventing oxidization of the copper wire.
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
Antibody engineering using phage display with a coiled-coil heterodimeric Fv antibody fragment.
Directory of Open Access Journals (Sweden)
Xinwei Wang
Full Text Available A Fab-like antibody binding unit, ccFv, in which a pair of heterodimeric coiled-coil domains was fused to V(H and V(L for Fv stabilization, was constructed for an anti-VEGF antibody. The anti-VEGF ccFv showed the same binding affinity as scFv but significantly improved stability and phage display level. Furthermore, phage display libraries in the ccFv format were constructed for humanization and affinity maturation of the anti-VEGF antibody. A panel of V(H frameworks and V(H-CDR3 variants, with a significant improvement in affinity and expressibility in both E. coli and yeast systems, was isolated from the ccFv phage libraries. These results demonstrate the potential application of the ccFv antibody format in antibody engineering.
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Biocompatible Silver-containing a-C:H and a-C coatings: AComparative Study
Energy Technology Data Exchange (ETDEWEB)
Endrino, Jose Luis; Allen, Matthew; Escobar Galindo, Ramon; Zhang, Hanshen; Anders, Andre; Albella, Jose Maria
2007-04-01
Hydrogenated diamond-like-carbon (a-C:H) and hydrogen-free amorphous carbon (a-C) coatings are known to be biocompatible and have good chemical inertness. For this reason, both of these materials are strong candidates to be used as a matrix that embeds metallic elements with antimicrobial effect. In this comparative study, we have incorporated silver into diamond-like carbon (DLC) coatings by plasma based ion implantation and deposition (PBII&D) using methane (CH4) plasma and simultaneously depositing Ag from a pulsed cathodic arc source. In addition, we have grown amorphous carbon - silver composite coatings using a dual-cathode pulsed filtered cathodic-arc (FCA) source. The silver atomic content of the deposited samples was analyzed using glow discharge optical spectroscopy (GDOES). In both cases, the arc pulse frequency of the silver cathode was adjusted in order to obtain samples with approximately 5 at.% of Ag. Surface hardness of the deposited films was analyzed using the nanoindentation technique. Cell viability for both a-C:H/Ag and a-C:/Ag samples deposited on 24-well tissue culture plates has been evaluated.
Performance comparison between silicon solar panel and dye-sensitized solar panel in Malaysia
Hamed, N. K. A.; Ahmad, M. K.; Urus, N. S. T.; Mohamad, F.; Nafarizal, N.; Ahmad, N.; Soon, C. F.; Ameruddin, A. S.; Faridah, A. B.; Shimomura, M.; Murakami, K.
2017-09-01
In carrying out experimental research in performance between silicon solar panel and dye-sensitive solar panel, we have been developing a device and a system. This system has been developed consisting of controllers, hardware and software. This system is capable to get most of the input sources. If only need to change the main circuit and coding for a different source input value. This device is able to get the ambient temperature, surface temperature, surrounding humidity, voltage with load, current with load, voltage without load and current without load and save the data into external memory. This device is able to withstand the heat and rain as it was fabricated in a waterproof box. This experiment was conducted to examine the performance of both the solar panels which are capable to maintain their stability and performance. A conclusion based on data populated, the distribution of data for dye-sensitized solar panel is much better than silicon solar panel as dye-sensitized solar panel is very sensitive to heat and not depend only on midday where is that is the maximum ambient temperature for both solar panel as silicon solar panel only can give maximum and high output only when midday.
Analysis of 3-panel and 4-panel microscale ionization sources
International Nuclear Information System (INIS)
Natarajan, Srividya; Parker, Charles B.; Glass, Jeffrey T.; Piascik, Jeffrey R.; Gilchrist, Kristin H.; Stoner, Brian R.
2010-01-01
Two designs of a microscale electron ionization (EI) source are analyzed herein: a 3-panel design and a 4-panel design. Devices were fabricated using microelectromechanical systems technology. Field emission from carbon nanotube provided the electrons for the EI source. Ion currents were measured for helium, nitrogen, and xenon at pressures ranging from 10 -4 to 0.1 Torr. A comparison of the performance of both designs is presented. The 4-panel microion source showed a 10x improvement in performance compared to the 3-panel device. An analysis of the various factors affecting the performance of the microion sources is also presented. SIMION, an electron and ion optics software, was coupled with experimental measurements to analyze the ion current results. The electron current contributing to ionization and the ion collection efficiency are believed to be the primary factors responsible for the higher efficiency of the 4-panel microion source. Other improvements in device design that could lead to higher ion source efficiency in the future are also discussed. These microscale ion sources are expected to find application as stand alone ion sources as well as in miniature mass spectrometers.
The effect of an alternating electric field on a totally ionised plasma
International Nuclear Information System (INIS)
Baglin, H.; Brin, A.; Ozias, Y.; Salmon, J.
1960-01-01
The equation giving the distribution function of the electrons in a steady-state, for a fully ionized plasma in an a.c. field, are provided from the Fokker-Planck equation. The electric conductivity is complex and depends on the frequency. (author) [fr
3D display system using monocular multiview displays
Sakamoto, Kunio; Saruta, Kazuki; Takeda, Kazutoki
2002-05-01
A 3D head mounted display (HMD) system is useful for constructing a virtual space. The authors have researched the virtual-reality systems connected with computer networks for real-time remote control and developed a low-priced real-time 3D display for building these systems. We developed a 3D HMD system using monocular multi-view displays. The 3D displaying technique of this monocular multi-view display is based on the concept of the super multi-view proposed by Kajiki at TAO (Telecommunications Advancement Organization of Japan) in 1996. Our 3D HMD has two monocular multi-view displays (used as a visual display unit) in order to display a picture to the left eye and the right eye. The left and right images are a pair of stereoscopic images for the left and right eyes, then stereoscopic 3D images are observed.
Performance modelling of plasma microthruster nozzles in vacuum
Ho, Teck Seng; Charles, Christine; Boswell, Rod
2018-05-01
Computational fluid dynamics and plasma simulations of three geometrical variations of the Pocket Rocket radiofrequency plasma electrothermal microthruster are conducted, comparing pulsed plasma to steady state cold gas operation. While numerical limitations prevent plasma modelling in a vacuum environment, results may be obtained by extrapolating from plasma simulations performed in a pressurised environment, using the performance delta from cold gas simulations performed in both environments. Slip regime boundary layer effects are significant at these operating conditions. The present investigation targets a power budget of ˜10 W for applications on CubeSats. During plasma operation, the thrust force increases by ˜30% with a power efficiency of ˜30 μNW-1. These performance metrics represent instantaneous or pulsed operation and will increase over time as the discharge chamber attains thermal equilibrium with the heated propellant. Additionally, the sculpted nozzle geometry achieves plasma confinement facilitated by the formation of a plasma sheath at the nozzle throat, and fast recombination ensures a neutral exhaust plume that avoids the contamination of solar panels and interference with externally mounted instruments.
Industrial innovation based on fundamental physics
International Nuclear Information System (INIS)
Kogelschatz, Ulrich
2002-01-01
Industrial innovation frequently results from an improved understanding of basic physics. Scientific discoveries quite often lead to engineering inventions that have not been the target of the original investigations. Examples are given from the field of plasma physics and plasma technology. High voltage circuit breakers, ozone generators, high power CO 2 lasers, excimer lamps, and plasma display panels have profited substantially from initially purely scientific investigations. In the meantime they have reached multi-billion dollar market shares
Malinina, A. A.; Guivan, N. N.; Shimon, L. L.; Shuaibov, A. K.
2010-09-01
Results are presented from experimental and theoretical studies of the optical characteristics and parameters of the plasma of an atmospheric-pressure barrier discharge excited in a HgBr2: N2: He mixture, which was used as the working medium of a small-size (with a radiation area of 8 cm2) exciplex gas-discharge radiation source. The mean radiation power of 87 mW was achieved at the radiation wavelength λmax = 502 nm. The electron energy distribution function, the transport characteristics, the specific energy lost in the processes involving electrons, the electron temperature and density, and the rate constants of elastic and inelastic electron scattering by the components of the working mixture were calculated as functions of the reduced field E/ N. The plasma of a discharge excited in a HgBr2: N2: He mixture can be used as the working medium of a small-size blue-green radiation source. Such a source can find application in biotechnology, photonics, and medicine and can also be used to manufacture gas-discharge display panels.
International Nuclear Information System (INIS)
Lee, Jang-Hoon; Lee, Seung-Hyu; Hwangbo, Chang-Kwon; Lee, Kwang-Su
2004-01-01
Electromagnetic-interference (EMI) shielding and near-infrared (NIR) cutoff filters for plasma display panels, based on fundamental structures (ITO/Ag/ITO), (TiO 2 /Ti/Ag/TiO 2 ) and (TiO 2 /ITO/Ag/ITO/TiO 2 ), were designed and prepared by RF-magnetron sputtering. The optical, structural and electrical properties of the filters were investigated by using spectrophotometry, Auger electron spectroscopy, X-ray photoelectron spectroscopy, Rutherford backscattering spectroscopy, atomic force microscopy and four-point-probe measurements. The results show that ITO films as the barriers and base layers lead to higher transmittance in the visible spectrum and smoother surface roughness than Ti metal barriers, while maintaining high NIR cutoff characteristics and chemical stability, which may be attributed to the lower absorption in the interfacial layers and better protection of the Ag layers by the ITO layers.
Directory of Open Access Journals (Sweden)
Hauser Elizabeth R
2005-04-01
Full Text Available Abstract Background To facilitate efficient selection and the prioritization of candidate complex disease susceptibility genes for association analysis, increasingly comprehensive annotation tools are essential to integrate, visualize and analyze vast quantities of disparate data generated by genomic screens, public human genome sequence annotation and ancillary biological databases. We have developed a plug-in package for Ensembl called "Statistical Viewer" that facilitates the analysis of genomic features and annotation in the regions of interest defined by linkage analysis. Results Statistical Viewer is an add-on package to the open-source Ensembl Genome Browser and Annotation System that displays disease study-specific linkage and/or association data as 2 dimensional plots in new panels in the context of Ensembl's Contig View and Cyto View pages. An enhanced upload server facilitates the upload of statistical data, as well as additional feature annotation to be displayed in DAS tracts, in the form of Excel Files. The Statistical View panel, drawn directly under the ideogram, illustrates lod score values for markers from a study of interest that are plotted against their position in base pairs. A module called "Get Map" easily converts the genetic locations of markers to genomic coordinates. The graph is placed under the corresponding ideogram features a synchronized vertical sliding selection box that is seamlessly integrated into Ensembl's Contig- and Cyto- View pages to choose the region to be displayed in Ensembl's "Overview" and "Detailed View" panels. To resolve Association and Fine mapping data plots, a "Detailed Statistic View" plot corresponding to the "Detailed View" may be displayed underneath. Conclusion Features mapping to regions of linkage are accentuated when Statistic View is used in conjunction with the Distributed Annotation System (DAS to display supplemental laboratory information such as differentially expressed disease
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
Aislamiento acústico a ruido aéreo en acristalamientos de vidrio
Directory of Open Access Journals (Sweden)
Escuder Silla, E.
2007-08-01
Full Text Available In this paper, the Ookura & Saito model is applied to determine the Airborne Sound Insulation of glazing systems. In particular, the calculations that appear are for monolithic glasses of different thicknesses and laminated glasses from different types. There are different prediction models of the airborne acoustic behaviour of multilayer panels (and the laminated glasses can be considered like such. In all of them, the input data are the elastic constants and the loss factor. The monolithic glasses and the intermediate layer have been characterized according to different Standards. The results are compared with experimental measurements and data of the study of Marsh (1, obtaining a range of acceptable adjustment.
En este artículo se aplica el modelo de Ookura & Saito para determinar el aislamiento acústico a ruido aéreo de sistemas constructivos basados en vidrios. En concreto, los cálculos que se presentan son para vidrios monolíticos de distintos espesores y para vidrios laminados de diferentes tipos. Existen diferentes modelos de predicción del comportamiento acústico a ruido aéreo de estructuras multicapa (y los vidrios laminados pueden considerarse como tales. En todos ellos, los datos de entrada son las constantes elásticas y el factor de pérdidas. Tanto los vidrios monolíticos como la capa intermedia se han caracterizado siguiendo diferentes normativas. Los resultados se comparan con medidas experimentales y con datos recogidos del estudio de Marsh (1, obteniéndose un grado de ajuste aceptable.
Nonlinear plasma wave models in 3D fluid simulations of laser-plasma interaction
Chapman, Thomas; Berger, Richard; Arrighi, Bill; Langer, Steve; Banks, Jeffrey; Brunner, Stephan
2017-10-01
Simulations of laser-plasma interaction (LPI) in inertial confinement fusion (ICF) conditions require multi-mm spatial scales due to the typical laser beam size and durations of order 100 ps in order for numerical laser reflectivities to converge. To be computationally achievable, these scales necessitate a fluid-like treatment of light and plasma waves with a spatial grid size on the order of the light wave length. Plasma waves experience many nonlinear phenomena not naturally described by a fluid treatment, such as frequency shifts induced by trapping, a nonlinear (typically suppressed) Landau damping, and mode couplings leading to instabilities that can cause the plasma wave to decay rapidly. These processes affect the onset and saturation of stimulated Raman and Brillouin scattering, and are of direct interest to the modeling and prediction of deleterious LPI in ICF. It is not currently computationally feasible to simulate these Debye length-scale phenomena in 3D across experimental scales. Analytically-derived and/or numerically benchmarked models of processes occurring at scales finer than the fluid simulation grid offer a path forward. We demonstrate the impact of a range of kinetic processes on plasma reflectivity via models included in the LPI simulation code pF3D. This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344.
... page: //medlineplus.gov/ency/article/003535.htm Antinuclear antibody panel To use the sharing features on this page, please enable JavaScript. The antinuclear antibody panel is a blood test that looks at ...
... page: //medlineplus.gov/ency/article/003558.htm Hepatitis virus panel To use the sharing features on this page, please enable JavaScript. The hepatitis virus panel is a series of blood tests used ...
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
DEFF Research Database (Denmark)
2003-01-01
A composite panel having front and back faces, the panel comprising facing reinforcement, backing reinforcement and matrix material binding to the facing and backing reinforcements, the facing and backing reinforcements each independently comprising one or more reinforcing sheets, the facing rein...... by matrix material, the facing and backing reinforcements being interconnected to resist out-of-plane relative movement. The reinforced composite panel is useful as a barrier element for shielding structures, equipment and personnel from blast and/or ballistic impact damage....
Rational Design of Composite Panels
DEFF Research Database (Denmark)
Riber, Hans Jørgen
1996-01-01
A non-linear structural model for composite panels is presented. The non-linear terms in the lateral displacements are modelled as an additional set of lateral loads acting on the panel. Hence the solution is reduced to that of an equivalent panel with small displacements In order to treat sandwich...... Norske Veritas', DNV, building rules concerning high-speed light craft, in which the panel scantlings are often restricted by a maximum lateral deflection connected with the panel span....
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Composite panel development at JPL
Mcelroy, Paul; Helms, Rich
1988-01-01
Parametric computer studies can be use in a cost effective manner to determine optimized composite mirror panel designs. An InterDisciplinary computer Model (IDM) was created to aid in the development of high precision reflector panels for LDR. The materials properties, thermal responses, structural geometries, and radio/optical precision are synergistically analyzed for specific panel designs. Promising panels designs are fabricated and tested so that comparison with panel test results can be used to verify performance prediction models and accommodate design refinement. The iterative approach of computer design and model refinement with performance testing and materials optimization has shown good results for LDR panels.
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
Direct view panel type X-ray image intensifier tube
International Nuclear Information System (INIS)
Yang, S.-P.; Robbins, C.D.; Merrit, E.
1977-01-01
A panel shaped, proximity type, X-ray image intensifier tube for medical X-ray fluoroscopy use is described. It has all linear components and yet a high brightness gain, in excess of 4,000 cd-sec/m 2 -R, the tube being comprised of a rugged metallic tube envelope, an inwardly concave metallic input window, a directly viewable full size output display screen, and a scintillator-photocathode screen having a thickness of at least 200 microns for a high X-ray photon utilization ability as well as X-ray stopping power, the scintillator-photocathode screen being suspended on insulators within the envelope and in between the input window and the output screen. The scintillator-photocathode screen is spaced from the output screen by at least 8mm to allow the application of a high negative potential at the scintillator-photocathode screen with respect to the output screen for high gain with low field emission, since all of the remaining components within the tube envelope are at neutral potential with respect to the output display screen. (Auth.)
Ac irreversibility line of bismuth-based high temperature superconductors
International Nuclear Information System (INIS)
Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.
1997-01-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society
Supersonic Panel Flutter Test Results for Flat Fiber-Glass Sandwich Panels with Foamed Cores
Tuovila, W. J.; Presnell, John G., Jr.
1961-01-01
Flutter tests have been made on flat panels having a 1/4 inch-thick plastic-foam core covered with thin fiber-glass laminates. The testing was done in the Langley Unitary Plan wind tunnel at Mach numbers from 1.76 t o 2.87. The flutter boundary for these panels was found to be near the flutter boundary of thin metal panels when compared on the basis of an equivalent panel stiffness. The results also demonstrated that the depth of the cavity behind the panel has a pronounced influence on flutter. Changing the cavity depth from 1 1/2 inches to 1/2 inch reduced the dynamic pressure at start of flutter by 40 percent. No flutter was obtained when the spacers on the back of the panel were against the bottom of the cavity.
Taylor, Robert W.; Nash, Sally K.
2007-01-01
While technical training and advanced degree's assure proficiency at specific tasks within engineering disciplines, they fail to address the potential for communication breakdown and decision making errors familiar to multicultural environments where language barriers, intimidating personalities and interdisciplinary misconceptions exist. In an effort to minimize these pitfalls to effective panel review, NASA's lead safety engineers to the ISS Safety Review Panel (SRP), and Payload Safety Review Panel (PSRP) initiated training with their engineers, in conjunction with the panel chairs, and began a Panel Resource Management (PRM) program. The intent of this program focuses on the ability to reduce the barriers inhibiting effective participation from all panel attendees by bolstering participants confidence levels through increased communication skills, situational awareness, debriefing, and a better technical understanding of requirements and systems.
DEFF Research Database (Denmark)
Bouaidat, Salim; Berendsen, C.; Thomsen, P.
2004-01-01
Micro scale patterning of bioactive surfaces is desirable for numerous biochip applications. Polyethyleneoxide-like (PEO-like) coating with non-fouling functionality has been deposited using low frequency AC plasma polymerization. The non-fouling properties of the coating were tested with human c...... and versatility of the plasma-polymerized coatings, make this technology highly suitable for bio-MEMS and biochip applications, where patterned high contrast non-fouling surfaces are needed....
Pesch, Sandra; Bergmann, Martin; Bostedt, Hartwig
2006-07-15
Seminal plasma is very important for sperm metabolism as well as sperm function and survival and transport in the female genital tract. Analysis of enzyme activities and concentrations of elements can estimate integrity and function of sperm cell membranes. In man much data are available about biochemical analyses of seminal plasma. However, not many studies have been conducted in horses yet. We collected ejaculates from 72 stallions, measured the volume, obtained seminal plasma by centrifugation and examined spermatozoa with light microscopy for motility, concentration, for dead sperm and morphology. Of seminal plasma fluid, we measured activities of aspartate-amino-transferase (AST), gamma-glutamyl-transferase (GGT), alkaline phosphatase (AlP), acid phosphatase (AcP) and lactate-dehydrogenase (LDH) as well as concentrations of sodium (Na(+)), potassium (K(+)), total and ionised calcium (Ca(TOTAL)/Ca(2+)), magnesium (Mg(2+)), phosphate (P), chloride (Cl), copper (Cu), iron (Fe) and zinc (Zn). In addition, correlations among different parameters in light microscopy and seminal plasma were statistically examined by using the Spearman rank correlation coefficient. Median enzyme activities for AST, GGT, AlP, AcP and LDH were 80.0, 7,500, 30,200, 20.0, 81.0 IU/L, respectively. Concentrations of Na(+), K(+), Ca(TOTAL), Ca(2+), Mg(2+), P, Cl were 110.5, 22.1, 2.9, 1.7, 3.1, 1.1 and 114.5 mmol/L, and of microelements Cu, Fe and Zn were 17.8, 1.9 and 13.2 micromol/L, respectively. Furthermore, we found significant correlations between semen volume as well as sperm concentration and AST, GGT, AlP, AcP and LDH as well as Fe and Zn. This made us propose a primary testicular and epididymal origin of these parameters. Significant correlation between GGT and motility may be a sign for its function for cell protection against free radicals. LDH activity significantly correlates with motility and progressive motility, live:dead-ratio and pathomorphology. In our study, LDH seems to
ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching
Taylor, Terri
2009-05-01
In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.
Diagnostics of microdischarge-integrated plasma sources for display and materials processing
International Nuclear Information System (INIS)
Tachibana, K; Kishimoto, Y; Kawai, S; Sakaguchi, T; Sakai, O
2005-01-01
Two different types of microdischarge-integrated plasma sources have been operated at around the atmospheric pressure range. The discharge characteristics were diagnosed by optical emission spectroscopy (OES), laser absorption spectroscopy (LAS) and microwave transmission (MT) techniques. The dynamic spatiotemporal behaviour of excited atoms was analysed using OES and LAS and the temporal behaviour of the electron density was estimated using the MT method. In Ar and Xe/Ne gases, waveforms of the MT signal followed the current waveform in the rise period and lasted longer according to the recombination losses. However, in He the waveform followed the density of metastable atoms, reflecting the production of a large amount of electrons by the Penning ionization process with impurities. The estimated peak electron density in those plasma sources is of the order of 10 12 cm -3 , and the metastable atom density can reach 10 13 cm -3 . Thus, it is suggested that these sources can be potentially applied to convenient material processing tools of large area operated stably at atmospheric pressure
Nalladhimmu, Pavan Kumar Reddy; Priyadarshini, S.
2018-04-01
As the demand of electricity is increasing, there is need to using the renewable sources to produce the energy at present of power shortage, the use of solar energy could be beneficial to great extent and easy to get the maximum efficiency. There is an urgent in improving the efficiency of solar power generation. Current solar panels setups take a major power loss when unwanted obstructions cover the surface of the panels. To make solar energy more efficiency of solar array systems must be maximized efficiency evaluation of PV panels, that has been discussed with particular attention to the presence of dust on the efficiency of the PV panels have been highlighted. This paper gives the how the solar panel cleaning system works and designing of the cleaning system.
Magnetic irreversibility in granular superconductors: ac susceptibility study
International Nuclear Information System (INIS)
Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.
1991-01-01
Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)
Lightweight, Thermally Insulating Structural Panels
Eisen, Howard J.; Hickey, Gregory; Wen, Liang-Chi; Layman, William E.; Rainen, Richard A.; Birur, Gajanana C.
1996-01-01
Lightweight, thermally insulating panels that also serve as structural members developed. Honeycomb-core panel filled with low-thermal-conductivity, opacified silica aerogel preventing convection and minimizes internal radiation. Copper coating on face sheets reduces radiation. Overall thermal conductivities of panels smaller than state-of-art commercial non-structurally-supporting foam and fibrous insulations. On Earth, panels suitable for use in low-air-pressure environments in which lightweight, compact, structurally supporting insulation needed; for example, aboard high-altitude aircraft or in partially evacuated panels in refrigerators.
Plasma polymerization at different positions in an asymmetric ethylene discharge
International Nuclear Information System (INIS)
Trieschmann, Jan; Hegemann, Dirk
2011-01-01
The characteristics of plasma polymerization are investigated in an asymmetric, capacitively coupled plasma discharge. Here, the deposition in different plasma zones, i.e. on the driven electrode, within the plasma bulk and the plasma sheath as well as approximately at the plasma-sheath edge, is investigated. Principal expectations are perfectly met, though new interesting dependences of the obtained a-C : H coatings with respect to film properties and deposition rates are also found. That is, the deposition rates as measured on thin, small glass slides placed directly on the electrode are considerably higher than everywhere else in the plasma, yet only single-sided. In contrast, the deposition rates on the samples within the plasma are lowered depending on the exact placement, while a double-sided coating is obtained. Furthermore, film properties, such as the film density, are highly dependent on the sample placement in the plasma, which can even be higher under floating conditions. With simple physical arguments we are able to show the relations between the deposition rate and the energy input into the plasma as well as between the energy density during film growth and the film density itself.
PERBANDINGAN UNJUK KERJA ANTARA PANEL SEL SURYA BERPENJEJAK DENGAN PANEL SEL SURYA DIAM
Syafaruddin Ch
2010-01-01
The ability to produce electrical energy at Solar Power Plant is highly dependent on the magnitude and duration of sun exposure on the solar cell panels. The movement of the sun from east to west that periodicity in every day is a problem at the optimization generation of electricity at Solar Power Plant if using solar panel that motionless. This is because the solar cell panel can not catch the maximum sun exposure. To solve the above problem then designed a solar cell panel tracker...
Control of hybrid AC/DC microgrid under islanding operational conditions
DEFF Research Database (Denmark)
Ding, G.; Gao, F.; Zhang, S.
2014-01-01
This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....
Ac irreversibility line of bismuth-based high temperature superconductors
Energy Technology Data Exchange (ETDEWEB)
Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)
1997-09-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}
16. Hot dense plasma atomic processes
International Nuclear Information System (INIS)
Werner, Dappen; Totsuji, H.; Nishii, Y.
2002-01-01
This document gathers 13 articles whose common feature is to deal with atomic processes in hot plasmas. Density functional molecular dynamics method is applied to the hydrogen plasma in the domain of liquid metallic hydrogen. The effects of the density gradient are taken into account in both the electronic kinetic energy and the exchange energy and it is shown that they almost cancel with each other, extending the applicability of the Thomas-Fermi-Dirac approximation to the cases where the density gradient is not negligible. Another article reports about space and time resolved M-shell X-ray measurements of a laser-produced gas jet xenon plasma. Plasma parameters have been measured by ion acoustic and electron plasma waves Thomson scattering. Photo-ionization becomes a dominant atomic process when the density and the temperature of plasmas are relatively low and when the plasma is submitted to intense external radiation. It is shown that 2 plasmas which have a very different density but have the same ionization parameters, are found in a similar ionization state. Most radiation hydrodynamics codes use radiative opacity data from available libraries of atomic data. Several articles are focused on the determination of one group Rosseland and Planck mean analytical formulas for several single elements used in inertial fusion targets. In another paper the plasma density effect on population densities, effective ionization, recombination rate coefficients and on emission lines from carbon and Al ions in hot dense plasma, is studied. The last article is devoted to a new atomic model in plasmas that considers the occupation probability of the bound state and free state density in the presence of the plasma micro-field. (A.C.)
Fringe periods of color moirés in contact-type 3-D displays.
Lee, Hyoung; Kim, Sung-Kyu; Sohn, Kwanghoon; Son, Jung-Young; Chernyshov, Oleksii O
2016-06-27
A mathematical formula of calculating the fringe periods of the color moirés appearing at the contact-type 3-D displays is derived. It is typical that the color moirés are chirped and the period of the line pattern in viewing zone forming optics is more than two times of that of the pixel pattern in the display panel. These make impossible to calculate the fringe periods of the color moirés with the conventional beat frequency formula. The derived formula work very well for any combination of two line patterns having either a same line period or different line periods. This is experimentally proved. Furthermore, it is also shown that the fringe period can be expressed in terms of the viewing distance and focal length of the viewing zone forming optics.
Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation
Reitan, D. K.
1973-01-01
Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.
Hoffmann, Errol R; Chan, Alan H S
2017-08-01
Much research on stereotype strength relating display and control movements for displays moving in the vertical or horizontal directions has been reported. Here we report effects of display movement angle, where the display moves at angles (relative to the vertical) of between 0° and 180°. The experiment used six different controls, four display locations relative to the operator and three types of indicator. Indicator types were included because of the strong effects of the 'scale-side principle' that are variable with display angle. A directional indicator had higher stereotype strength than a neutral indicator, and showed an apparent reversal in control/display stereotype direction beyond an angle of 90°. However, with a neutral indicator this control reversal was not present. Practitioner Summary: The effects of display moving at angles other than the four cardinal directions, types of control, location of display and types of indicator are investigated. Indicator types (directional and neutral) have an effect on stereotype strength and may cause an apparent control reversal with change of display movement angle.
Blankson, Isaiah M.; Foster, John E.; Adamovsky, Grigory
2016-01-01
2016 NASA Glenn Technology Day Panel Presentation on May 24, 2016. The panel description is: Environmental Impact: NASA Glenn Water Capabilities Both global water scarcity and water treatment concerns are two of the most predominant environmental issues of our time. Glenn researchers share insights on a snow sensing technique, hyper spectral imaging of Lake Erie algal blooms, and a discussion on non-equilibrium plasma applications for water purification supporting human spaceflight and terrestrial point-of-use. The panel moderator will be Bryan Stubbs, Executive Director of the Cleveland Water Alliance.
Oh, Seung-Won; Park, Jun-Hee; Lee, Ji-Hoon; Yoon, Tae-Hoon
2015-09-07
Recently, low-frequency driving of liquid crystal display (LCD) panels to minimize power consumption has drawn much attention. In the case in which an LCD panel is driven by a fringe-field at a low frequency, the image flickering phenomenon occurs when the sign of the applied electric field is reversed. We investigated image flickering induced by the flexoelectric effect in a fringe-field switching (FFS) liquid crystal cell in terms of the transmittance difference between frames and the ripple phenomenon. Experimental results show that image flicker due to transmittance difference can be eliminated completely and that the ripple phenomena can be reduced significantly by applying a bipolar voltage wave to the FFS cell.
Panel data analysis using EViews
Agung, I Gusti Ngurah
2013-01-01
A comprehensive and accessible guide to panel data analysis using EViews software This book explores the use of EViews software in creating panel data analysis using appropriate empirical models and real datasets. Guidance is given on developing alternative descriptive statistical summaries for evaluation and providing policy analysis based on pool panel data. Various alternative models based on panel data are explored, including univariate general linear models, fixed effect models and causal models, and guidance on the advantages and disadvantages of each one is given. Panel Data Analysis
Naumer, Matthias; Ying, Ying; Michelfelder, Stefan; Reuter, Antje; Trepel, Martin; Müller, Oliver J; Kleinschmidt, Jürgen A
2012-05-01
Libraries based on the insertion of random peptide ligands into the capsid of adeno-associated virus type 2 (AAV2) have been widely used to improve the efficiency and selectivity of the AAV vector system. However, so far only libraries of 7-mer peptide ligands have been inserted at one well-characterized capsid position. Here, we expanded the combinatorial AAV2 display system to a panel of novel AAV libraries, displaying peptides of 5, 7, 12, 19, or 26 amino acids in length at capsid position 588 or displaying 7-mer peptides at position 453, the most prominently exposed region of the viral capsid. Library selections on two unrelated cell types-human coronary artery endothelial cells and rat cardiomyoblasts-revealed the isolation of cell type-characteristic peptides of different lengths mediating strongly improved target-cell transduction, except for the 26-mer peptide ligands. Characterization of vector selectivity by transduction of nontarget cells and comparative gene-transduction analysis using a panel of 44 human tumor cell lines revealed that insertion of different-length peptides allows targeting of distinct cellular receptors for cell entry with similar efficiency, but with different selectivity. The application of such novel AAV2 libraries broadens the spectrum of targetable receptors by capsid-modified AAV vectors and provides the opportunity to choose the best suited targeting ligand for a certain application from a number of different candidates.
A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network
Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.
2017-05-01
Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.
RECIPANEL: RECYCLED PAPER PANELS
Directory of Open Access Journals (Sweden)
HERNÁN CAÑOLA
2012-01-01
Full Text Available En este artículo se estudia la fabricación y el comportamiento mecánico de paneles a base de papel reciclado. El objetivo principal del proyecto es producir un prototipo de panel que emplee elementos provenientes de residuos sólidos (papel periódico y de un material conglomerante (cemento Portland blanco. El panel debe ser económico, debe tener buenas propiedades mecánicas y debe tener dimensiones comerciales para su uso en muros tabiques y en cielos falsos en la industria de la construcción. El Recipanel es un panel no estructural a base de papel reciclado. El Recipanel cumple las normas colombianas en lo relativo a los paneles de uso no estructural y presenta además unas excelentes características mecánicas.
DEFF Research Database (Denmark)
Blaabjerg, Frede; Aquila, A. Dell; Liserre, Marco
2004-01-01
of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....
Atmospheric Pressure Plasma Induced Sterilization and Chemical Neutralization
Garate, Eusebio; Evans, Kirk; Gornostaeva, Olga; Alexeff, Igor; Lock Kang, Weng; Wood, Thomas K.
1998-11-01
We are studying chemical neutralization and surface decontamination using atmospheric pressure plasma discharges. The plasma is produced by corona discharge from an array of pins and a ground plane. The array is constructed so that various gases, like argon or helium, can be flowed past the pins where the discharge is initiated. The pin array can be biased using either DC, AC or pulsed discharges. Results indicate that the atmospheric plasma is effective in sterilizing surfaces with biological contaminants like E-coli and bacillus subtilus cells. Exposure times of less than four minutes in an air plasma result in a decrease in live colony counts by six orders of magnitude. Greater exposure times result in a decrease of live colony counts of up to ten orders of magnitude. The atmospheric pressure discharge is also effective in decomposing organic phosphate compounds that are simulants for chemical warfare agents. Details of the decomposition chemistry, by-product formation, and electrical energy consumption of the system will be discussed.
21 CFR 880.5100 - AC-powered adjustable hospital bed.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...
Nonlinear AC susceptibility, surface and bulk shielding
van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.
1996-02-01
We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.
electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.
LPL Announces World's Fastest TFT-LCD Panel for Mobile Phones%LG飞利浦已研制出用于手机的TFT-LCD
Institute of Scientific and Technical Information of China (English)
Ken Werner
2006-01-01
@@ LG.Philips LCD (LPL) announced at Sept.13th 2006, it has developed the industry's fastest TFT-LCD panel for mobile phones, which will permit next-generation handsets to display TV and video content with less motion blur.