A Computational Model of Hydraulic Volume Displacement Drive

Directory of Open Access Journals (Sweden)

V. N. Pil'gunov

2014-01-01

Full Text Available The paper offers a computational model of industrial-purpose hydraulic drive with two hydraulic volume adjustable working chamber machines (pump and motor. Adjustable pump equipped with the pressure control unit can be run together with several adjustable hydraulic motors on the principle of three-phase hydraulic socket-outlet with high-pressure lines, drain, and drainage system. The paper considers the pressure-controlled hydrostatic transmission with hydraulic motor as an output link. It shows a possibility to create a saving hydraulic drive using a functional tie between the adjusting parameters of the pump and hydraulic motor through the pressure difference, torque, and angular rate of the hydraulic motor shaft rotation. The programmable logic controller can implement such tie. The Coulomb and viscous frictions are taken into consideration when developing a computational model of the hydraulic volume displacement drive. Discharge balance considers external and internal leakages in equivalent clearances of hydraulic machines, as well as compression loss volume caused by hydraulic fluid compressibility and deformation of pipe walls. To correct dynamic properties of hydraulic drive, the paper offers that in discharge balance are included the additional regulated external leakages in the open circuit of hydraulic drive and regulated internal leakages in the closed-loop circuit. Generalized differential equations having functional multipliers and multilinked nature have been obtained to describe the operation of hydraulic positioning and speed drive with two hydraulic volume adjustable working chamber machines. It is shown that a proposed computational model of hydraulic drive can be taken into consideration in development of LS («Load-Sensing» drives, in which the pumping pressure is tuned to the value required for the most loaded slave motor to overcome the load. Results attained can be used both in designing the industrial-purpose heavy

Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.; Andersen, Michael A.E.

2005-07-01

This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

Complex state variable- and disturbance observer-based current controllers for AC drives

DEFF Research Database (Denmark)

Dal, Mehmet; Teodorescu, Remus; Blaabjerg, Frede

2013-01-01

In vector-controlled AC drives, the design of current controller is usually based on a machine model defined in synchronous frame coordinate, where the drive performance may be degraded by both the variation of the machine parameters and the cross-coupling between the d- and q-axes components...... of the stator current. In order to improve the current control performance an alternative current control strategy was proposed previously aiming to avoid the undesired cross-coupling and non-linearities between the state variables. These effects are assumed as disturbances arisen in the closed-loop path...... of the parameter and the cross-coupling effect. Moreover, it provides a better performance, smooth and low noisy operation with respect to the complex variable controller....

Advanced DC/AC inverters applications in renewable energy

CERN Document Server

Luo, Fang Lin

2013-01-01

DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

AC application of second generation HTS wire

Science.gov (United States)

Thieme, C. L. H.; Gagnon, K.; Voccio, J.; Aized, D.; Claassen, J.

2008-02-01

For the production of Second Generation (2G) YBCO High Temperature Superconductor wire American Superconductor uses a wide-strip MOD-YBCO/RABiTSTM process, a low-cost approach for commercial manufacturing. It can be engineered with a high degree of flexibility to manufacture practical 2G conductors with architectures and properties tailored for specific applications and operating conditions. For ac applications conductor and coil design can be geared towards low hysteretic losses. For applications which experience high frequency ac fields, the stabilizer needs to be adjusted for low eddy current losses. For these applications a stainless-steel laminate is used. An example is a Low Pass Filter Inductor which was developed and built in this work.

High-power converters and AC drives

CERN Document Server

Wu, Bin

2017-01-01

This new edition reflects the recent technological advancements in the MV drive industry, such as advanced multilevel converters and drive configurations. It includes three new chapters, Control of Synchronous Motor Drives, Transformerless MV Drives, and Matrix Converter Fed Drives. In addition, there are extensively revised chapters on Multilevel Voltage Source Inverters and Voltage Source Inverter-Fed Drives. This book includes a systematic analysis on a variety of high-power multilevel converters, illustrates important concepts with simulations and experiments, introduces various megawatt drives produced by world leading drive manufacturers, and addresses practical problems and their mitigations methods.

An EMC Evaluation of the Use of Unshielded Motor Cables in AC Adjustable Speed Drive Applications

DEFF Research Database (Denmark)

Hanigovszki, Norbert; Poulsen, J.; Spiazzi, G.

2004-01-01

The most common solution for modern adjustable speed drives (ASD) is the use of induction motors (IM) fed by voltage-source inverters (VSI). The inverter generates a pulsewidth modulated (PWM) voltage, with values of about 6 kV/ dv/dt m s or even more. In three-leg inverters for three-phase appli......The most common solution for modern adjustable speed drives (ASD) is the use of induction motors (IM) fed by voltage-source inverters (VSI). The inverter generates a pulsewidth modulated (PWM) voltage, with values of about 6 kV/ dv/dt m s or even more. In three-leg inverters for three......-phase applications the occurrence of common-mode voltage is inherent due to asymmetrical output pulses. As a result, for electromagnetic compatibility (EMC) reasons, in most applications shielded cables are used between the inverter and the motor, implying high installation costs. The present paper discusses the use...

Transient Performance of Radiator on Engine Rpm Variation with AC Loading

Directory of Open Access Journals (Sweden)

Made Ricki Murti

2012-11-01

Full Text Available Radiator is one of heat exchanger applications that has a function to remove out of heat must be able to operate properly for allowed engine temperature limit. Vehicles that operate on the street usually driving with varying rpm so that the heat produced by the combustion process is not constant and then this study analyze the performance of radiators as a function of time (transient condition. Tests is done on the condition of operating the engine with five rpm variations, each for one hour with air conditioning load and without air-conditioning load. The data to be collected includ the inlet and outlet temperature of radiator and radiator fluid volume flow. The results obtained is heat exhausted rate as a performance radiator is increasing as with increasing of engine rpm and at load conditions with the AC produces heat exhausted rate is greater than AC without AC load. The heat exhausted rate in an hour of machine operation still shows the system operates at a transient condition due to there still exists a numerical increase in the heat exhausted rate as a function of time.

Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

Energy Technology Data Exchange (ETDEWEB)

Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

2008-07-01

Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

Brushless traction PM Machines using commercial drive technology, part I: Design methodology and motor design

NARCIS (Netherlands)

Kazmin, Evgeny; Lomonova, E.A.; Paulides, J.J.H.

2008-01-01

A concept design approach for the brushless PM traction motor, which has crucial constraints on volume envelope and on the drive, is presented. The considered motor drive is the three-phase DC/AC converter, which is commercially available on the modern market of the standard variable frequency

Multi-Motor Drives for Crane Application

Directory of Open Access Journals (Sweden)

MITROVIC, N.

2009-10-01

Full Text Available This paper focuses on the application of adjustable speed induction motor drives for gantry cranes. Modern solution considers application of frequency converters for all drives. Multi-motor drives are standard solutions in crane application and requirements of load sharing are present. Presented algorithm provides load sharing proportional to the rated motor power on the simple and practically applicable method on the basis of estimated torques by frequency converters, and controller realized in PLC. Special attention is devoted to wide span gantry drive and algorithm for skew elimination. Solutions for load distribution in multi-motor drive, as well as mode of gantry drive skew elimination, are described. Suggested solution concept is confirmed by the experimental results.

Proportional-Integral-Resonant AC Current Controller

Directory of Open Access Journals (Sweden)

STOJIC, D.

2017-02-01

Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

Power sharing algorithm for vector controlled six-phase AC motor with four customary three-phase voltage source inverter drive

DEFF Research Database (Denmark)

Padmanaban, Sanjeevikumar; Grandi, Gabriele; Blaabjerg, Frede

2015-01-01

This paper considered a six-phase (asymmetrical) induction motor, kept 30 phase displacement between two set of three-phase open-end stator windings configuration. The drive system consists of four classical three-phase voltage inverters (VSIs) and all four dc sources are deliberately kept isolated......) by nearest three vectors (NTVs) approach is adopted to regulate each couple of VSIs. The proposed power sharing algorithm is verified by complete numerical simulation modeling (Matlab/ Simulink-PLECS software) of whole ac drive system by observing the dynamic behaviors in different designed condition. Set...

Dissipative two-level system under strong ac driving: A combination of Floquet and Van Vleck perturbation theory

International Nuclear Information System (INIS)

Hausinger, Johannes; Grifoni, Milena

2010-01-01

We study the dissipative dynamics of a two-level system (TLS) exposed to strong ac driving. By combining Floquet theory with Van Vleck perturbation theory in the TLS tunneling matrix element, we diagonalize the time-dependent Hamiltonian and provide corrections to the renormalized Rabi frequency of the TLS, which are valid for both a biased and unbiased TLS and go beyond the known high-frequency and rotating-wave results. In order to mimic environmental influences on the TLS, we couple the system weakly to a thermal bath and solve analytically the corresponding Floquet-Bloch-Redfield master equation. We give a closed expression for the relaxation and dephasing rates of the TLS and discuss their behavior under variation of the driving amplitude. Further, we examine the robustness of coherent destruction of tunneling (CDT) and driving-induced tunneling oscillations (DITO). We show that also for a moderate driving frequency an almost complete suppression of tunneling can be achieved for short times and demonstrate the sensitiveness of DITO to a change of the external parameters.

Analysis and Implementation of Parallel Connected Two-Induction Motor Single-Inverter Drive by Direct Vector Control for Industrial Application

DEFF Research Database (Denmark)

Gunabalan, Ramachandiran; Padmanaban, Sanjeevikumar; Blaabjerg, Frede

2015-01-01

Sensorless-based direct vector control techniques are widely used for three-phase induction motor drive, whereas in case of multiple-motor control, it becomes intensively complicated and very few research articles in support to industrial applications were found. A straight-forward direct vector...... to estimate the rotor speed, rotor flux, and load torque of both motors. Simulation results along with theoretical background provided in this paper confirm the feasibility of operation of the ac motors and proves reliability for industrial applications....

IMAGE information monitoring and applied graphics software environment. Volume 4. Applications description

International Nuclear Information System (INIS)

Hallam, J.W.; Ng, K.B.; Upham, G.L.

1986-09-01

The EPRI Information Monitoring and Applied Graphics Environment (IMAGE) system is designed for 'fast proto-typing' of advanced concepts for computer-aided plant operations tools. It is a flexible software system which can be used for rapidly creating, dynamically driving and evaluating advanced operator aid displays. The software is written to be both host computer and graphic device independent. This four volume report includes an Executive Overview of the IMAGE package (Volume 1), followed by Software Description (Volume II), User's Guide (Volume III), and Description of Example Applications (Volume IV)

A new poly-Si TFT compensation pixel circuit employing AC driving mode for AMOLED displays

International Nuclear Information System (INIS)

Song Xiaofeng; Luo Jianguo; Wu Weijing; Peng Junbiao; Zhou Lei; Zhang Lirong

2013-01-01

This paper presents a new poly-Si pixel circuit employing AC driving mode for active matrix organic light-emitting diode (AMOLED) displays. The proposed pixel circuit, which consists of one driving thin-film transistor (TFT), three switching TFTs, and one storage capacitor, can effectively compensate for the threshold voltage variation in poly-Si and the OLED degradation. As there is no light emission, except for during the emitting period, and a small number of devices used in the proposed pixel circuit, a high contrast ratio and a high pixel aperture ratio can be easily achieved. Simulation results by SMART-SPICE software show that the non-uniformity of the OLED current for the proposed pixel circuit is significantly decreased (< 10%) with an average value of 2.63%, while that of the conventional 2T1C is 103%. Thus the brightness uniformity of AMOLED displays can be improved by using the proposed pixel circuit. (semiconductor integrated circuits)

Evaluation of Low-Cost Topologies for Two-Phase Induction Motor Drives, in Industrial Applications

DEFF Research Database (Denmark)

Blaabjerg, Frede; Lungeanu, Florin; Skaug, Kenneth

2002-01-01

on the other side. Another contradiction comes from the benefits as well as from the drawbacks related with the ac running capacitor. It is concluded that the two-phase induction motor drives are more depending on the load characteristic than the three-phase motor drives, while the best topology...

A Multipulse Pattern Modulation Scheme for Harmonic Mitigation in Three-Phase Multimotor Drives

DEFF Research Database (Denmark)

Davari, Pooya; Yang, Yongheng; Zare, Firuz

2016-01-01

, which thus deteriorates the power grid quality and also lowers the conversion efficiency. Both degradations are apt to occur in motor drive applications. At present, many industrial drives are equipped with three-phase diode rectifiers and employ passive filtering techniques on the AC or DC side...

78 FR 39345 - ACS Wireless, Inc.; Notice of Application

Science.gov (United States)

2013-07-01

... communications industry. Applicant states that, on a pro forma basis post-Transaction, its assets will consist of... providing wholesale wireless communications services to its members. The Transaction agreements contemplate... portion of the ACS Wireless' revenue. Applicant states that post-Transaction, on a pro forma basis, for...

Antifriction coatings based on a-C for biomedicine applications

International Nuclear Information System (INIS)

Yurjev, Y N; Kiseleva, D V; Zaitcev, D A; Sidelev, D V; Korneva, O S

2016-01-01

This article reports on the investigation of mechanical properties of carbon films deposited by dual magnetron sputtering system with closed and mirror magnetic field. There is shown that a-C films with predominantly sp 2 -phase have relatively high hardness (up to 20 GPa) and low friction index (∼0.01). The influence of magnetic field on friction index is determined. The analysis of experimental data shows the obtained a-C samples can be used for biomedicine applications. (paper)

Phase-locking of driven vortex lattices with transverse ac force and periodic pinning

International Nuclear Information System (INIS)

Reichhardt, Charles; Kolton, Alejandro B.; Dominguez, Daniel; Gronbech-Jensen, Niels

2001-01-01

For a vortex lattice moving in a periodic array we show analytically and numerically that a new type of phase locking occurs in the presence of a longitudinal dc driving force and a transverse ac driving force. This phase locking is distinct from the Shapiro step phase locking found with longitudinal ac drives. We show that an increase in critical current and a fundamental phase-locked step width scale with the square of the driving ac amplitude. Our results should carry over to other systems such as vortex motion in Josephson-junction arrays

AC Initiation System.

Science.gov (United States)

An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)

AC Application of HTS Conductors in Highly Dynamic Electric Motors

International Nuclear Information System (INIS)

Oswald, B; Best, K-J; Setzer, M; Duffner, E; Soell, M; Gawalek, W; Kovalev, L K

2006-01-01

Based on recent investigations we design highly dynamic electric motors up to 400 kW and linear motors up to 120 kN linear force using HTS bulk material and HTS tapes. The introduction of HTS tapes into AC applications in electric motors needs fundamental studies on double pancake coils under transversal magnetic fields. First theoretical and experimental results on AC field distributions in double-pancake-coils and corresponding AC losses will be presented. Based on these results the simulation of the motor performance confirms extremely high power density and efficiency of both types of electric motors. Improved characteristics of rare earth permanent magnets used in our motors at low temperatures give an additional technological benefit

Chaos in electric drive systems analysis control and application

CERN Document Server

Chau, K T

2011-01-01

In Chaos in Electric Drive Systems: Analysis, Control and Application authors Chau and Wang systematically introduce an emerging technology of electrical engineering that bridges abstract chaos theory and practical electric drives. The authors consolidate all important information in this interdisciplinary technology, including the fundamental concepts, mathematical modeling, theoretical analysis, computer simulation, and hardware implementation. The book provides comprehensive coverage of chaos in electric drive systems with three main parts: analysis, control and application. Corresponding drive systems range from the simplest to the latest types: DC, induction, synchronous reluctance, switched reluctance, and permanent magnet brushless drives.The first book to comprehensively treat chaos in electric drive systemsReviews chaos in various electrical engineering technologies and drive systemsPresents innovative approaches to stabilize and stimulate chaos in typical drivesDiscusses practical application of cha...

Adjustable Speed Drives - Future Challenges and Applications

DEFF Research Database (Denmark)

Blaabjerg, Frede; Thoegersen, Paul

2004-01-01

The main trends within Adjustable Drives in industrial and appliance applications for the next decade are discussed based on the newest developments seen on the market and a few historical trends. Different drive configurations are presented and the general demands to adjustable speed drives...

Application of AC servo motor on the in-core neutron flux instrumentation system

International Nuclear Information System (INIS)

Du Xiaoguang; Wang Mingtao

2010-01-01

The application of ac servo motor in the In-Core Neutron Flux Instrumentation System is described. The hardware component of ac servo motor control system is different from the dc motor control system. The effect of two control system on the instrumentation system is compared. The ac servo motor control system can improve the accuracy of the motion control, optimize the speed control and increase the reliability. (authors)

Improved transistorized AC motor controller for battery powered urban electric passenger vehicles

Science.gov (United States)

Peak, S. C.

1982-01-01

An ac motor controller for an induction motor electric vehicle drive system was designed, fabricated, tested, evaluated, and cost analyzed. A vehicle performance analysis was done to establish the vehicle tractive effort-speed requirements. These requirements were then converted into a set of ac motor and ac controller requirements. The power inverter is a three-phase bridge using power Darlington transistors. The induction motor was optimized for use with an inverter power source. The drive system has a constant torque output to base motor speed and a constant horsepower output to maximum speed. A gear shifting transmission is not required. The ac controller was scaled from the base 20 hp (41 hp peak) at 108 volts dec to an expanded horsepower and battery voltage range. Motor reversal was accomplished by electronic reversal of the inverter phase sequence. The ac controller can also be used as a boost chopper battery charger. The drive system was tested on a dynamometer and results are presented. The current-controlled pulse width modulation control scheme yielded improved motor current waveforms. The ac controller favors a higher system voltage.

Soliton motion in a parametrically ac-driven damped Toda lattice

International Nuclear Information System (INIS)

Rasmussen, K.O.; Malomed, B.A.; Bishop, A.R.; Groenbech-Jensen, N.

1998-01-01

We demonstrate that a staggered parametric ac driving term can support stable progressive motion of a soliton in a Toda lattice with friction, while an unstaggered driving force cannot. A physical context of the model is that of a chain of anharmonically coupled particles adsorbed on a solid surface of a finite size. The ac driving force is generated by a standing acoustic wave excited on the surface. Simulations demonstrate that the state left behind the moving soliton, with the particles shifted from their equilibrium positions, gradually relaxes back to the equilibrium state that existed before the passage of the soliton. The perturbation theory predicts that the ac-driven soliton exists if the amplitude of the drive exceeds a certain threshold. The analytical prediction for the threshold is in reasonable agreement with that found numerically. Collisions between two counterpropagating solitons is also simulated, demonstrating that the collisions are, effectively, fully elastic. copyright 1998 The American Physical Society

Optimal Control Development System for Electrical Drives

Directory of Open Access Journals (Sweden)

Marian GAICEANU

2008-08-01

Full Text Available In this paper the optimal electrical drive development system is presented. It consists of both electrical drive types: DC and AC. In order to implement the optimal control for AC drive system an Altivar 71 inverter, a Frato magnetic particle brake (as load, three-phase induction machine, and dSpace 1104 controller have been used. The on-line solution of the matrix Riccati differential equation (MRDE is computed by dSpace 1104 controller, based on the corresponding feedback signals, generating the optimal speed reference for the AC drive system. The optimal speed reference is tracked by Altivar 71 inverter, conducting to energy reduction in AC drive. The classical control (consisting of rotor field oriented control with PI controllers and the optimal one have been implemented by designing an adequate ControlDesk interface. The three-phase induction machine (IM is controlled at constant flux. Therefore, the linear dynamic mathematical model of the IM has been obtained. The optimal control law provides transient regimes with minimal energy consumption. The obtained solution by integration of the MRDE is orientated towards the numerical implementation-by using a zero order hold. The development system is very useful for researchers, doctoral students or experts training in electrical drive. The experimental results are shown.

ac propulsion system for an electric vehicle

Science.gov (United States)

Geppert, S.

1980-01-01

It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

AC losses in horizontally parallel HTS tapes for possible wireless power transfer applications

Science.gov (United States)

Shen, Boyang; Geng, Jianzhao; Zhang, Xiuchang; Fu, Lin; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Gawith, James; Coombs, T. A.

2017-12-01

This paper presents the concept of using horizontally parallel HTS tapes with AC loss study, and the investigation on possible wireless power transfer (WPT) applications. An example of three parallel HTS tapes was proposed, whose AC loss study was carried out both from experiment using electrical method; and simulation using 2D H-formulation on the FEM platform of COMSOL Multiphysics. The electromagnetic induction around the three parallel tapes was monitored using COMSOL simulation. The electromagnetic induction and AC losses generated by a conventional three turn coil was simulated as well, and then compared to the case of three parallel tapes with the same AC transport current. The analysis demonstrates that HTS parallel tapes could be potentially used into wireless power transfer systems, which could have lower total AC losses than conventional HTS coils.

Active load current sharing in fuel cell and battery fed DC motor drive for electric vehicle application

International Nuclear Information System (INIS)

Pany, Premananda; Singh, R.K.; Tripathi, R.K.

2016-01-01

Highlights: • Load current sharing in FC and battery fed dc drive. • Active current sharing control using LabVIEW. • Detail hardware implementation. • Controller performance is verified through MATLAB simulation and experimental results. - Abstract: In order to reduce the stress on fuel cell based hybrid source fed electric drive system the controller design is made through active current sharing (ACS) technique. The effectiveness of the proposed ACS technique is tested on a dc drive system fed from fuel cell and battery energy sources which enables both load current sharing and source power management. High efficiency and reliability of the hybrid system can be achieved by proper energy conversion and management of power to meet the load demand in terms of required voltage and current. To overcome the slow dynamics feature of FC, a battery bank of adequate power capacity has to be incorporated as FC voltage drops heavily during fast load demand. The controller allows fuel cell to operate in normal load region and draw the excess power from battery. In order to demonstrate the performance of the drive using ACS control strategy different modes of operation of the hybrid source with the static and dynamic behavior of the control system is verified through simulation and experimental results. This control scheme is implemented digitally in LabVIEW with PCI 6251 DAQ I/O interface card. The efficacy of the controller performance is demonstrated in system changing condition supplemented by experimental validation.

Analysis and implementation of power managment and control strategy for six-phase multilevel ac drive system in fault condition

DEFF Research Database (Denmark)

Sanjeevikumar, P.; Grandi, Gabriele; Blaabjerg, Frede

2016-01-01

sources. The developed post-fault algorithm is applied when there is a fault by one VSI and the load is fed from the remaining three healthy VSIs. In faulty conditions the multilevel outputs are reduced from 3-level to 2-level, but still the system propagates with degraded power. Numerical simulation......This research article exploits the power management algorithm in post-fault conditions for a six-phase (quad) multilevel inverter. The drive circuit consists of four 2-level, three-phase voltage source inverter (VSI) supplying a six-phase open-end windings motor or/impedance load......, with circumstantial failure of one VSI investigated. A simplified level-shifted pulse-width modulation (PWM) algorithm is developed to modulate each couple of three-phase VSI as 3-level output voltage generators in normal operation. The total power of the whole ac drive is shared equally among the four isolated DC...

Application of ac impedance in fuel cell research and development

Energy Technology Data Exchange (ETDEWEB)

Selman, J R; Lin, Y P [Illinois Inst. of Tech., Chicago, IL (United States). Dept. of Chemical Engineering

1993-10-01

In applying ac impedance to fuel cells and their porous (gas diffusion) electrodes the emphasis lies on different fuel cell components, and their properties, according to the fuel cell type. The focus has been directed at the electrode/electrolyte interface in MCFC and PAFC, whereas in SOFC and PEMFC the ionic/electronic conductivity of the electrolyte or the characteristics of its composite with the electrocatalyst is of primary interest. The limitations of ac impedance in fuel cell application are in part due to difficulties of interpretation and in part due to experimental difficulties because of the generally fast electrode reaction kinetics. Further research directions are indicated. (author)

Electric vehicle machines and drives design, analysis and application

CERN Document Server

Chau, K

2015-01-01

A timely comprehensive reference consolidates the research and development of electric vehicle machines and drives for electric and hybrid propulsions • Focuses on electric vehicle machines and drives • Covers the major technologies in the area including fundamental concepts and applications • Emphasis the design criteria, performance analyses and application examples or potentials of various motor drives and machine systems • Accompanying website includes the simulation models and outcomes as supplementary material

Power sharing algorithm for vector controlled six-phase AC motor with four customary three-phase voltage source inverter drive

Directory of Open Access Journals (Sweden)

Sanjeevikumar Padmanaban

2015-09-01

Full Text Available This paper considered a six-phase (asymmetrical induction motor, kept 30° phase displacement between two set of three-phase open-end stator windings configuration. The drive system consists of four classical three-phase voltage inverters (VSIs and all four dc sources are deliberately kept isolated. Therefore, zero-sequence/homopolar current components cannot flow. The original and effective power sharing algorithm is proposed in this paper with three variables (degree of freedom based on synchronous field oriented control (FOC. A standard three-level space vector pulse width modulation (SVPWM by nearest three vectors (NTVs approach is adopted to regulate each couple of VSIs. The proposed power sharing algorithm is verified by complete numerical simulation modeling (Matlab/Simulink-PLECS software of whole ac drive system by observing the dynamic behaviors in different designed condition. Set of results are provided in this paper, which confirms a good agreement with theoretical development.

AC Electroluminescent Processes in Pr3+-Activated (Ba0.4Ca0.6TiO3 Diphase Polycrystals

Directory of Open Access Journals (Sweden)

Nan Gao

2017-05-01

Full Text Available We investigated the properties of alternating current (AC-driven electroluminescence from (Ba0.4Ca0.6TiO3:Pr3+ diphase polycrystal-based device. The results of crystal phases and micrographs, and the symmetrical dual emissions in one AC cycle, indicate the spontaneous formation of a dielectric/phosphor/dielectric sandwich microstructure in (Ba0.4Ca0.6TiO3:Pr3+. The electroluminescent device emits a red light of 617 nm, which is attributed to the 1D2-3H4 transition of Pr3+ in the phosphor phase. At a fixed AC frequency, the intensity of electroluminescence exhibits a steep enhancement when applying an increased driving electric field that is beyond a threshold. In a fixed driving electric field, the intensity of electroluminescence shows a rapid rise at low frequencies, but reaches saturation at high frequencies. Based on a double-injection model, we discussed systematically the electroluminescent processes in a whole cycle of AC electric field, which matched well with the experimental data. Our investigation is expected to expand our understanding of such a diphase electroluminescent device, thereby promoting their applications in lighting and displays.

Frequency modulation drive for a piezoelectric motor

Science.gov (United States)

Mittas, Anthony

2001-01-01

A piezoelectric motor has peak performance at a specific frequency f.sub.1 that may vary over a range of frequencies. A drive system is disclosed for operating such a motor at peak performance without feedback. The drive system consists of the motor and an ac source connected to power the motor, the ac source repeatedly generating a frequency over a range from f.sub.1 -.DELTA.x to f.sub.1 +.DELTA.y.

Ripple Field AC Losses in 10-MW Wind Turbine Generators With a MgB2 Superconducting Field Winding

DEFF Research Database (Denmark)

Liu, Dong; Polinder, Henk; Magnusson, Niklas

2016-01-01

Superconducting (SC) synchronous generators are proposed as a promising candidate for 10-20-MW direct-drive wind turbines because they can have low weights and small sizes. A common way of designing an SC machine is to use SC wires with high current-carrying capability in the dc field winding...... and the ac armature winding is made with copper conductors. In such generators, the dc field winding is exposed to ac magnetic field ripples due to space harmonics from the armature. In generator design phases, the ac loss caused by these ripple fields needs to be evaluated to avoid local overheating...... and an excessive cooling budget. To determine the applicability of different design solutions in terms of ac losses, this paper estimates the ac loss level of 10-MW wind generator designs employing a MgB2 SC field winding. The effects on ac losses are compared between nonmagnetic and ferromagnetic teeth...

AC, DC or EC motor? What type of engine for what purpose?; AC-, DC- oder EC-Motor? Welche Motorausfuehrung fuer welchen Zweck

Energy Technology Data Exchange (ETDEWEB)

Zeiff, Andreas; Homburg, Dietrich

2009-01-15

Electronics is the key technology in control engineering, but even the best control system requires reliable modules to transmit signals. Modern electric motors have become indispensable here. There are nearly as many motor types as there are applications. Electromagnetic conversion of electric into mechanical power is directly related to motor design. There are AC and DC motors, one-speed motors and variable-speed motors. Rotary momentum and synchronisation can be optimized by selecting the appropriate motor type, as can dynamics and detent torque. Correct selection of the electric motor therefore is essential for an optimal drive concept. (orig.)

Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

Science.gov (United States)

Reitan, D. K.

1973-01-01

Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

Common-mode Voltage Reduction in a Motor Drive System with a Power Factor Correction

DEFF Research Database (Denmark)

Adabi, J.; Boora, A.A.; Zare, F.

2012-01-01

Common-mode voltage generated by a power converter in combination with parasitic capacitive couplings is a potential source of shaft voltage in an AC motor drive system. In this study, a three-phase motor drive system supplied with a single-phase AC-DC diode rectifier is investigated in order...... to reduce shaft voltage in a three-phase AC motor drive system. In this topology, the AC-DC diode rectifier influences the common-mode voltage generated by the inverter because the placement of the neutral point is changing in different rectifier circuit states. A pulse width modulation technique...

Cost effective second generation AC-modules: Development and testing aspects

International Nuclear Information System (INIS)

Islam, Saiful; Woyte, Achim; Belmans, Ronnie; Heskes, Peter; Rooij, P.M.; Hogedoorn, Ron

2006-01-01

In the framework of the European research project PV2GO, a new AC-module inverter was developed, taking into account all relevant aspects from a European market's point of view (standards, market, application, and research and development goals). The project goal was to achieve the overall system costs of 3 Euro per Wp for a modular plug-and-play photovoltaic system. For the photovoltaic-module, a standard 130-Wp Eurosolare module was chosen. The research and development (R and D) goal was to develop an advanced DC-control system consisting of a state-of-the-art programmable digital device and an Application Specific Integrated Circuit (ASIC) for the AC-control of the inverter. According to the topology concept, thermal and magnetic designs were optimized with regard to production technology and packaging for large-scale production. The new AC-modules were tested in a number of field-test sites in various parts of Europe and their reliability was assessed through Highly Accelerated Stress Tests. Efficiency and power quality have been tested in the laboratory. Further in the PV2GO project an optimization study of the manufacturing process of the new generation of AC-modules for high volume output was done. Another task was the pre-certification procedure to assure compliance with the European guidelines and standards

Changes in driving behavior and cognitive performance with different breath alcohol concentration levels.

Science.gov (United States)

Liu, Yung-Ching; Fu, Shing-Mei

2007-06-01

This study examines the changes in driving behavior and cognitive performance of drivers with different breath alcohol concentration (BrAC) levels. Eight licensed drivers, aged between 20 and 30 years, with BrAC levels of 0.00, 0.25, 0.4 and 0.5 mg/l performed simulated driving tests under high- and low-load conditions. Subjects were asked to assess their subjective psychological load at specified intervals and perform various tasks. The outcome was measured in terms of reaction times for task completion, accuracy rates, and driver's driving behavior. The effects of BrAC vary depending on the task. Performance of tasks involving attention shift, information processing, and short-term memory showed significant deterioration with increasing BrAC, while dangerous external vehicle driving behavior occurred only when the BrAC reached 0.4 mg/l and the deterioration was marked. We can conclude that the cognitive faculty is the first to be impaired by drinking resulting in deteriorated performance in tasks related to divided attention, short-term memory, logical reasoning, followed by visual perception. On the other hand, increasing alcohol dose may not pose an immediate impact on the external vehicle driving behavior but may negatively affect the driver's motor behavior even at low BrAC levels. Experience and will power could compensate for the negative influence of alcohol enabling the drivers to remain in full steering control. This lag between alcohol consumption and impaired driving performance may mislead the drivers in thinking that they are still capable of safe steering and cause them to ignore the potential dangers of drunk driving.

Output filters for AC adjustable speed drives

DEFF Research Database (Denmark)

Blaabjerg, Frede; Hanigovszki, Norbert; Landkildehus, Jorn, Jorn

2007-01-01

The standard industrial solution for adjustable speed drives (ASD) is the use of induction motors (IM) fed by voltage-source inverters (VSI). The inverter generates a pulsewidth modulated (PWM) voltage, with dv/dt values of about 6 kV/¿s or even more. In three-leg inverters for three-phase appli...

Simulation of Trolleybus Traction Induction Drive With Supercapacitor Energy Storage System

Science.gov (United States)

Brazis, V.; Latkovskis, L.; Grigans, L.

2010-01-01

The article considers the possibilities of saving the regenerative braking energy in Škoda 24Tr type trolleybuses by installing the onboard supercapacitor energy storage system (ESS) and improving its performance with automated switching to the autonomous traction mode. Proposed is an ESS control system with constant DC bus voltage in the supercapacitor charging mode and supercapacitor current proportional to the AC drive current in the discharging mode. The authors investigate stability of the trolleybus ESS control system operating together with AC traction drive in various overhead voltage failure modes. The co-simulation of ESS operation was done by Matlab/Simulink AC drive and PSIM ESS continuous models.

Patterns of drinking and driving offenses among nightclub patrons in Brazil.

Science.gov (United States)

Wagner, Gabriela A; Sanchez, Zila M

2017-05-01

Brazil has a strict drinking and driving law known as the Brazilian "Dry Law". The aim of the present study was to investigate characteristics associated with the breaking of the Brazilian traffic law, on drinking and driving, at nightclub exit among a representative sample of nightclub patrons in the city of São Paulo, Brazil. Portal survey realized with a two-stage cluster sampling survey design to collect data from 2422 patrons at the entrance and 1822 patrons at the exit of 31 nightclubs in the city of São Paulo, Brazil. Patrons' breath alcohol concentrations (BrACs) at the entrance and exit of the nightclubs were categorized according to the law as either a "traffic offense" or a "traffic offense and crime". Weighted multinomial logistic regression was used to analyze factors associated with different patterns of drinking and driving offenses. Of the subjects, 16.5% (n=369) were identified as driving patrons at the entrance and exit of the nightclubs. At entry, 80.1% of the patrons had a zero BrAC, 14.9% had a BrAC meeting the traffic offense criteria and 5.0% had a BrAC meeting the traffic offense and crime criteria. Women were less likely to have BrACs meeting the traffic offense criteria. At nightclub exit, 63.4% of patrons had maintained a zero BrAC, 24.7% had a BrAC that had increased and now met the traffic offense and crime criteria, and 11.9% had a decreased or stable BrAC. An increased BrAC was more frequently identified in patrons who were men, were single, and had used illicit drugs inside the nightclub. Despite the existence of a strict law regarding drinking and driving, a significant proportion of nightclub patrons in the city of São Paulo had violated this law, suggesting a perception of impunity and need for law enforcement. Copyright © 2017 Elsevier B.V. All rights reserved.

Ab initio full charge-density study of the atomic volume of α-phase Fr, Ra, Ac, Th, Pa, U, Np, and Pu

DEFF Research Database (Denmark)

Vitos, Levente; Kollár, J.; Skriver, Hans Lomholt

1997-01-01

We have used a full charge-density technique based on the linear muffin-tin orbitals method in first-principles calculations of the atomic volumes of the light actinides including Fr, Ra, and Ac in their low-temperature crystallographic phases. The good agreement between the theoretical and exper......We have used a full charge-density technique based on the linear muffin-tin orbitals method in first-principles calculations of the atomic volumes of the light actinides including Fr, Ra, and Ac in their low-temperature crystallographic phases. The good agreement between the theoretical...... and experimental values along the series support the picture of itinerant 5f electronic states in Th to Pu. The increased deviation between theory and experiment found in Np and Pu may be an indication of correlation effects not included in the local density approximation....

Effects of Consuming a Low Dose of Alcohol with Mixers Containing Carbohydrate or Artificial Sweetener on Simulated Driving Performance

Directory of Open Access Journals (Sweden)

Bryce Brickley

2018-03-01

Full Text Available The Australian National Drug and Alcohol Research Centre (NDARC devised gender-based drinking recommendations to ensure blood or equivalized breath alcohol concentrations (BrAC remain <0.050%. However, these may be inappropriate for individuals consuming alcohol without carbohydrate (CHO, which results in higher BrACs. This study investigated the effects of ingesting alcohol with and without CHO on BrACs and simulated driving performance. Thirty-two participants (16 males; age: 23 ± 6 years completed two randomized single-blinded trials. Participants performed a baseline drive (Drive 1, then an experimental drive (Drive 2, following alcohol consumption (males: 20 g; females: 10 g. Alcoholic beverages contained either 25 g sucrose or aspartame (AS. Driving performance was assessed using lateral control (standard deviation of lane position [SDLP] and number of lane departures and risk-taking (number of overtaking maneuvers and maximum overtaking speed. BrAC and subjective ratings (e.g., intoxication were also assessed. BrAC was significantly lower as Drive 2 commenced with CHO compared to AS (0.022 ± 0.008% vs. 0.030 ± 0.011%. Two males provided BrACs >0.050% with AS. Neither beverage influenced changes to simulated driving performance. Ingesting alcohol in quantities advised by the NDARC results in no detectable simulated driving impairment. However, the likelihood of exceeding the legal drink-driving BrAC is increased when alcohol is consumed with artificially-sweetened mixers.

A new DC/AC boost transformerless converter in application of photovoltaic power generation

DEFF Research Database (Denmark)

Wei, Mo; Loh, Poh Chiang; Blaabjerg, Frede

2011-01-01

This paper presents a new DC/AC boost transformerless converter in the applications of photovoltaic (PV) power generation. A new circuit topology of single phase full bridge power inverter with additional DC/DC boost stage is proposed. The proposed topology overcomes two commonly existing......, and then converts the DC into AC to supply the load. A special modulation technique is proposed to eliminate the leakage current which is commonly presents in PV transformerless power generation, helps to increase the system efficiency and output performance....

Research on a novel DDC-based capacity controller for the direct-expansion variable-air-volume A/C system

Energy Technology Data Exchange (ETDEWEB)

Chen Wu, E-mail: chenwu73@263.ne [School of Marine Engineering, Jimei University, Xiamen, Fujian Province 361021 (China); Deng Shiming [Department of Building Services Engineering, The Hong Kong Polytechnic University, Kowloon (Hong Kong)

2010-01-15

A direct-expansion (DX) variable-air-volume (VAV) air-conditioning (A/C) system consists of a VAV air-distribution sub-system and a DX refrigeration plant. This paper reports in detail on a novel capacity controller developed for the DX VAV A/C system to regulate its compressor speed and hence its cooling capacity. The capacity controller consisted of both a numerical calculation algorithm (NCA), which was fundamentally based on the principle of energy balance using a number of real-time measured system's operating parameters, and a dead-band for decoupling the control actions from both the capacity controller and a conventional PI feedback controller for regulating the opening of an electronic expansion valve (EEV) in the refrigeration plant. To study the feasibility of the capacity controller, an experimental rig for the DX VAV A/C system having two conditioned spaces was built and experimental tests were carried out. The test results showed that using the capacity controller, the cooling capacity of the system's refrigeration plant can be accurately and continuously regulated and the supply air temperature well maintained at its desired value. The desirable independent zoning-control for space air temperatures can be successfully achieved by the DX VAV A/C system and the control performance for air temperatures in the conditioned space was highly satisfactory.

Research on a novel DDC-based capacity controller for the direct-expansion variable-air-volume A/C system

Energy Technology Data Exchange (ETDEWEB)

Chen, Wu [School of Marine Engineering, Jimei University, Xiamen, Fujian Province 361021 (China); Deng, Shiming [Department of Building Services Engineering, The Hong Kong Polytechnic University, Kowloon (China)

2010-01-15

A direct-expansion (DX) variable-air-volume (VAV) air-conditioning (A/C) system consists of a VAV air-distribution sub-system and a DX refrigeration plant. This paper reports in detail on a novel capacity controller developed for the DX VAV A/C system to regulate its compressor speed and hence its cooling capacity. The capacity controller consisted of both a numerical calculation algorithm (NCA), which was fundamentally based on the principle of energy balance using a number of real-time measured system's operating parameters, and a dead-band for decoupling the control actions from both the capacity controller and a conventional PI feedback controller for regulating the opening of an electronic expansion valve (EEV) in the refrigeration plant. To study the feasibility of the capacity controller, an experimental rig for the DX VAV A/C system having two conditioned spaces was built and experimental tests were carried out. The test results showed that using the capacity controller, the cooling capacity of the system's refrigeration plant can be accurately and continuously regulated and the supply air temperature well maintained at its desired value. The desirable independent zoning-control for space air temperatures can be successfully achieved by the DX VAV A/C system and the control performance for air temperatures in the conditioned space was highly satisfactory. (author)

Research on a novel DDC-based capacity controller for the direct-expansion variable-air-volume A/C system

International Nuclear Information System (INIS)

Chen Wu; Deng Shiming

2010-01-01

A direct-expansion (DX) variable-air-volume (VAV) air-conditioning (A/C) system consists of a VAV air-distribution sub-system and a DX refrigeration plant. This paper reports in detail on a novel capacity controller developed for the DX VAV A/C system to regulate its compressor speed and hence its cooling capacity. The capacity controller consisted of both a numerical calculation algorithm (NCA), which was fundamentally based on the principle of energy balance using a number of real-time measured system's operating parameters, and a dead-band for decoupling the control actions from both the capacity controller and a conventional PI feedback controller for regulating the opening of an electronic expansion valve (EEV) in the refrigeration plant. To study the feasibility of the capacity controller, an experimental rig for the DX VAV A/C system having two conditioned spaces was built and experimental tests were carried out. The test results showed that using the capacity controller, the cooling capacity of the system's refrigeration plant can be accurately and continuously regulated and the supply air temperature well maintained at its desired value. The desirable independent zoning-control for space air temperatures can be successfully achieved by the DX VAV A/C system and the control performance for air temperatures in the conditioned space was highly satisfactory.

An overview of power electronics applications in fuel cell systems: DC and AC converters.

Science.gov (United States)

Ali, M S; Kamarudin, S K; Masdar, M S; Mohamed, A

2014-01-01

Power electronics and fuel cell technologies play an important role in the field of renewable energy. The demand for fuel cells will increase as fuel cells become the main power source for portable applications. In this application, a high-efficiency converter is an essential requirement and a key parameter of the overall system. This is because the size, cost, efficiency, and reliability of the overall system for portable applications primarily depend on the converter. Therefore, the selection of an appropriate converter topology is an important and fundamental aspect of designing a fuel cell system for portable applications as the converter alone plays a major role in determining the overall performance of the system. This paper presents a review of power electronics applications in fuel cell systems, which include various topology combinations of DC converters and AC inverters and which are primarily used in fuel cell systems for portable or stand-alone applications. This paper also reviews the switching techniques used in power conditioning for fuel cell systems. Finally, this paper addresses the current problem encountered with DC converters and AC inverter.

DC-Link Compensation Method for Slim DC Link Drives Fed by Soft Grid

DEFF Research Database (Denmark)

Mathe, Laszlo; Rosendahl Andersen, Henrik; Lazar, Radu

2010-01-01

Slim DC-link PWM (AC) drives for lowperformance applications are emerging on the market. Such drives equipped with a small DC-link capacitance exhibit instability tendencies, if installed on a soft line, giving a degraded performance. The total harmonic distortion (THD) and the partially weighted...... harmonic distortion (PWHD) of the line current are degraded, if resonance between the line impedance and the DC-link capacitance occurs. Likewise, the motor performance is affected negatively giving extra torque ripple, vibration and acoustic-noise emission. This paper proposes a novel DC-link compensation...

An Integrated Multifunctional Bidirectional AC/DC and DC/DC Converter for Electric Vehicles Applications

OpenAIRE

Liwen Pan; Chengning Zhang

2016-01-01

This paper presents an on-board vehicular battery charger that integrates bidirectional AC/DC converter and DC/DC converter to achieve high power density for application in electric vehicles (EVs). The integrated charger is able to transfer electrical energy between the battery pack and the electric traction system and to function as an AC/DC battery charger. The integrated charger topology is presented and the design of passive components is discussed. The control schemes are developed for m...

Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

DEFF Research Database (Denmark)

Ljusev, Petar; Andersen, Michael Andreas E.

2004-01-01

This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS

Directory of Open Access Journals (Sweden)

S. YU. Buryak

2014-05-01

Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.

Design of High-Efficiency and Low-Cost Six-Phase Permanent Magnet Synchronous Generator for Direct-Drive Small-Scale Wind Power Application

Directory of Open Access Journals (Sweden)

M. E. Moazzen

2017-06-01

Full Text Available Permanent magnet synchronous generators (PMSG have a huge potential for direct-drive wind power applications. Therefore, optimal design of these generators is necessary to maximize their efficiency and to reduce their manufacturing cost and total volume. In this paper, an optimal design of a six-phase 3.5 KW direct-drive PMSG to generate electricity for domestic needs is performed. The aim of optimal design is to reduce the manufacturing cost, losses and total volume of PMSG. To find the best design, single/multi-objective design optimization is carried out. Cuckoo optimization algorithm (COA is adopted to solve the optimization problem. Comparison between the results of the single-objective and multi-objective models shows that simultaneous optimization of manufacturing cost, losses and total volume leads to more suitable design for PMSG. Finally, finite-element method (FEM is employed to validate the optimal design, which show a good agreement between the theoretical work and simulation results.

Analysis and implementation of power management and control strategy for six-phase multilevel ac drive system in fault condition

Directory of Open Access Journals (Sweden)

Sanjeevikumar Padmanaban

2016-03-01

Full Text Available This research article exploits the power management algorithm in post-fault conditions for a six-phase (quad multilevel inverter. The drive circuit consists of four 2-level, three-phase voltage source inverter (VSI supplying a six-phase open-end windings motor or/impedance load, with circumstantial failure of one VSI investigated. A simplified level-shifted pulse-width modulation (PWM algorithm is developed to modulate each couple of three-phase VSI as 3-level output voltage generators in normal operation. The total power of the whole ac drive is shared equally among the four isolated DC sources. The developed post-fault algorithm is applied when there is a fault by one VSI and the load is fed from the remaining three healthy VSIs. In faulty conditions the multilevel outputs are reduced from 3-level to 2-level, but still the system propagates with degraded power. Numerical simulation modelling and experimental tests have been carried out with proposed post-fault control algorithm with three-phase open-end (asymmetrical induction motor/R-L impedance load. A complete set of simulation and experimental results provided in this paper shows close agreement with the developed theoretical background.

Vector control of three-phase AC machines system development in the practice

CERN Document Server

Quang, Nguyen Phung; Dittrich, J

2015-01-01

This book addresses the vector control of three-phase AC machines, in particular induction motors with squirrel-cage rotors (IM), permanent magnet synchronous motors (PMSM) and doubly-fed induction machines (DFIM), from a practical design and development perspective. The main focus is on the application of IM and PMSM in electrical drive systems, where field-orientated control has been successfully established in practice. It also discusses the use of grid-voltage oriented control of DFIMs in wind power plants. This second, enlarged edition includes new insights into flatness-based  nonlinear

Improved SCR ac Motor Controller for Battery Powered Urban Electric Vehicles

Science.gov (United States)

Latos, T. S.

1982-01-01

An improved ac motor controller, which when coupled to a standard ac induction motor and a dc propulsion battery would provide a complete electric vehicle power train with the exception of the mechanical transmission and drive wheels was designed. In such a system, the motor controller converts the dc electrical power available at the battery terminals to ac electrical power for the induction motor in response to the drivers commands. The performance requirements of a hypothetical electric vehicle with an upper weight bound of 1590 kg (3500 lb) were used to determine the power rating of the controller. Vehicle acceleration capability, top speed, and gradeability requisites were contained in the Society of Automotive Engineers (SAE) Schedule 227a(d) driving cycle. The important capabilities contained in this driving cycle are a vehicle acceleration requirement of 0 to 72.4 kmph (0 to 45 mph) in 28 seconds a top speed of 88.5 kmph (55 mph), and the ability to negotiate a 10% grade at 48 kmph (30 mph). A 10% grade is defined as one foot of vertical rise per 10 feet of horizontal distance.

Dynamic Behavior of Electric Machines and Drives. Papers presented at the Conference of Energy Technology, Society Within the VDE (ETG) and of the Measurement and Control Society of VDI/VDE (Energy Technology Society), 1979

Energy Technology Data Exchange (ETDEWEB)

1980-01-01

The volume contains 12 pages divided into 3 sections; dynamic behavior of motors and drives; modeling of electric machines and drives; dynamic behavior in the generation of electric power. Individual paper deal with: ac drives in power plants and chemical industry; dc drives in steel industry; dynamic behavior of rectifier-fed asynchronous and synchronous motors; modeling of drives, generators, excitation devices and controllers; comparison of excitation systems; analysis of power fluctuations of a large power plant unit by means of a simplified block circuit model; effect of voltage and turbine control on the dynamic behavior of large steam turbine units in the system.

Statistical time lags in ac discharges

International Nuclear Information System (INIS)

Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F

2011-01-01

The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

Statistical time lags in ac discharges

Energy Technology Data Exchange (ETDEWEB)

Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)

2011-04-06

The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms{sup -1}. The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

Modelling and measurement of ac loss in BSCCO/Ag-tape windings

International Nuclear Information System (INIS)

Oomen, M P; Nanke, R; Leghissa, M

2003-01-01

High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications

Application for Single Price Auction Model (SPA) in AC Network

Science.gov (United States)

Wachi, Tsunehisa; Fukutome, Suguru; Chen, Luonan; Makino, Yoshinori; Koshimizu, Gentarou

This paper aims to develop a single price auction model with AC transmission network, based on the principle of maximizing social surplus of electricity market. Specifically, we first formulate the auction market as a nonlinear optimization problem, which has almost the same form as the conventional optimal power flow problem, and then propose an algorithm to derive both market clearing price and trade volume of each player even for the case of market-splitting. As indicated in the paper, the proposed approach can be used not only for the price evaluation of auction or bidding market but also for analysis of bidding strategy, congestion effect and other constraints or factors. Several numerical examples are used to demonstrate effectiveness of our method.

Electric Drive Study

Science.gov (United States)

1987-03-01

compound promises to reduce weight of future permanent magnet motors by 20 to 30 percent; a similar reduction is expected in size (approximately 20...drive systems. The AC permanent magnet (brushless DC motor) is rapidly evolving and will replace most electrically excited machines. Permanent magnet motors using

A Phase Current Reconstruction Approach for Three-Phase Permanent-Magnet Synchronous Motor Drive

Directory of Open Access Journals (Sweden)

Hao Yan

2016-10-01

Full Text Available Three-phase permanent-magnet synchronous motors (PMSMs are widely used in renewable energy applications such as wind power generation, tidal energy and electric vehicles owing to their merits such as high efficiency, high precision and high reliability. To reduce the cost and volume of the drive system, techniques of reconstructing three-phase current using a single current sensor have been reported for three-phase alternating current (AC control system using the power converts. In existing studies, the reconstruction precision is largely influenced by reconstructing dead zones on the Space Vector Pulse Width Modulation (SVPWM plane, which requires other algorithms to compensate either by modifying PWM modulation or by phase-shifting of the PWM signal. In this paper, a novel extended phase current reconstruction approach for PMSM drive is proposed. Six novel installation positions are obtained by analyzing the sampling results of the current paths between each two power switches. By arranging the single current sensor at these positions, the single current sensor is sampled during zero voltage vectors (ZVV without modifying the PWM signals. This proposed method can reconstruct the three-phase currents without any complex algorithms and is available in the sector boundary region and low modulation region. Finally, this method is validated by experiments.

AC electric motors control advanced design techniques and applications

CERN Document Server

Giri, Fouad

2013-01-01

The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

Performance Evaluation of A Developed Variable Frequency Drive ...

African Journals Online (AJOL)

This paper presents the performance characteristics of a developed variable frequency drive (VFD) adaptable for operation of ac machines speed control. The VFD developed is robust, durable, cheap and have low maintenance cost compared to conventional VFDs. The controlled asynchronous ac motor was operated to ...

Right ventricular volume estimation with cine MRI

International Nuclear Information System (INIS)

Sawachika, Takashi

1993-01-01

To quantitate right ventricular (RV) volumes easily using cine MRI, we developed a new method called 'modified area-length method (MOAL method)'. To validate this method, we compared it to the conventional Simpson's rule. Magnetom H15 (Siemens) was used and 6 normal volunteers and 21 patients with various RV sizes were imaged with ECG triggered gradient echo method (FISP, TR 50 ms, TE 12 ms, slice thickness 9 mm). For Simpson's rule transverse images of 12 sequential views which cover whole heart were acquired. For the MOAL method, two orthogonal views were imaged. One was the sagittal view which includes RV outflow tract and the other was the coronal view defined from the sagittal image to cover the whole RV. From these images the area (As, Ac) of RV and the longest distance between RV apex and pulmonary valve (Lmax) were determined. By correlating RV volumes measured by Simpson's rule to As*Ac/Lmax the RV volume could be estimated as follows: V=0.85*As*Ac/Lmax+4.55. Thus the MOAL method demonstrated excellent accuracy to quantitate RV volume and the acquisition time abbreviated to one fifth compared with Simpson's rule. This should be a highly promising method for routine clinical application. (author)

FreedomCAR Advanced Traction Drive Motor Development Phase I

Energy Technology Data Exchange (ETDEWEB)

Ley, Josh (UQM Technologies, Inc.); Lutz, Jon (UQM Technologies, Inc.)

2006-09-01

The overall objective of this program is to design and develop an advanced traction motor that will meet the FreedomCAR and Vehicle Technologies (FCVT) 2010 goals and the traction motor technical targets. The motor specifications are given in Section 1.3. Other goals of the program include providing a cost study to ensure the motor can be developed within the cost targets needed for the automotive industry. The program has focused on using materials that are both high performance and low costs such that the performance can be met and cost targets are achieved. In addition, the motor technologies and machine design features must be compatible with high volume manufacturing and able to provide high reliability, efficiency, and ruggedness while simultaneously reducing weight and volume. Weight and volume reduction will become a major factor in reducing cost, material cost being the most significant part of manufacturing cost at high volume. Many motor technology categories have been considered in the past and present for traction drive applications, including: brushed direct current (DC), PM (PM) brushless dc (BLDC), alternating current (AC) induction, switched reluctance and synchronous reluctance machines. Of these machine technologies, PM BLDC has consistently demonstrated an advantage in terms of power density and efficiency. As rare earth magnet cost has declined, total cost may also be reduced over the other technologies. Of the many different configurations of PM BLDC machines, those which incorporate power production utilizing both magnetic torque as well as reluctance torque appear to have the most promise for traction applications. There are many different PM BLDC machine configurations which employ both of these torque producing mechanisms; however, most would fall into one of two categories--some use weaker magnets and rely more heavily on reluctance torque (reluctance-dominant PM machines), others use strong PMs and supplement with reluctance torque

OPTIMISATION OF A DRIVE SYSTEM AND ITS EPICYCLIC GEAR SET

OpenAIRE

Bellegarde , Nicolas; Dessante , Philippe; Vidal , Pierre; Vannier , Jean-Claude

2007-01-01

International audience; This paper describes the design of a drive consisting of a DC motor, a speed reducer, a lead screw transformation system, a power converter and its associated DC source. The objective is to reduce the mass of the system. Indeed, the volume and weight optimisation of an electrical drive is an important issue for embedded applications. Here, we present an analytical model of the system in a specific application and afterwards an optimisation of the motor and speed reduce...

AC/ARNG Integrated Division Concept Study, Appendices, Volume 3

National Research Council Canada - National Science Library

Twohig, John

1997-01-01

...) division headquarters. The US Army Training and Doctrine Command (TRADOC) was tasked to conduct a viability assessment of the AC/ARNG Integrated Division concept and focus on merits and implementation issues...

PMBLDC motor drive with power factor correction controller

DEFF Research Database (Denmark)

George, G.J.; Ramachandran, Rakesh; Arun, N.

2012-01-01

reliability, and low maintenance requirements. The proposed Power Factor Controller topology improves power quality by improving performance of PMBLDCM drive, such as reduction of AC main current harmonics, near unity power factor. PFC converter forces the drive to draw sinusoidal supply current in phase...

Indirect Matrix Converter for Hybrid Electric Vehicle Application with Three-Phase and Single-Phase Outputs

Directory of Open Access Journals (Sweden)

Yeongsu Bak

2015-04-01

Full Text Available This paper presents an indirect matrix converter (IMC topology for hybrid electric vehicle (HEV application with three-phase and single-phase outputs. The HEV includes mechanical, electrical, control, and electrochemical systems among others. In the mechanical system, a traction motor and a compressor motor are used to drive the HEV. The traction motor and the compressor motor are usually operated as three-phase and single-phase motors, respectively. In this respect, a dual AC-drive system can operate the traction and the compressor motor simultaneously. Furthermore, compared to a conventional dual matrix converter system, the proposed topology can reduce the number of switches that the dual outputs share with a DC-link. The application of this system for HEV has advantages, like long lifetime and reduced volume due to the lack of a DC-link. The proposed control strategy and modulation schemes ensure the sinusoidal input and output waveforms and bidirectional power transmission. The proposed system for the HEV application is verified by simulation and experiments.

Sensorless AC electric motor control robust advanced design techniques and applications

CERN Document Server

Glumineau, Alain

2015-01-01

This monograph shows the reader how to avoid the burdens of sensor cost, reduced internal physical space, and system complexity in the control of AC motors. Many applications fields—electric vehicles, wind- and wave-energy converters and robotics, among them—will benefit. Sensorless AC Electric Motor Control describes the elimination of physical sensors and their replacement with observers, i.e., software sensors. Robustness is introduced to overcome problems associated with the unavoidable imperfection of knowledge of machine parameters—resistance, inertia, and so on—encountered in real systems. The details of a large number of speed- and/or position-sensorless ideas for different types of permanent-magnet synchronous motors and induction motors are presented along with several novel observer designs for electrical machines. Control strategies are developed using high-order, sliding-mode and quasi-continuous-sliding-mode techniques and two types of observer–controller schemes based on backstepping ...

Effective Peroxidase-Like Activity of Co-Aminoclay [CoAC] and Its Application for Glucose Detection

Directory of Open Access Journals (Sweden)

Han Pill Song

2018-02-01

Full Text Available In this study, we describe a novel peroxidase-like activity of Co-aminoclay [CoAC] present at pH ~5.0 and its application to fluorescent biosensor for the determination of H2O2 and glucose. It is synthesized with aminoclays (ACs entrapping cationic metals such as Fe, Cu, Al, Co., Ce, Ni, Mn, and Zn to find enzyme mimicking ACs by sol–gel ambient conditions. Through the screening of catalytic activities by the typical colorimetric reaction employing 2,2′-azino-bis(3-ethylbenzo-thiazoline-6-sulfonic aciddiammonium salt (ABTS as a substrate with or without H2O2, Fe, Cu, and CoACs are found to exhibit peroxidase-like activity, as well as oxidase-like activity was observed from Ce and MnACs. Among them, CoAC shows exceptionally high peroxidase-like activity, presumably due to its ability to induce electron transfer between substrates and H2O2. CoAC is then used to catalyze the oxidation of Amplex® UltraRed (AUR into a fluorescent end product, which enables a sensitive fluorescent detection of H2O2. Moreover, a highly sensitive and selective glucose biosensing strategy is developed, based on enzyme cascade reaction between glucose oxidase (GOx and CoAC. Using this strategy, a highly linear fluorescence enhancement is verified when the concentration of glucose is increased in a wide range from 10 μM to 1 mM with a lower detection limit of 5 μM. The practical diagnostic capability of the assay system is also verified by its use to detect glucose in human blood serum. Based on these results, it is anticipated that CoAC can serve as potent peroxidase mimetics for the detection of clinically important target molecules.

THE ACS NEARBY GALAXY SURVEY TREASURY

International Nuclear Information System (INIS)

Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.

2009-01-01

The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

Finite Volumes for Complex Applications VII

CERN Document Server

Ohlberger, Mario; Rohde, Christian

2014-01-01

The methods considered in the 7th conference on "Finite Volumes for Complex Applications" (Berlin, June 2014) have properties which offer distinct advantages for a number of applications. The second volume of the proceedings covers reviewed contributions reporting successful applications in the fields of fluid dynamics, magnetohydrodynamics, structural analysis, nuclear physics, semiconductor theory and other topics. The finite volume method in its various forms is a space discretization technique for partial differential equations based on the fundamental physical principle of conservation. Recent decades have brought significant success in the theoretical understanding of the method. Many finite volume methods preserve further qualitative or asymptotic properties, including maximum principles, dissipativity, monotone decay of free energy, and asymptotic stability. Due to these properties, finite volume methods belong to the wider class of compatible discretization methods, which preserve qualitative propert...

Characterization and snubbing of a bidirectional MCT in a resonant ac link converter

Science.gov (United States)

Lee, Tony; Elbuluk, Malik E.; Zinger, Donald S.

1993-01-01

The MOS-Controlled Thyristor (MCT) is emerging as a powerful switch that combines the better characteristics of existing power devices. A study of switching stresses on an MCT switch under zero voltage resonant switching is presented. The MCT is used as a bidirectional switch in an ac/ac pulse density modulated inverter for induction motor drive. Current and voltage spikes are observed and analyzed with variations in the timing of the switching. Different snubber circuit configurations are under investigation to minimize the effect of these transients. The results will be extended to study and test the MCT switching in a medium power (5 hp) induction motor drive.

Forward Conduction Mode Controlled Piezoelectric Transformer-Based PFC LED Drive

DEFF Research Database (Denmark)

Roedgaard, M. S.; Weirich, M.; Andersen, M. A. E.

2013-01-01

Light-emitting diode (LED) illumination is getting more and more common; as LED's performance is rising, the price is falling and is getting competitive. Some of the challenges of ac mains supplied illumination are the requirement of power factor correction (PFC) and the competitiveness of a low...... priced market. In this paper, a new forward conduction mode (FCM) control method for piezoelectric transformer (PT)-based power converters is proposed. A PT-based LED drive facilitating passive PFC is developed, utilizing and validating the FCM control method. The drive utilizes an inductorless half...... LED drive has been developed, supplied from 230-V 50-Hz ac mains, achieving a power factor of 0.96....

HIL Simulation of Power Electronics and Electric Drives for Automotive Applications

Directory of Open Access Journals (Sweden)

Frank Puschmann

2012-12-01

Full Text Available Hardware-in-the-loop simulation is today a standard method for testing electronic equipment in the automotive industry. Since electric drives and power electronic devices are more and more important in automotive applications, these kinds of systems have to be integrated into the hardware-in-the-loop simulation. Power converters and electric drives are used in many different applications in vehicles today (hybrid electric or electric powertrain, electric steering systems, DC-DC converters, etc.. The wide range of applications, topologies, and power levels results in various different approaches and solutions for hardware-in-the-loop testing. This paper gives an overview of hardware-in-the-loop simulation of power electronics and electric drives in the automotive industry. The currently available technologies are described and future challenges are outlined.

Principle and analysis of a linear motor driving system for HTS levitation applications

International Nuclear Information System (INIS)

Jin, Jian X.; Guo, You G.; Zhu, Jian G.

2007-01-01

High temperature superconductor (HTS) high levitation force density with passive and self-stabilizing features allows a number of special applications to be developed. Linear motor driving systems are commonly required for those applications such as levitated transport systems. In this paper a prototype linear motor driving system with HTS is analyzed with calculation details including its magnetic fields and driving forces presented in the paper

Quantum recurrence and fractional dynamic localization in ac-driven perfect state transfer Hamiltonians

International Nuclear Information System (INIS)

Longhi, Stefano

2014-01-01

Quantum recurrence and dynamic localization are investigated in a class of ac-driven tight-binding Hamiltonians, the Krawtchouk quantum chain, which in the undriven case provides a paradigmatic Hamiltonian model that realizes perfect quantum state transfer and mirror inversion. The equivalence between the ac-driven single-particle Krawtchouk Hamiltonian H -hat (t) and the non-interacting ac-driven bosonic junction Hamiltonian enables to determine in a closed form the quasi energy spectrum of H -hat (t) and the conditions for exact wave packet reconstruction (dynamic localization). In particular, we show that quantum recurrence, which is predicted by the general quantum recurrence theorem, is exact for the Krawtchouk quantum chain in a dense range of the driving amplitude. Exact quantum recurrence provides perfect wave packet reconstruction at a frequency which is fractional than the driving frequency, a phenomenon that can be referred to as fractional dynamic localization

Dual role of an ac driving force and the underlying two distinct order–disorder transitions in the vortex phase diagram of Ca3Ir4Sn13

International Nuclear Information System (INIS)

Kumar, Santosh; Singh, Ravi P.; Thamizhavel, A.; Tomy, C.V.; Grover, A.K.

2014-01-01

Highlights: • This work pertains to new findings related to a broad SMP anomaly. • Broad SMP prima facie encompasses two phase transformations in vortex matter. • We demarcated two phase boundaries pertaining to order–disorder transitions which have quasi first-order nature. - Abstract: We present distinct demarcation of the Bragg glass (BG) to multi-domain vortex glass (VG) transition line and the eventual amorphization of the VG phase in a weakly pinned single crystal of the superconducting compound Ca 3 Ir 4 Sn 13 on the basis of comprehension of the different yields about the second magnetization peak (SMP) anomaly in the dc magnetization and the corresponding anomalous feature in the ac susceptibility measurements. The shaking by a small ac magnetic field, inevitably present in the ac susceptibility measurements, is seen to result in contrasting responses in two different portions of the field-temperature (H, T) phase space of the multi-domain VG. In one of the portions, embracing the BG to VG transition across the onset of the SMP anomaly, the ac drive is surprisingly seen to assist the transformation of the well ordered BG phase to a lesser ordered VG phase. The BG phase exists as a superheated state over a small portion of the VG space and this attests to the first order nature of the BG to VG transition

Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer

Directory of Open Access Journals (Sweden)

Phuc Thinh Doan

2013-06-01

Full Text Available This paper develops a sensorless vector controlled method for AC induction motor using sliding-mode observer. For developing the control algorithm, modeling of AC induction motor is presented. After that, a sliding mode observer is proposed to estimate the motor speed, the rotor flux, the angular position of the rotor flux and the motor torque from monitored stator voltages and currents. The use of the nonlinear sliding mode observer provides very good performance for both low and high speed motor operation. Furthermore, the proposed system is robust in motor losses and load variations. The convergence of the proposed observer is obtained using the Lyapunov theory. Hardware and software for simulation and experiment of the AC induction motor drive are introduced. The hardware consists of a 1.5kw AC induction motor connected in series with a torque sensor and a powder brake. A controller is developed based on DSP TMS320F28355. The simulation and experimental results illustrate that fast torque and speed response with small torque ripples can be achieved. The proposed control scheme is suitable to the application fields that require high performance of torque response such as electric vehicles. doi:http://dx.doi.org/10.12777/ijse.4.2.2013.39-43 [How to cite this article: Doan, P. T., Nguyen, T. T., Jeong, S. K., Oh, S. J., & Kim, S. B. (2013. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer. INTERNATIONAL JOURNAL OF SCIENCE AND ENGINEERING, 4(2, 39-43; doi: http://dx.doi.org/10.12777/ijse.4.2.2013.39-43

HIL Simulation of Power Electronics and Electric Drives for Automotive Applications

OpenAIRE

Frank Puschmann; Axel Kiffe; Thomas Schulte

2012-01-01

Hardware-in-the-loop simulation is today a standard method for testing electronic equipment in the automotive industry. Since electric drives and power electronic devices are more and more important in automotive applications, these kinds of systems have to be integrated into the hardware-in-the-loop simulation. Power converters and electric drives are used in many different applications in vehicles today (hybrid electric or electric powertrain, electric steering systems, DC-DC converters, et...

AC/ARNG Integrated Division Concept Study, Main Report, Volume 1

National Research Council Canada - National Science Library

Twohig, John

1997-01-01

...) division headquarters. The US Army Training and Doctrine Command (TRADOC) was tasked to conduct a viability assessment of the AC/ARNG Integrated Division concept and focus on merits and implementation issues...

Experimental study on the scram of electromagnetic movable coil control rod drive mechanism

International Nuclear Information System (INIS)

Sun Changlong; Bo Hanliang; Jiang Shengyao; Zhang Hongchao; Ma Cang; Wang Jinhua; Qin Benke

2006-01-01

Electromagnetic movable coil control rod drive mechanism is a new type drive mechanism. The drive mechanism is experimentally studied to gain the characteristic of scram time. Further more, the reason of the different scram phenomena is analyzed and the disciplinarian of scram is also summarized. On the base of series experiments it can be concluded that scram time of AC break is longer than that of DC break and the residual current of coil's can distinctly influence the scram time. The scram time of AC break is 300-700 ms longer than that of DC break. (authors)

Introduction to AC machine design

CERN Document Server

Lipo, Thomas A

2018-01-01

AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

Loss minimization control and efficiency determination of electric drives in traction applications

Energy Technology Data Exchange (ETDEWEB)

Windisch, Thomas; Hofmann, Wilfried [Technische Univ. Dresden (Germany). Lehrstuhl fuer Elektrische Maschinen und Antriebe

2012-11-01

High-power electric drives in automotive traction applications consume a large part of the disposable electric energy. For this reason the energy efficiency of the drives is of great importance for range and fuel consumption of the hybrid electric vehicle. The paper describes two possible drives with different electric motors from a control point of view. The electric power losses in the drive system are determined depending on the operating point of the machine. With these loss characteristics the control of the drives is optimized to produce minimal losses. Finally the energy efficiency for a realistic urban bus drive cycle is calculated to compare the two types. (orig.)

AC/RF Superconductivity

Energy Technology Data Exchange (ETDEWEB)

Ciovati, G [Jefferson Lab (United States)

2014-07-01

This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

AC/RF Superconductivity

Energy Technology Data Exchange (ETDEWEB)

Ciovati, Gianluigi [JLAB

2015-02-01

This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

A Comprehensive Review of Permanent Magnet Transverse Flux Machines for Direct Drive Applications

Energy Technology Data Exchange (ETDEWEB)

Muljadi, Eduard [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Husain, Tausif [University of Akron; Hasan, Iftekhar [University of Akron; Sozer, Yilmaz [University of Akron; Husain, Iqbal [North Carolina State University

2017-11-07

The use of direct drive machines in renewable and industrial applications are increasing at a rapid rate. Transverse flux machines (TFM) are ideally suited for direct drive applications due to their high torque density. In this paper, a comprehensive review of the permanent magnet (PM) TFMs for direct drive applications is presented. The paper introduces TFMs and their operating principle and then reviews the different type of TFMs proposed in the literature. The TFMs are categorized according to the number of stator sides, types of stator cores and magnet arrangement in the rotor. The review covers different design topologies, materials used for manufacturing, structural and thermal analysis, modeling and design optimization and cogging torque minimization in TFMs. The paper also reviews various applications and comparisons for TFMs that have been presented in the literature.

Electric drive motors for industrial robots

Science.gov (United States)

Fichtner, K.

1985-04-01

In robotized industrial plants it is possible to use electric motors in the technological process and also for control, assembly, transport, testing, and measurements. Particularly suitable for these applications are permanent-magnet d.c. motors. A new special series was developed for industrial robots with hinge joints in kinematic pairs. The complete drive includes thyristors or transistor controls with regulators and, if necessary, a line transformer as well as a servomotor with tachometer and odometer for speed, current, and position control. The drive is coupled to a robot tong through mechanical torque and force converters. In addition to a 0 to 4000 rpm speed regulation, without wobble at low speeds, and a high torque-to-weight ratio for repetitive short-time heavy duty, these low-inertia motors develop high starting and accelerating torques over the entire speed range. They operate from a 1 to O 220 V a.c. line through a rectifier. The motors are totally enclosed, or of open construction for better ventilation. Their windings have class F insulation for operation at ambient temperatures up to 40 C.

Ac-driven vortex-antivortex dynamics in nanostructured superconductor-ferromagnetic hybrids

Energy Technology Data Exchange (ETDEWEB)

Lima, Clessio L.S., E-mail: clsl@df.ufpe.br [Nucleo de Tecnologia, Centro Academico do Agreste, Universidade Federal de Pernambuco, 55002-970 Caruaru-PE (Brazil); Souza Silva, Clecio C. de; Aguiar, J. Albino [Departamento de Fisica, Universidade Federal de Pernambuco, 50670-901 Recife-PE (Brazil)

2012-09-15

The dynamics of ac-driven vortices and antivortices in a superconducting film interacting with an array of magnetic dipoles on top is investigated via hybrid molecular dynamics-Monte Carlo simulations. The dipole array considered in this study is capable to stabilize in equilibrium vortex-antivortex pairs. The appearance of a net electric field out of the ac excitation demonstrates that this system behaves as a voltage rectifier. Because of the asymmetric nature of the effective pinning potential generated by the dipole array, the ac-driven vortices and antivortices are ratcheted in opposite directions, thereby contributing additively to the observed net voltage. In addition, for high frequency values, the dc electric field-ac amplitude curves present a series of steps. A careful analysis of the time series of the electric field and number of vortex-antivortex (v-av) pairs reveals that these steps are related to mode-locking between the drive frequency and the number of v-av creation-annihilation events.

AC and DC electrical properties of graphene nanoplatelets reinforced epoxy syntactic foam

Science.gov (United States)

Zegeye, Ephraim; Wicker, Scott; Woldesenbet, Eyassu

2018-04-01

Benefits of employing graphene nanopletlates (GNPLs) in composite structures include mechanical as well as multifunctional properties. Understanding the impedance behavior of GNPLs reinforced syntactic foams may open new applications for syntactic foam composites. In this work, GNPLs reinforced syntactic foams were fabricated and tested for DC and AC electrical properties. Four sets of syntactic foam samples containing 0, 0.1, 0.3, and 0.5 vol% of GNPLs were fabricated and tested. Significant increase in conductivity of syntactic foams due to the addition of GNPLs was noted. AC impedance measurements indicated that the GNPLs syntactic foams become frequency dependent as the volume fraction of GNPLs increases. With addition of GNPLs, the characteristic of the syntactic foams are also observed to transition from dominant capacitive to dominant resistive behavior. This work was carried out at Southern University, Mechanical Engineering Department, Baton Rouge, LA 70802, United States of America.

Drinking & driving in Viet Nam: prevalence, knowledge, attitudes, and practices in two provinces.

Science.gov (United States)

Bachani, Abdulgafoor M; Jessani, Nasreen S; Pham, V Cuong; Quang, La Ngoc; Nguyen, Phuong N; Passmore, Jonathon; Hyder, Adnan A

2013-12-01

Viet Nam is experiencing a shift in its burden of disease profile with injuries becoming more prominent. A history of high alcohol involvement in road traffic crashes despite stringent laws led to increased enforcement by police, enhanced public education messaging and targeted social marketing campaigns in Ha Nam and Ninh Binh provinces in Viet Nam. This study aims to illustrate the changes in prevalence (November 2010 to December 2011) and knowledge, attitudes and practices (KAP) around alcohol use and drink-driving for the year 2011. Breath Alcohol Concentration (BrAC) was collected through police enforcement checkpoints in the two provinces. The proportion of drivers with BrAC above the legal limit was plotted over time for both provinces. The trend in prevalence of drink-driving over time was further assessed using Poisson regression models. Prevailing KAPs were determined through surveying randomly selected road users over the age of 17 years at gas stations at quarterly intervals. Cross tabulations of key variables as well Chi-Square statistic were used to assess associations. A total of 8,404 drivers were tested for BrAC levels of which less than 0.25% were female. Of 1,639 drivers displaying BrAC levels in excess of the legal limit, 87.3% were car drivers, 7.9% motorcyclists and 86% were between the ages of 25 and 44 years. KAP surveys captured 1,661 drivers over the study period. The prevalence of self-reported drink-driving increased 6 percentage points among respondents aged 27-36. Between 44% (January 2011) and 49% (December 2011) of respondents indicated awareness of a drinking and driving Blood Alcohol Concentration (BAC) or BrAC limit and only 25% of all study participants recalled being penalized for a traffic violation - none of which were for drink-driving. While there has been some reduction in drink-driving prevalence, inadequate or incorrect knowledge on drink-driving legislation appears to be an impediment to greater gains. Increased

Nb46, 5wt% Ti Eb-melting for AC and DC superconducting applications

International Nuclear Information System (INIS)

Bormio, C.; Ramos, M.J.; Pinatti, D.G.

1990-01-01

This paper reports on the superconductor alloy Nb46, 5wt % Ti which presents the best superconducting and mechanical properties for the systems Nb-Ti. The greatest difficulty in obtaining this alloy is related to the difference between the raw materials melting temperatures, which is about 700 degrees C. As a result the alloy homogeneity as well as Ti desired content, turn to be hard to control. The authors choose an electrode sandwich type, where Nb and Ti sheets are interposed. The electrode dimensions calculation is based on the Ti evaporation rate, energy balance and superficial tension of liquid titanium between Nb sheets. The ingots were electron beam melted. Herein, we present the following ingot results: Ti, intersticial and trace contents compared to international manufactures as well as its mechanical workability. This alloy will be used in NbTi wire production for AC and DC applications. The AC and DC wires are produced by coswaging and codrawing of NbTi bars and C u Ni-tubes for AC wires and Cu-tubes for DC wires. High area reductions of about 2 x 10 8 are reached without intermediate heat treatment, and they are essential since they are precursors of collective pinning centers, responsible for high critical current densities

Control of parallel-connected bidirectional AC-DC converters in stationary frame for microgrid application

DEFF Research Database (Denmark)

Lu, Xiaonan; Guerrero, Josep M.; Teodorescu, Remus

2011-01-01

With the penetration of renewable energy in modern power system, microgrid has become a popular application worldwide. In this paper, parallel-connected bidirectional converters for AC and DC hybrid microgrid application are proposed as an efficient interface. To reach the goal of bidirectional...... power conversion, both rectifier and inverter modes are analyzed. In order to achieve high performance operation, hierarchical control system is accomplished. The control system is designed in stationary frame, with harmonic compensation in parallel and no coupled terms between axes. In this control...

Normal form of particle motion under the influence of an ac dipole

Directory of Open Access Journals (Sweden)

R. Tomás

2002-05-01

Full Text Available ac dipoles in accelerators are used to excite coherent betatron oscillations at a drive frequency close to the tune. These beam oscillations may last arbitrarily long and, in principle, there is no significant emittance growth if the ac dipole is adiabatically turned on and off. Therefore the ac dipole seems to be an adequate tool for nonlinear diagnostics provided the particle motion is well described in the presence of the ac dipole and nonlinearities. Normal forms and Lie algebra are powerful tools to study the nonlinear content of an accelerator lattice. In this article a way to obtain the normal form of the Hamiltonian of an accelerator with an ac dipole is described. The particle motion to first order in the nonlinearities is derived using Lie algebra techniques. The dependence of the Hamiltonian terms on the longitudinal coordinate is studied showing that they vary differently depending on the ac dipole parameters. The relation is given between the lines of the Fourier spectrum of the turn-by-turn motion and the Hamiltonian terms.

75 FR 63476 - Ocean Transportation Intermediary License; Applicants

Science.gov (United States)

2010-10-15

.... David A. Knott dba DAK Logistics Services (NVO), 1010 Bluejay Drive, Suisun City, CA 94585. Officer... Office of Transportation Intermediaries, Federal Maritime Commission, Washington, DC 20573. ACS Logistics.... Application Type: QI Change. Archer Logistics USA LLC (NVO), 6051 Kennedy Boulevard East, PhB, West New York...

Effect of the valence electron concentration on the bulk modulus and chemical bonding in Ta2AC and Zr2AC (A=Al, Si, and P)

International Nuclear Information System (INIS)

Schneider, Jochen M.; Music, Denis; Sun Zhimei

2005-01-01

We have studied the effect of the valence electron concentration, on the bulk modulus and the chemical bonding in Ta 2 AC and Zr 2 AC (A=Al, Si, and P) by means of ab initio calculations. Our equilibrium volume and the hexagonal ratio (c/a) agree well (within 2.7% and 1.2%, respectively) with previously published experimental data for Ta 2 AlC. The bulk moduli of both Ta 2 AC and Zr 2 AC increase as Al is substituted with Si and P by 13.1% and 20.1%, respectively. This can be understood since the substitution is associated with an increased valence electron concentration, resulting in band filling and an extensive increase in cohesion

Dual role of an ac driving force and the underlying two distinct order–disorder transitions in the vortex phase diagram of Ca{sub 3}Ir{sub 4}Sn{sub 13}

Energy Technology Data Exchange (ETDEWEB)

Kumar, Santosh, E-mail: santoshkumar@phy.iitb.ac.in [Department of Physics, Indian Institute of Technology Bombay, Mumbai 400076 (India); Singh, Ravi P.; Thamizhavel, A. [Department of Condensed Matter Physics and Materials Science, Tata Institute of Fundamental Research, Mumbai 400005 (India); Tomy, C.V., E-mail: tomy@phy.iitb.ac.in [Department of Physics, Indian Institute of Technology Bombay, Mumbai 400076 (India); Grover, A.K. [Department of Condensed Matter Physics and Materials Science, Tata Institute of Fundamental Research, Mumbai 400005 (India); Department of Physics, Panjab University, Chandigarh 160014 (India)

2014-11-15

Highlights: • This work pertains to new findings related to a broad SMP anomaly. • Broad SMP prima facie encompasses two phase transformations in vortex matter. • We demarcated two phase boundaries pertaining to order–disorder transitions which have quasi first-order nature. - Abstract: We present distinct demarcation of the Bragg glass (BG) to multi-domain vortex glass (VG) transition line and the eventual amorphization of the VG phase in a weakly pinned single crystal of the superconducting compound Ca{sub 3}Ir{sub 4}Sn{sub 13} on the basis of comprehension of the different yields about the second magnetization peak (SMP) anomaly in the dc magnetization and the corresponding anomalous feature in the ac susceptibility measurements. The shaking by a small ac magnetic field, inevitably present in the ac susceptibility measurements, is seen to result in contrasting responses in two different portions of the field-temperature (H, T) phase space of the multi-domain VG. In one of the portions, embracing the BG to VG transition across the onset of the SMP anomaly, the ac drive is surprisingly seen to assist the transformation of the well ordered BG phase to a lesser ordered VG phase. The BG phase exists as a superheated state over a small portion of the VG space and this attests to the first order nature of the BG to VG transition.

Hybrid Switch Reluctance Drives For Pump Applications

DEFF Research Database (Denmark)

Jakobsen, Uffe

be the single phase hybrid switched reluctance motor (HSRM). Due to the simple construction of the single phase HSRM, manufacturing may be simplified compared to a three phase permanent magnet motor and consumption of copper may be lowered when compared to both the induction motor and some three phase permanent...... magnet synchronous motor (PMSM), the HSRM needs information about rotor position to be properly controlled. For BLDC, PMSM, induction motors, and the normal SRM position sensorless methods are relatively well established and have been used for some time. For the single phase switched reluctance motor......The initial research problem is to investigate an alternative motor drive to the existing permanent magnet synchronous and brushless DC-motor drives for pump applications. A review of different motor types showed that a possible candidate for another low cost permanent magnet motor may...

Smartphone Based Application For Driving Directions With Restaurants On The Way

Directory of Open Access Journals (Sweden)

Anup Badhe

2015-08-01

Full Text Available Everyday lot of people take a road trip to travel between two points. Each road trip involves driving directions provided in some form by many applications but an essential component to that is food which is sadly missing from all of those. The proposed system tries to encompass the food element into driving directions based on the drivers food preferences

Electrical drives for direct drive renewable energy systems

CERN Document Server

Mueller, Markus

2013-01-01

Wind turbine gearboxes present major reliability issues, leading to great interest in the current development of gearless direct-drive wind energy systems. Offering high reliability, high efficiency and low maintenance, developments in these direct-drive systems point the way to the next generation of wind power, and Electrical drives for direct drive renewable energy systems is an authoritative guide to their design, development and operation. Part one outlines electrical drive technology, beginning with an overview of electrical generators for direct drive systems. Principles of electrical design for permanent magnet generators are discussed, followed by electrical, thermal and structural generator design and systems integration. A review of power electronic converter technology and power electronic converter systems for direct drive renewable energy applications is then conducted. Part two then focuses on wind and marine applications, beginning with a commercial overview of wind turbine drive systems and a...

The effect of ac-driven force on superlubricity in a two-dimensional Frenkel-Kontorova model

International Nuclear Information System (INIS)

Lin Maimai

2010-01-01

By using the molecular dynamic simulation method with a fourth-order Runge-Kutta algorithm, a two-dimensional dc- and ac-driven Frenkel-Kontorova model with a square symmetry substrate potential for a square lattice layer has been investigated in this paper. For this system, the effects of many different parameters on the static friction force have been studied in detail. It was found that not only the amplitude and frequency of the ac-driven force, but also the direction of dc- and ac-driven forces and the misfit angle between two layers have a strong influence on the static friction force. This indicated that the phenomenon of superlubricity appears easily with larger ac amplitude and smaller ac frequency for some special direction of the external driving force and misfit angle.

Using variable speed drives technology to reap rewards of efficient HVAC design

International Nuclear Information System (INIS)

Anon.

1999-01-01

Electric motors are continuously running at full speed with vanes and throttles used to modulate the output, in most HVAC applications. This results in an excessive wastage of electrical energy, and the solution is the variable speed drive, which can save vast amounts of energy in fans, pumps and compressors across the HVAC system. Users of traditional control methods will not benefit from the energy savings that are possible through variable speed drives because the motor speed remains the same, with the result that some, and in some cases most, of the energy drawn will be wasted. Variable speed drives are more efficient because they control output by regulating the motor speed, rather than run the motor at full speed and use restrictions to reduce the flow. Recently, small so-called micro-drives have been launched, cutting the cost for most variable speed operation. Variable speed motors can also introduce new features to the HVAC system. An example of how drives can save money and improve the indoor climate is cited for Heathrow airport. There, the gateroom was earlier controlled by modulating valves in both heater and cooler coils, with two fans that operated continuously at rated speed. This system was very inefficient because the occupancy of the gateroom varied between zero and maximum several times daily. A new system was installed using two AC drives, in which one drive controls the supply air fan and the other the return air fan. The energy savings amounted to 89% during two tests and 77% in a third. A pump installation in the district heating system of Strasbourg, Germany, showed the savings that are possible in pump applications

An AMOLED AC-Biased Pixel Design Compensating the Threshold Voltage and I-R Drop

Directory of Open Access Journals (Sweden)

Ching-Lin Fan

2011-01-01

Full Text Available We propose a novel pixel design and an AC bias driving method for active-matrix organic light-emitting diode (AM-OLED displays using low-temperature polycrystalline silicon thin-film transistors (LTPS-TFTs. The proposed threshold voltage and I-R drop compensation circuit, which comprised three transistors and one capacitor, have been verified to supply uniform output current by simulation work using the Automatic Integrated Circuit Modeling Simulation Program with Integrated Circuit Emphasis (AIM-SPICE simulator. The simulated results demonstrate excellent properties such as low error rate of OLED anode voltage variation (<0.7% and low voltage drop of VDD power line. The proposed pixel circuit effectively enables threshold-voltage-deviation correction of driving TFT and compensates for the voltage drop of VDD power line using AC bias on OLED cathode.

Non-Federal Participation in AC Intertie : Final Environmental Impact Statement. Volume 1: Environmental Analysis.

Energy Technology Data Exchange (ETDEWEB)

United States. Bonneville Power Administration.

1994-01-01

Bonneville Power Administration (BPA) is considering action in two areas: (1) non-Federal access to the AC Intertie, and, (2) BPA Intertie marketing. BPA`s preferred alternative for non-Federal access is the Capacity Ownership alternative combined with the Increased Assured Delivery -- Access for Non-Scheduling Utilities alternative; the preferred alternative for BPA Intertie marketing is the Federal Marketing and Joint Ventures alternative. BPA considered these two areas previously in its Intertie Development and Use EIS of April 1988. The EIS resulted in BPA decisions to participate in the construction of the Third AC Intertie, to allow non-Federal access to BPA`s share of the Pacific Northwest-Pacific Southwest (PNW-PSW) Intertie (AC and DC lines) pursuant to a Long-Term Intertie Access Policy (LTIAP), and to pursue BPA`s export marketing alternative. The decision on allowing direct financial non-Federal participation in the Third AC line was deferred to a later, separate process, examined here. Also, BPA`s export marketing objectives must now be examined in view of changed operations of Columbia River hydro facilities for improved fish survival.

Examination of breath alcohol concentration (BrAC) levels, alcohol use disorders identification test (AUDIT-C) classification, and intended plans for getting home among bar-attending college students.

Science.gov (United States)

Martin, Ryan J; Chaney, Beth H; Cremeens-Matthews, Jennifer

2015-06-01

The college student population is one of the heaviest drinking demographic groups in the US and impaired driving is a serious alcohol-related problem. The objective of this study is to better understand the relationship between alcohol-related behaviors and "plans to get home" among a sample of college students. We conducted four anonymous field studies to examine associations between breath alcohol concentration (BrAC) levels, Alcohol Use Disorders Identification Test (AUDIT-C) classification, and plans for getting home among a sample of bar-attending college students (N = 713). The vast majority of participants in our sample (approximately 95%) were not intending to drive and the average BrAC% of those intending to drive was .041. Our one-way ANOVAs indicated that (1) participants classified by the AUDIT-C as not having an alcohol problem had a significantly lower BrAC% than those classified as having a potential problem and (2) participants planning to drive had a significantly lower BrAC% than those with a plan that did not involve them driving and those without a plan to get home. Although it is encouraging that most of our sample was not intending to drive, it is important to continue to attempt to reduce impaired driving in this population. This study helps college health professionals and administrators to better understand the relationship between alcohol-related behaviors and plans to get home among college students. © American Academy of Addiction Psychiatry.

Power electronic converter systems for direct drive renewable energy applications

DEFF Research Database (Denmark)

Chen, Zhe

2013-01-01

This chapter presents power electronic conversion systems for wind and marine energy generation applications, in particular, direct drive generator energy conversion systems. Various topologies are presented and system design optimization and reliability are briefly discussed....

Circuit for Driving Piezoelectric Transducers

Science.gov (United States)

Randall, David P.; Chapsky, Jacob

2009-01-01

The figure schematically depicts an oscillator circuit for driving a piezoelectric transducer to excite vibrations in a mechanical structure. The circuit was designed and built to satisfy application-specific requirements to drive a selected one of 16 such transducers at a regulated amplitude and frequency chosen to optimize the amount of work performed by the transducer and to compensate for both (1) temporal variations of the resonance frequency and damping time of each transducer and (2) initially unknown differences among the resonance frequencies and damping times of different transducers. In other words, the circuit is designed to adjust itself to optimize the performance of whichever transducer is selected at any given time. The basic design concept may be adaptable to other applications that involve the use of piezoelectric transducers in ultrasonic cleaners and other apparatuses in which high-frequency mechanical drives are utilized. This circuit includes three resistor-capacitor networks that, together with the selected piezoelectric transducer, constitute a band-pass filter having a peak response at a frequency of about 2 kHz, which is approximately the resonance frequency of the piezoelectric transducers. Gain for generating oscillations is provided by a power hybrid operational amplifier (U1). A junction field-effect transistor (Q1) in combination with a resistor (R4) is used as a voltage-variable resistor to control the magnitude of the oscillation. The voltage-variable resistor is part of a feedback control loop: Part of the output of the oscillator is rectified and filtered for use as a slow negative feedback to the gate of Q1 to keep the output amplitude constant. The response of this control loop is much slower than 2 kHz and, therefore, does not introduce significant distortion of the oscillator output, which is a fairly clean sine wave. The positive AC feedback needed to sustain oscillations is derived from sampling the current through the

A new method for measuring the wall charge waveforms of AC PDP

International Nuclear Information System (INIS)

Liang Zhihu; Liu Zujun; Liu Chunliang

2004-01-01

A new method is developed to measure the wall charge waveforms in coplanar alternating current plasma display panel (AC PDP). In the method, two groups of display electrodes are selected from a coplanar AC PDP and two capacitors are respectively connected with these two groups of display electrodes in series, and a measuring circuit and a reference circuit are thus constructed. With the help of special processing, discharge takes place in the cells included in the measuring circuit under a normal drive voltage but no discharge takes place in the cells included in the reference circuit under a normal drive voltage. The wall charge waveforms are obtained from the voltage difference between the two capacitors. Using the method, the wall charge waveforms are measured during resetting period, addressing period and sustaining period for the 304.8 mm (12-inch) test PDP panel. The result shows that the wall voltage is about 96 V during the sustaining period. (authors)

Inverter Output Filter Effect on PWM Motor Drives of a Flywheel Energy Storage System

Science.gov (United States)

Santiago, Walter

2004-01-01

NASA Glenn Research Center (GRC) has been involved in the research and development of high speed flywheel systems for small satellite energy storage and attitude control applications. One research and development area has been the minimization of the switching noise produced by the pulsed width modulated (PWM) inverter that drives the flywheel permanent magnet motor/generator (PM M/G). This noise can interfere with the flywheel M/G hardware and the system avionics hampering the full speed performance of the flywheel system. One way to attenuate the inverter switching noise is by placing an AC filter at the three phase output terminals of the inverter with the filter neutral point connected to the DC link (DC bus) midpoint capacitors. The main benefit of using an AC filter in this fashion is the significant reduction of the inverter s high dv/dt switching and its harmonics components. Additionally, common mode (CM) and differential mode (DM) voltages caused by the inverter s high dv/dt switching are also reduced. Several topologies of AC filters have been implemented and compared. One AC filter topology consists of a two-stage R-L-C low pass filter. The other topology consists of the same two-stage R-L-C low pass filter with a series connected trap filter (an inductor and capacitor connected in parallel). This paper presents the analysis, design and experimental results of these AC filter topologies and the comparison between the no filter case and conventional AC filter.

An experimental result of estimating an application volume by machine learning techniques.

Science.gov (United States)

Hasegawa, Tatsuhito; Koshino, Makoto; Kimura, Haruhiko

2015-01-01

In this study, we improved the usability of smartphones by automating a user's operations. We developed an intelligent system using machine learning techniques that periodically detects a user's context on a smartphone. We selected the Android operating system because it has the largest market share and highest flexibility of its development environment. In this paper, we describe an application that automatically adjusts application volume. Adjusting the volume can be easily forgotten because users need to push the volume buttons to alter the volume depending on the given situation. Therefore, we developed an application that automatically adjusts the volume based on learned user settings. Application volume can be set differently from ringtone volume on Android devices, and these volume settings are associated with each specific application including games. Our application records a user's location, the volume setting, the foreground application name and other such attributes as learning data, thereby estimating whether the volume should be adjusted using machine learning techniques via Weka.

Fundamentals of electrical drives

CERN Document Server

Veltman, André; De Doncker, Rik W

2007-01-01

Provides a comprehensive introduction to various aspects of electrical drive systems. This volume provides a presentation of dynamic generic models that cover all major electrical machine types and modulation/control components of a drive as well as dynamic and steady state analysis of transformers and electrical machines.

Adjustable-Speed Single-Phase IM Drive with Reduced Number of Switches

Czech Academy of Sciences Publication Activity Database

Chomát, Miroslav; Lipo, T. A.

2003-01-01

Roč. 39, č. 3 (2003), s. 819-825 ISSN 0093-9994 R&D Projects: GA ČR GA102/02/0554 Grant - others:National Science Foundation(US) GA9820434 Institutional research plan: CEZ:AV0Z2057903 Keywords : AC motor drives * converters * induction motor drives Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.783, year: 2003

Advantages of Square-Root Extended Kalman Filter for Sensorless Control of AC Drives

Czech Academy of Sciences Publication Activity Database

Šmídl, Václav; Peroutka, Z.

2012-01-01

Roč. 59, č. 11 (2012), s. 4189-4196 ISSN 0278-0046 Institutional research plan: CEZ:AV0Z10750506 Institutional support: RVO:67985556 Keywords : Kalman filters * Mathematical model * AC motors Subject RIV: BC - Control Systems Theory Impact factor: 5.165, year: 2012 http://library.utia.cas.cz/separaty/2012/AS/smidl-0436868.pdf

Advanced Microsystems for Automotive Applications 2015 : Smart Systems for Green and Automated Driving

CERN Document Server

Müller, Beate; Meyer, Gereon

2016-01-01

This edited volume presents the proceedings of the AMAA 2015 conference, Berlin, Germany. The topical focus of the 2015 conference lies on smart systems for green and automated driving. The automobile of the future has to respond to two major trends, the electrification of the drivetrain, and the automation of the transportation system. These trends will not only lead to greener and safer driving but re-define the concept of the car completely, particularly if they interact with each other in a synergetic way as for autonomous parking and charging, self-driving shuttles or mobile robots. Key functionalities like environment perception are enabled by electronic components and systems, sensors and actuators, communication nodes, cognitive systems and smart systems integration. The book will be a valuable read for research experts and professionals in the automotive industry but the book may also be beneficial for graduate students.

A novel five-level optimized carrier multilevel PWM quad-inverter six-phase AC drive

DEFF Research Database (Denmark)

Sanjeevikumar, P.; Blaabjerg, F.; Wheeler, Pat

2016-01-01

A novel single carrier pulse-width modulation (PWM) for a new quad-inverter configuration for multilevel six-phase asymmetrical open-winding ac converter is proposed in this article. Modularity of the circuit consist of four standard two-level voltage source inverters (VSIs) with slight modificat......A novel single carrier pulse-width modulation (PWM) for a new quad-inverter configuration for multilevel six-phase asymmetrical open-winding ac converter is proposed in this article. Modularity of the circuit consist of four standard two-level voltage source inverters (VSIs) with slight...... modifications, i.e. one additional bi-direction switch (MOSFET/IGBT) in each phase and a link to neutral with two capacitors to generate increased output levels. Furthermore, original optimal single carrier zero-shifted five-level modulation (SCZSFM) algorithm is developed for each VSI to behave as equivalent...

An AC Resistance Optimization Method Applicable for Inductor and Transformer Windings with Full Layers and Partial Layers

DEFF Research Database (Denmark)

Shen, Zhan; Li, Zhiguang; Jin, Long

2017-01-01

This paper proposes an ac resistance optimization method applicable for both inductor and transformer windings with full layers and partial layers. The proposed method treats the number of layers of the windings as a design variable instead of as a predefined parameter, compared to existing methods...

Deep gray matter volume loss drives disability worsening in multiple sclerosis

Science.gov (United States)

Prados, Ferran; Brownlee, Wallace J.; Altmann, Daniel R.; Tur, Carmen; Cardoso, M. Jorge; De Angelis, Floriana; van de Pavert, Steven H.; Cawley, Niamh; De Stefano, Nicola; Stromillo, M. Laura; Battaglini, Marco; Ruggieri, Serena; Gasperini, Claudio; Filippi, Massimo; Rocca, Maria A.; Rovira, Alex; Sastre‐Garriga, Jaume; Vrenken, Hugo; Leurs, Cyra E.; Killestein, Joep; Pirpamer, Lukas; Enzinger, Christian; Ourselin, Sebastien; Wheeler‐Kingshott, Claudia A.M. Gandini; Chard, Declan; Thompson, Alan J.; Alexander, Daniel C.; Barkhof, Frederik; Ciccarelli, Olga

2018-01-01

with disability accumulation (beta = 0.04; p < 0.001). Interpretation This large, multicenter and longitudinal study shows that DGM volume loss drives disability accumulation in MS, and that temporal cortical GM shows accelerated atrophy in SPMS than RRMS. The difference in regional GM atrophy development between phenotypes needs to be taken into account when evaluating treatment effect of therapeutic interventions. Ann Neurol 2018;83:210–222 PMID:29331092

AFFECTIVE COMPUTING AND AUGMENTED REALITY FOR CAR DRIVING SIMULATORS

Directory of Open Access Journals (Sweden)

Dragoș Datcu

2017-12-01

Full Text Available Car simulators are essential for training and for analyzing the behavior, the responses and the performance of the driver. Augmented Reality (AR is the technology that enables virtual images to be overlaid on views of the real world. Affective Computing (AC is the technology that helps reading emotions by means of computer systems, by analyzing body gestures, facial expressions, speech and physiological signals. The key aspect of the research relies on investigating novel interfaces that help building situational awareness and emotional awareness, to enable affect-driven remote collaboration in AR for car driving simulators. The problem addressed relates to the question about how to build situational awareness (using AR technology and emotional awareness (by AC technology, and how to integrate these two distinct technologies [4], into a unique affective framework for training, in a car driving simulator.

Alternating-Current Motor Drive for Electric Vehicles

Science.gov (United States)

Krauthamer, S.; Rippel, W. E.

1982-01-01

New electric drive controls speed of a polyphase as motor by varying frequency of inverter output. Closed-loop current-sensing circuit automatically adjusts frequency of voltage-controlled oscillator that controls inverter frequency, to limit starting and accelerating surges. Efficient inverter and ac motor would give electric vehicles extra miles per battery charge.

Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

International Nuclear Information System (INIS)

Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

1997-01-01

The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

The Thermodynamics of Drunk Driving

Science.gov (United States)

Thompson, Robert Q.

1997-05-01

Chemical and instrumental tests for driving under the influence of alcohol (DUI) measure the concentration of ethanol in the breath (BrAC), while state DUI laws are described in terms of blood alcohol concentration (BAC). Consequently, accurate and fair conversion from BrAC to BAC is crucial to the judicial process. Theoretical treatment of the water-air-ethanol equilibrium system and the related blood-breath-ethanol system, based on principles from general chemistry and biology, yields an equation relating the ratio of BAC to BrAC to the absolute temperature of the breath, the fraction of water in the blood, and the enthalpy and entropy of vaporization of ethanol from aqueous solution. The model equation predicts an average value for the ratio of 2350+100, not significantly different from reported experimental values. An exponential temperature dependence is predicted and has been confirmed experimentally as well. Biological, chemical, and instrumental variables are described along with their contributions to the overall uncertainty in the value of BrAC/BAC. While the forensic science community uses, and debates, a fixed ratio of 2100, the theoretical model suggests that a value of 1880 should be used to reduce the fraction of false positives to <1%.

The decay properties of the trapped magnetic field in HTS bulk superconducting actuator by AC controlled magnetic field

International Nuclear Information System (INIS)

Kim, S.B.; Uwani, Y.; Joo, J.H.; Kawamoto, R.; Jo, Y.S.

2011-01-01

The electric device applications of a high temperature superconducting (HTS) bulk magnet, having stable levitation and suspension properties according to their strong flux pinning force, have been proposed and developed. We have been investigating a three-dimensional (3-D) superconducting actuator using HTS bulks to develop a non-contract transportation device which moves freely in space. It is certain for our proposed 3-D superconducting actuator to be useful as a transporter used in a clean room where silicon wafers, which do not like mechanical contact and dust, are manufactured. The proposed actuator consists of the trapped HTS bulk as a mover and two-dimensionally arranged electromagnets as a stator. Up to now, the electromagnets consisted with iron core and copper coil were used as a stator, and each electromagnet was individually controlled using DC power supplies. In our previous work, the unstable movement characteristics of HTS bulk were observed under the DC operation, and the AC electromagnets driven with AC controlled current was proposed to solve these problems. In general, the trapped magnetic field in HTS bulk was decayed by a time-varying external magnetic field. Thus, it needs to optimize the shapes of AC electromagnets and operating patterns, the decay properties of the trapped magnetic field in the HTS bulk mover by the AC magnetic field should be cleared. In this paper, the influences of the frequency, the overall operating time, the strength of magnetization field and drive current against the decay of trapped magnetic field were experimentally studied using the fabricated AC electromagnets.

Introduction of hvdc transmission into a predominantly ac network

Energy Technology Data Exchange (ETDEWEB)

Casson, W; Last, F H; Huddart, K W

1966-02-01

Methods for reinforcing the supply network, including systems employing dc links, without introducing a new primary network are briefly described. The arrangement for dc links is outlined and the application to an existing ac system is considered. The economics of ac and dc for reinforcement schemes are briefly mentioned.

Composite Cu/Fe/MgB{sub 2} superconducting wires and MgB{sub 2}/YSZ/Hastelloy coated conductors for ac and dc applications

Energy Technology Data Exchange (ETDEWEB)

Glowacki, B A [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge (United Kingdom); Majoros, M [Interdisciplinary Research Centre in Superconductivity, University of Cambridge, Madingley Road, Cambridge (United Kingdom); Vickers, M [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge (United Kingdom); Eisterer, M [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Toenies, S [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Weber, H W [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Fukutomi, M [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan); Komori, K [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan); Togano, K [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan)

2003-02-01

We discuss the results of a study of MgB{sub 2} multifilamentary conductors and coated conductors from the point of view of their future dc and ac applications. The correlation between the slope of the irreversibility line induced by neutron irradiation defects and in situ structural imperfections and the critical temperature and critical current density is discussed with respect to the conductor performance and applicability. We debate the possible origin of the observed anomalous decrease of ac susceptibility at 50 K in copper clad in situ powder-in-tube MgB{sub 2} wires. Different conductor preparation methods and conductor architectures, and attainable critical current densities are presented. Some numerical results on critical currents, thermal stability and ac losses of future MgB{sub 2} multifilamentary and coated conductors with magnetic cladding of their filaments are also discussed.

Transport, shot noise, and topology in AC-driven dimer arrays

Science.gov (United States)

Niklas, Michael; Benito, Mónica; Kohler, Sigmund; Platero, Gloria

2016-11-01

We analyze an AC-driven dimer chain connected to a strongly biased electron source and drain. It turns out that the resulting transport exhibits fingerprints of topology. They are particularly visible in the driving-induced current suppression and the Fano factor. Thus, shot noise measurements provide a topological phase diagram as a function of the driving parameters. The observed phenomena can be explained physically by a mapping to an effective time-independent Hamiltonian and the emergence of edge states. Moreover, by considering quantum dissipation, we determine the requirements for the coherence properties in a possible experimental realization. For the computation of the zero-frequency noise, we develop an efficient method based on matrix-continued fractions.

Design method for marine direct drive volume control ahead actuator

Directory of Open Access Journals (Sweden)

WANG Haiyang

2018-02-01

Full Text Available [Objectives] In order to reduce the size, weight and auxiliary system configuration of marine ahead actuators, this paper proposes a kind of direct drive volume control electro-hydraulic servo ahead actuator. [Methods] The protruding and indenting control of the servo oil cylinder are realized through the forward and reverse of the bidirectional working gear pump, and the flow matching valve implements the self-locking of the ahead actuator in the target position. The mathematical model of the ahead actuator is established, and an integral separation fuzzy PID controller designed. On this basis, using AMESim software to build a simulation model of the ahead actuator, and combined with testing, this paper completes an analysis of the control strategy research and dynamic and static performance of the ahead actuator. [Results] The experimental results agree well with the simulation results and verify the feasibility of the ahead actuator's design. [Conclusions] The research results of this paper can provide valuable references for the integration and miniaturization design of marine ahead actuators.

Variable speed electrical driving systems; Entrainements electriques a vitesse variable

Energy Technology Data Exchange (ETDEWEB)

Bonal, J. [ESE, Promethee, Groupe Schneider (France)

1997-12-31

This book is the first of a series of 3 volumes which synthesize the most recent knowledge on variable speed electrical driving systems. It is devoted to electronic and electromechanical engineers and technicians and to manufacturers of electrical equipments involving such systems. after a recall of basic electrotechnical and mechanical notions, this book focusses on the functionalities and criteria of definition of driving systems, and shows the interactions between the different parts of these equipments. It develops a methodological approach of the choice for the most suitable technology with respect to the application under consideration. Various industrial sectors are concerned and a particular attention is paid to the driving of receptive turbo-machineries which play a major role in the energy balance sheet of the industrial electrical power force. (J.S.) 28 refs.

Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential

Science.gov (United States)

Frank, A.; Heller, R.; Goldacker, W.; Kling, A.; Schmidt, C.

2008-02-01

Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability.

Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential

International Nuclear Information System (INIS)

Frank, A; Heller, R; Goldacker, W; Kling, A; Schmidt, C

2008-01-01

Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability

Pemodelan Konverter AC – DC Tiga Fasa Dua Arah pada Sepeda Listrik Menggunakan Metode SPWM

OpenAIRE

Putri, Hellga Afdilah; Hamzah, Amir

2017-01-01

This study is aimed to design and analyze bidirectional converter three phase by using method SPWM on electric bike. This study discusses the three-phase inverter with Sine Pulse WidthModulation (SPWM) method as a three-phase induction motor drive and also the rectifier which has function to convert the AC voltage of the source of three-phase AC into DC voltage that ismodeled by using Matlab / Simulink. The purpose of this study is to get the design of the threephase inverter SPWM as a three-...

Variable speed drives boost air handler benefits

Energy Technology Data Exchange (ETDEWEB)

Twenty-four separate roof-top air handlers, controlled by variable speed ac motor drives, provide comfort and ventilation for employees at a 500,000 sq. ft. sportswear distribution center in southern Virginia. They were chosen over optional packaged HVAC units because of their flexibility, efficiency, and short payback advantages. The operation of the units is described.

Information driving force and its application in agent-based modeling

Science.gov (United States)

Chen, Ting-Ting; Zheng, Bo; Li, Yan; Jiang, Xiong-Fei

2018-04-01

Exploring the scientific impact of online big-data has attracted much attention of researchers from different fields in recent years. Complex financial systems are typical open systems profoundly influenced by the external information. Based on the large-scale data in the public media and stock markets, we first define an information driving force, and analyze how it affects the complex financial system. The information driving force is observed to be asymmetric in the bull and bear market states. As an application, we then propose an agent-based model driven by the information driving force. Especially, all the key parameters are determined from the empirical analysis rather than from statistical fitting of the simulation results. With our model, both the stationary properties and non-stationary dynamic behaviors are simulated. Considering the mean-field effect of the external information, we also propose a few-body model to simulate the financial market in the laboratory.

Methods, systems and apparatus for controlling operation of two alternating current (AC) machines

Science.gov (United States)

Gallegos-Lopez, Gabriel [Torrance, CA; Nagashima, James M [Cerritos, CA; Perisic, Milun [Torrance, CA; Hiti, Silva [Redondo Beach, CA

2012-02-14

A system is provided for controlling two AC machines. The system comprises a DC input voltage source that provides a DC input voltage, a voltage boost command control module (VBCCM), a five-phase PWM inverter module coupled to the two AC machines, and a boost converter coupled to the inverter module and the DC input voltage source. The boost converter is designed to supply a new DC input voltage to the inverter module having a value that is greater than or equal to a value of the DC input voltage. The VBCCM generates a boost command signal (BCS) based on modulation indexes from the two AC machines. The BCS controls the boost converter such that the boost converter generates the new DC input voltage in response to the BCS. When the two AC machines require additional voltage that exceeds the DC input voltage required to meet a combined target mechanical power required by the two AC machines, the BCS controls the boost converter to drive the new DC input voltage generated by the boost converter to a value greater than the DC input voltage.

Hybrid AC-High Voltage DC Grid Stability and Controls

Science.gov (United States)

Yu, Jicheng

The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient

Low-Cost Voltage Zero-Crossing Detector for AC-Grid Applications

Directory of Open Access Journals (Sweden)

Vorobyov Maxim

2014-10-01

Full Text Available Renewable energy sources and energy storage devices are becoming more popular. Some of them like small hydropower turbines, wind turbines and diesel generators produce AC voltage with different frequency and voltage than the main grid. For them power electronics converters are necessary. Power electronics converters presented in industry use two or three level energy conversion, although direct AC to AC converters exist, but one of the main problems is the switch commutation when current or voltage is crossing the zero point. Zero crossing sensors are used to solve this problem. They consist of current or voltage measurement unit and zero crossing detector. Different approaches are used for zero crossing: hardware or software. Hardware approach is simple but it has low precision. Software approach has high precision but it is complicated and expensive. In this paper a simple low cost high precision approach is presented. It takes all advantages from both approaches. While tested with two types of microcontrollers the precision of experimental measurement is 25 μs - 40 μs.

Study on ac losses of HTS coil carrying ac transport current

International Nuclear Information System (INIS)

Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan

2005-01-01

Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses

Multi-phase AC/AC step-down converter for distribution systems

Science.gov (United States)

Aeloiza, Eddy C.; Burgos, Rolando P.

2017-10-25

A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

Janus particle microshuttle: 1D directional self-propulsion modulated by AC electrical field

Directory of Open Access Journals (Sweden)

Jiliang Chen

2014-03-01

Full Text Available A catalytic Janus particle is capable of gaining energy from the surrounding fuel solution to drive itself to move continuously, which has an important impact in different fields, especially the field of micro-systems. However, the randomness of self-propulsion at the microscale restricts its use in practice. Achieving a directed self-propelled movement would greatly promote the application of the Janus particle. We proved experimentally that an AC electric field was an effective way to suppress Brownian motion and control the direction of self-propelled movement. The self-propulsion and dielectrophoretic response of a 2μm Janus particle were observed and the related basic data were collected. Interdigital electrodes, 20 μm in width, were energized in pulsed style to modulate the self-propulsion, which resulted in a shuttle-style motion in which a single Janus particle moved to and fro inside the strip electrode. The change of direction depends on its unique position: the catalyst side is always pointed outward and the orientation angle relative to the electrode is about 60°. Numerical simulation also proved that this position is reasonable. The present study could be beneficial with regard to self-propulsion and AC electrokinetics of the Janus particle.

Estimation of Transformer Parameters and Loss Analysis for High Voltage Capacitor Charging Application

DEFF Research Database (Denmark)

Thummala, Prasanth; Schneider, Henrik; Ouyang, Ziwei

2013-01-01

In a bi-directional DC-DC converter for capacitive charging application, the losses associated with the transformer makes it a critical component. In order to calculate the transformer losses, its parameters such as AC resistance, leakage inductance and self capacitance of the high voltage (HV......) winding has to be estimated accurately. This paper analyzes the following losses of bi-directional flyback converter namely switching loss, conduction loss, gate drive loss, transformer core loss, and snubber loss, etc. Iterative analysis of transformer parameters viz., AC resistance, leakage inductance...

Motion Planning in Dynamic Environments with Application to Self-Driving Vehicles

OpenAIRE

Schwesinger, Ulrich

2017-01-01

This thesis is concerned with the development of trajectory planning approaches targeting autonomous driving applications in dynamic environments shared with other traffic participants. The goal is to enable mobile robots to operate in challenging environments, characterized by narrow spaces and close proximity of other agents. With their broad range of private and commercial applications reaching from logistics to valet parking to name a few, driverless vehicles have gained increasing at...

Feasibility planning study for a behavior database. Volume III Appendix B, Compendium of survey questions on drinking and driving and occupant restraints

Science.gov (United States)

1987-04-01

The general objective of the project was to determine the feasibility of and the general requirements for a centralized database on driver behavior and attitudes related to drunk driving and occupant restraints. Volume III is a compendium of question...

Note: A phase synchronization photography method for AC discharge

Science.gov (United States)

Wu, Zhicheng; Zhang, Qiaogen; Ma, Jingtan; Pang, Lei

2018-05-01

To research discharge physics under AC voltage, a phase synchronization photography method is presented. By using a permanent-magnet synchronous motor to drive a photography mask synchronized with a discharge power supply, discharge images in a specific phase window can be recorded. Some examples of discharges photographed by this method, including the corona discharge in SF6 and the corona discharge along the air/epoxy surface, demonstrate the feasibility of this method. Therefore, this method provides an effective tool for discharge physics researchers.

Flexible AC transmission systems: the state of the art

Energy Technology Data Exchange (ETDEWEB)

Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

1994-12-31

Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

Low AC Loss YBCO Coated Conductor Geometry by Direct Inkjet Printing

Energy Technology Data Exchange (ETDEWEB)

Rupich, Martin, Dr. [American Superconductor Corporation; Duckworth, Robert, Dr. [Oak Ridge National Laboratory

2009-10-01

The second generation (2G) high temperature superconductors (HTS) wire offers potential benefits for many electric power applications, including ones requiring filamentized conductors with low ac loss, such as transformers and fault current limiters. However, the use of 2G wire in these applications requires the development of both novel multi-filamentary conductor designs with lower ac losses and the development of advanced manufacturing technologies that enable the low-cost manufacturing of these filamentized architectures. This Phase I SBIR project focused on testing inkjet printing as a potential low-cost, roll-to-roll manufacturing technique to fabricate potential low ac loss filamentized architectures directly on the 2G template strips.

Lung-protective ventilation in intensive care unit and operation room : Tidal volume size, level of positive end-expiratory pressure and driving pressure

NARCIS (Netherlands)

Serpa Neto, A.

2017-01-01

Several investigations have shown independent associations between three ventilator settings – tidal volume size, positive end–expiratory pressure (PEEP) and driving pressure – and outcomes in patients with the acute respiratory distress syndrome (ARDS). There is an increasing notion that similar

AC-600 passive ECRHR system and its research program

International Nuclear Information System (INIS)

Chen Bingde; Xiao Zejun; Zhou Renmin; Liu Yiyang

1997-01-01

The secondary-side passive emergency core residual heat removal system (ECRHR System) is an important part of AC-600 PWR passive safety system, with which the core decay heat can be removed through nature circulation in primary and secondary system. Since 1991, the program for AC-600 passive ECRHR system has been conducted to investigate its distinct thermal-hydraulic phenomena, heat removal capability, affecting factors, and to develop computer codes. The test facility, designed according to the power/volume simulating law, is a full pressure and temperature operating loop with volume scaling factor of 1/390. It is composed of main loop system, emergence feedwater system, depression system, heat tracing, I and C system and power supply system. A total of sixteen tests is planned in first stage and fifteen of them have been done. The preliminary result analysis showed that the system has efficient heat removal capability in most conditions and some special thermal hydraulic phenomena, for example, flow fluctuation, which has negative impact on system's nature circulation, were identified

AC Conductivity and Dielectric Properties of Borotellurite Glass

Science.gov (United States)

Taha, T. A.; Azab, A. A.

2016-10-01

Borotellurite glasses with formula 60B2O3-10ZnO-(30 - x)NaF- xTeO2 ( x = 0 mol.%, 5 mol.%, 10 mol.%, and 15 mol.%) have been synthesized by thermal melting. X-ray diffraction (XRD) analysis confirmed that the glasses were amorphous. The glass density ( ρ) was determined by the Archimedes method at room temperature. The density ( ρ) and molar volume ( V m) were found to increase with increasing TeO2 content. The direct-current (DC) conductivity was measured in the temperature range from 473 K to 623 K, in which the electrical activation energy of ionic conduction increased from 0.27 eV to 0.48 eV with increasing TeO2 content from 0 mol.% to 15 mol.%. The dielectric parameters and alternating-current (AC) conductivity ( σ ac) were investigated in the frequency range from 1 kHz to 1 MHz and temperature range from 300 K to 633 K. The AC conductivity and dielectric constant decreased with increasing TeO2 content from 0 mol.% to 15 mol.%.

Variable Speed Wind Turbine Based on Multiple Generators Drive-Train Configuration

DEFF Research Database (Denmark)

Deng, Fujin; Chen, Zhe

2010-01-01

A variable speed wind turbine is presented in this paper, where multiple permanent magnet synchronous generators (MPMSGs) drive-train configuration is employed in the wind turbine. A cascaded multilevel converter interface based on the MPMSGs is developed to synthesize a desired high ac sinusoidal...... output voltage, which could be directly connected to the grids. What is more, such arrangement has been made so that the output ac voltage having a selected phase angle difference among the stator windings of multiple generators. A phase angle shift strategy is proposed in this paper, which effectively...... reduce the fluctuation of the electromagnetic torque sum and results in a good performance for the MPMSGs structure. The simulation study is conducted using PSCAD/EMTDC, and the results verify the feasibility of this variable speed wind turbine based on multiple generators drive-train configuration....

AC – AC Converters for UPS

Directory of Open Access Journals (Sweden)

Rusalin Lucian R. Păun

2008-05-01

Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

Rectangular maximum-volume submatrices and their applications

KAUST Repository

Mikhalev, Aleksandr; Oseledets, I.V.

2017-01-01

We introduce a definition of the volume of a general rectangular matrix, which is equivalent to an absolute value of the determinant for square matrices. We generalize results of square maximum-volume submatrices to the rectangular case, show a connection of the rectangular volume with an optimal experimental design and provide estimates for a growth of coefficients and an approximation error in spectral and Chebyshev norms. Three promising applications of such submatrices are presented: recommender systems, finding maximal elements in low-rank matrices and preconditioning of overdetermined linear systems. The code is available online.

Rectangular maximum-volume submatrices and their applications

KAUST Repository

Mikhalev, Aleksandr

2017-10-18

We introduce a definition of the volume of a general rectangular matrix, which is equivalent to an absolute value of the determinant for square matrices. We generalize results of square maximum-volume submatrices to the rectangular case, show a connection of the rectangular volume with an optimal experimental design and provide estimates for a growth of coefficients and an approximation error in spectral and Chebyshev norms. Three promising applications of such submatrices are presented: recommender systems, finding maximal elements in low-rank matrices and preconditioning of overdetermined linear systems. The code is available online.

Performance of AC/graphite capacitors at high weight ratios of AC/graphite

Energy Technology Data Exchange (ETDEWEB)

Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

2008-03-01

The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

Multi-Phase Modular Drive System: A Case Study in Electrical Aircraft Applications

Directory of Open Access Journals (Sweden)

Charles Onambele

2017-12-01

Full Text Available In this article, an advanced multiphase modular power drive prototype is developed for More Electric Aircraft (MEA. The proposed drive is designed to supply a multi-phase permanent magnet (PM motor rating 120 kW with 24 slots and 11 pole pairs. The power converter of the drive system is based on Silicon Carbide Metal Oxide Semiconductor Field-Effect Transistor (SiC MOSFET technology to operate at high voltage, high frequency and low reverse recovery current. Firstly, an experimental characterization test is performed for the selected SiC power module in harsh conditions to evaluate the switching energy losses. Secondly, a finite element thermal analysis based on Ansys-Icepak is accomplished to validate the selected cooling system for the power converter. Thirdly, a co-simulation model is developed using Matlab-Simulink and LTspice® to evaluate the SiC power module impact on the performance of a multiphase drive system at different operating conditions. The results obtained show that the dynamic performance and efficiency of the power drive are significantly improved, which makes the proposed system an excellent candidate for future aircraft applications.

Initial experience with AcQsim CT simulator

International Nuclear Information System (INIS)

Michalski, Jeff M.; Gerber, Russell; Bosch, Walter R.; Harms, William; Matthews, John W.; Purdy, James A.; Perez, Carlos A.

1995-01-01

performed with the patient on a conventional simulator in which portal radiographs are compared against DRRs. Results: Several important issues have been identified that impact on clinical utilization of the CT simulator. Thin, finely spaced CT slices improve the DRR quality but potentially degrade the quality of cross sectional images used for image segmentation. Large data sets also increase the workload for anatomic image segmentation (contouring) and raise concerns regarding data storage and easy network access. Software for image segmentation has been significantly improved allowing rapid drawing of contours around tumor/target volumes and normal tissues and improved edit functions that allow interpolation, copying, and correction of contours. These tools have reduced the time for defining all the normal tissues and target volumes for some sites (e.g. prostate) to less than 30 minutes. Acquisition of this large volume CT data currently takes less than 30 minutes potentially reducing patient time in the simulation/planning process. Difficult simulations, such as mantle/periaortic and craniospinal fields that typically require multiple 2-3 hour simulation sessions, now take half as much time with the spiral CT scanner. Subsequent field reductions or secondary fields can be planned without the physical presence of the patient. A comparison of predicted isocenter shift coordinates and actual coordinates used for verification simulation showed that the average change in isocenter position was less than a few mm indicating that the verification process can likely be eliminated. Disadvantages of current device include limited CT ring size (70 cm) and reconstruction window (48 cm) which prevent universal application of technique to all patients. Conclusion: The AcQsim offers significant advantages over a conventional simulator in terms of patient compliance and fatigue, as well as departmental throughput. In virtual simulation, after the initial acquisition of CT data, the CT

Design Comparison of Autonomous High Voltage Driving System for DEAP Actuator

DEFF Research Database (Denmark)

Huang, Lina; Pittini, Riccardo; Zhang, Zhe

2014-01-01

As a new type of smart material, the Dielectric Electro Active Polymer (DEAP) is introduced in terms of configuration, working principle and potential applications. The design of an autonomous high voltage driving system for DEAP actuator is investigated. The system configuration and the design...... methodology of a high voltage converter are discussed in detail. Based on the heating valve application, three different high voltage converter solutions have been proposed. The different proposals have been compared in terms of energy loss, volume and cost. Finally, the design selection suggestions...

Limiting volume with modern ventilators.

Science.gov (United States)

Wing, Thomas J; Haan, Lutana; Ashworth, Lonny J; Anderson, Jeff

2015-06-01

The acute respiratory distress syndrome (ARDS) network low tidal-volume study comparing tidal volumes of 12 ml/kg versus 6 ml/kg was published in 2000. The study was stopped early as data revealed a 22% relative reduction in mortality rate when using 6 ml/kg tidal volume. The current generation of critical care ventilators allows the tidal volume to be set during volume-targeted, assist/control (volume A/C); however, some ventilators include options that may prevent the tidal volume from being controlled. The purpose of this bench study was to evaluate the delivered tidal volume, when these options are active, in a spontaneously breathing lung model using an electronic breathing simulator. Four ventilators were evaluated: CareFusion AVEA (AVEA), Dräger Evita® XL (Evita XL), Covidien Puritan Bennett® 840(TM) (PB 840), and Maquet SERVO-i (SERVO-i). Each ventilator was connected to the Hans Rudolph Electronic Breathing Simulator at an amplitude of 0 cm H2O and then 10 cm H2O. All four ventilators were set to deliver volume A/C, tidal volume 400 ml, respiratory rate 20 bpm, positive end-expiratory pressure 5 cm H2O, peak flowrate 60 L/min. The displayed tidal volume was recorded for each ventilator at the above settings with additional options OFF and then ON. The AVEA has two options in volume A/C: demand breaths and V-sync. When activated, these options allow the patient to exceed the set tidal volume. When using the Evita XL, the option AutoFlow can be turned ON or OFF, and when this option is ON, the tidal volume may vary. The PB 840 does not have any additional options that affect volume delivery, and it maintains the set tidal volume regardless of patient effort. The SERVO-i's demand valve allows additional flow if the patient's inspiratory flowrate exceeds the set flowrate, increasing the delivered tidal volume; this option can be turned OFF with the latest software upgrade. Modern ventilators have an increasing number of optional settings. These settings may

Comparative evaluation of soft-switching, bidirectional, isolated AC/DC converter topologies

NARCIS (Netherlands)

Everts, J.; Krismer, F.; Van den Keybus, J.; Driesen, Johan; Kolar, J.W.

2012-01-01

For realizing bidirectional and isolated AC/DC converters, soft-switching techniques/topologies seem to be a favourable choice as they enable a further loss and volume reduction of the system. Contrary to the traditional dual-stage approach, using a power factor corrector (PFC) stage in series with

The Preliminary Research for Implementation of Improved DTC Scheme of High Performance PMSM Drives

Directory of Open Access Journals (Sweden)

Tole Sutikno

2008-12-01

Full Text Available The direct torque control (DTC is one of control approache that is used commonly in PMSM control system. This method supports a very quick and precise torque response. However, the DTC method is not perfect and has some disadvantages. Many researchers have been proposed to modify the basic DTC scheme for PMSM drive. All this contributions allow performance to be improved, but at the same time they lead to more complex schemes. Furthermore, the PMSM drive control systems are usually based on microcontroller and DSP. Some researchers also have been used DSP and FPGA together to develop DTC for AC drives. These allow improving the performance, but they will increase cost. For the reason above, this paper proposed a new DTC scheme to apply only based on FPGA. The preliminary research showed that the proposed DTC sheme can reduce torque and flux ripples significantly. Therefore, this paper also recomend to realize proposed DTC scheme based on FPGA in order to support to execute very fast computation.The implementation is hoped that it will very potential to replace not only the induction motor but also the DC servo motor in a number of industrial process, commercial, domestic and modern military applications of high-performance drive.

GLOBAL AND LOCAL COUPLING COMPENSATION EXPERIMENTS IN RHIC USING AC DIPOLES

International Nuclear Information System (INIS)

CALAGA, R.; FRANCHI, A., TOMAS, R.; CERN)

2006-01-01

Compensation of transverse coupling during the RHIC energy ramp has been proven to be non-trivial and tedious. The lack of accurate knowledge of the coupling sources has initiated several efforts to develop fast techniques using turn-by-turn BPM data to identify and compensate these sources. This paper aims to summarize the beam experiments performed to measure the coupling, matrix and resonance driving terms with the aid of RHIC ac dipoles at injection energy

Power-Quality-Oriented Optimization in Multiple Three-Phase Adjustable Speed Drives

DEFF Research Database (Denmark)

Yang, Yongheng; Davari, Pooya; Blaabjerg, Frede

2016-01-01

As an almost standardized configuration, Diode Rectifiers (DRs) and Silicon-Controlled Rectifiers (SCRs) are commonly employed as the front-end topology in three-phase Adjustable Speed Drive (ASD) systems. Features of this ASD configuration include: structural and control simplicity, small volume......, low cost, and high reliability during operation. Yet, DRs and SCRs bring harmonic distortions in the mains and thus lowering the overall efficiency. Power quality standards/rules are thus released. For multiple ASD systems, certain harmonics of the total grid current can be mitigated by phase......-shifting the currents drawn by SCR-fed drives, and thus it is much flexible to reduce the Total Harmonic Distortion (THD) level in such applications. However, the effectiveness of this harmonic mitigation scheme for multiple ASD systems depends on: a) the number of parallel drives, b) the power levels, and c...

Drunk driving warning system (DDWS). Volume 2, Field test evaluation

Science.gov (United States)

1983-12-01

The Drunk Driving Warning System (DDWS) is a vehicle-mounted device for testing driver impairment and activating alarms. The driver must pass a steering competency test (the Critical Tracking Task or CTT) in order to drive the car in a normal manner....

Large A.C. machines theory and investigation methods of currents and losses in stator and rotor meshes including operation with nonlinear loads

CERN Document Server

Boguslawsky, Iliya; Hayakawa, Masashi

2017-01-01

In this monograph the authors solve the modern scientific problems connected with A.C. motors and generators, based first on the detailed consideration of their physical phenomena. The authors describe the theory and investigative methods they developed and applied in practice, which are considered to be of essential interest for specialists in the field of the electrical engineering industry in European countries, the USA, Argentina, and Brazil, as well as in such countries as India, China, and Iran. This book will be of interest to engineers specialized in the field of the manufacture, operation, and repair of A.C. machines (motors and generators) as well as electric drives; to professors, lecturers, and post-graduate students of technical universities, who are specializing in the field of electric machine engineering and electric drives; and to students who are engaged in the field of high current techniques, electric drives, and electric machine engineering.

Design considerations for permanent magnet direct drive generators for wind energy applications

NARCIS (Netherlands)

Jassal, A.K.; Polinder, H.; Damen, M.E.C.; Versteegh, K.

2012-01-01

Permanent Magnet Direct Drive (PMDD) generators offer very high force density, high efficiency and low number of components. Due to these advantages, PMDD generators are getting popular in the wind energy industry especially for offshore application. Presence of permanent magnets gives magnetic

Performance Analysis of Three-Phase Induction Motor with AC Direct and VFD

Science.gov (United States)

Kumar, Dinesh

2018-03-01

The electrical machine analysis and performance calculation is a very important aspect of efficient drive system design. The development of power electronics devices and power converters provide smooth speed control of Induction Motors by changing the frequency of input supply. These converters, on one hand are providing a more flexible speed control that also leads to problems of harmonics and their associated ailments like pulsating torque, distorted current and voltage waveforms, increasing losses etc. This paper includes the performance analysis of three phase induction motor with three-phase AC direct and variable frequency drives (VFD). The comparison has been concluded with respect to various parameters. MATLAB-SIMULINKTM is used for the analysis.

Detuning Minimization of Induction Motor Drive System for Alternative Energy Vehicles

Directory of Open Access Journals (Sweden)

Habibur Rehman

2015-08-01

Full Text Available This paper evaluates different types of AC machines and various control techniques for their suitability for the drive system of Alternative Energy Vehicles (AEV. An Indirect Field Oriented (IFO drive system for the AEV application is chosen and its major problem of detuning is addressed by designing an offline and an online rotor resistance adaptation technique. The offline scheme sets the slip gain at various operating conditions based on the fact that if the rotor resistance is set correctly and field orientation is achieved, then there should be a linear relationship between the torque current and the output torque. The online technique is designed using Model Reference Adaptive System (MRAS for the rotor resistance adaptation. For an ideal field oriented machine, the rotor flux along the q-axis should be zero. This condition acts as a reference model for the proposed MRAS scheme. The current model flux observer in the synchronous frame of reference is selected as an adjustable model and its rotor resistance is tuned so that the flux along the q-axis becomes zero. The effectiveness of the offline tuning scheme is evident through performance validation of the drive system, which is implemented in a real Ford vehicle. The experimental results obtained while driving the test vehicle are included in the paper while the proposed online scheme is validated on a 3.75 kW prototype induction motor.

Gear bearing drive

Science.gov (United States)

Mavroidis, Constantinos (Inventor); Vranish, John M. (Inventor); Weinberg, Brian (Inventor)

2011-01-01

A gear bearing drive provides a compact mechanism that operates as an actuator providing torque and as a joint providing support. The drive includes a gear arrangement integrating an external rotor DC motor within a sun gear. Locking surfaces maintain the components of the drive in alignment and provide support for axial loads and moments. The gear bearing drive has a variety of applications, including as a joint in robotic arms and prosthetic limbs.

AC distribution system for TFTR pulsed loads

International Nuclear Information System (INIS)

Carroll, R.F.; Ramakrishnan, S.; Lemmon, G.N.; Moo, W.I.

1977-01-01

This paper outlines the AC distribution system associated with the Tokamak Fusion Test Reactor and discusses the significant areas related to design, protection, and equipment selection, particularly where there is a departure from normal utility and industrial applications

Quasienergy spectrum and tunneling current in ac-driven triple quantum dot shuttles

Energy Technology Data Exchange (ETDEWEB)

Villavicencio, J [Facultad de Ciencias, Universidad Autonoma de Baja California, Ensenada (Mexico); Maldonado, I [Centro de Investigacion Cientifica y de Educacion Superior de Ensenada (Mexico); Cota, E [Centro de Nanociencias y Nanotecnologia, Universidad Nacional Autonoma de Mexico, Ensenada (Mexico); Platero, G, E-mail: villavics@uabc.edu.mx [Instituto de Ciencia de Materiales de Madrid (CSIC), Cantoblanco, 28049 Madrid (Spain)

2011-02-15

The dynamics of electrons in ac-driven double quantum dots have been extensively analyzed by means of Floquet theory. In these systems, coherent destruction of tunneling has been shown to occur for certain ac field parameters. In this work we analyze, by means of Floquet theory, the electron dynamics of a triple quantum dot in series attached to electric contacts, where the central dot position oscillates. In particular, we analyze the quasienergy spectrum of this ac-driven nanoelectromechanical system as a function of the intensity and frequency of the ac field and of external dc voltages. For strong driving fields, we derive, by means of perturbation theory, analytical expressions for the quasienergies of the driven oscillator system. From this analysis, we discuss the conditions for coherent destruction of tunneling (CDT) to occur as a function of detuning and field parameters. For zero detuning, and from the invariance of the Floquet Hamiltonian under a generalized parity transformation, we find analytical expressions describing the symmetry properties of the Fourier components of the Floquet states under such a transformation. By using these expressions, we show that in the vicinity of the CDT condition, the quasienergy spectrum exhibits exact crossings which can be characterized by the parity properties of the corresponding eigenvectors.

The Simulation of the Traction Drive with Middle-Frequency Transformer

Directory of Open Access Journals (Sweden)

Pavel Drabek

2008-01-01

Full Text Available This paper presents research motivated by industrial demand for special traction drive topology devoted to minimization of traction transformer weight against topology with classical 50Hz traction transformer. The special traction drive topology for AC power systems consists of input high voltage trolley converter (single phase matrix converter –middle frequency transformer - output converter - traction motor has been described. The main attention has been given tothe control algorithm of the traction topology (inserting of NULL vector of matrix converter and Two-value control ofsecondary active rectifier.

Drive of a rail locomotive using linear motors. Antrieb eines schienengebundenen Triebfahrzeuges mit Hilfe von Linearmotoren

Energy Technology Data Exchange (ETDEWEB)

Kagischke, W; Steffen, U

1977-12-08

The purpose of the invention is to avoid the disadvantages of asynchronous linear motors, for example for need for reactive current for excitation, where driving on a normal section and driving on a branch line should be possible without losing the saving in weight on the inductor. According to the invention, the common inductor on a synchronous linear motor consists of 2 parallel packets of laminations surrounded by DC excitation windings and the secondary systems consists of unwound and spaced magnetic sections covering the two packets of laminations on the normal section. In the direction of thrust, their length extends nearly over the pole pitch of the multi-phase AC winding. According to the invetnion, this drive therefore consists of a synchronous linear motor combined into a double motor, with an external, rail shaped fixed secondary system, which has a multi-phase AC winding opposite it.

AC electric field assisted orientational photorefractive effect in C60-doped nematic liquid crystal

International Nuclear Information System (INIS)

Sun Xiudong; Pei Yanbo; Yao Fengfeng; Zhang Jianlong; Hou Chunfeng

2007-01-01

Photorefractive gratings were produced in a C 60 -doped nematic liquid crystal cell under the application of two coherent beams and a nonbiased sinusoidal ac electric field. The beam coupling and diffraction of the ac electric field assisted gratings were studied systematically. A stable asymmetric energy transference was obtained. Diffraction was observed when the angle (between the normal of the cell and the bisector of the writing beams) was 0 0 , and the dependence of diffraction efficiency on the peak-to-peak value of the ac voltage was similar to that at an incidence angle of 45 0 , suggesting that the role of the ac field was to facilitate the charge separation, and the space-charge field (SCF) originated predominantly from the diffusion of the ac electric field assisted photo-induced carriers under the application of nonuniform illumination and an applied ac field. The grating was produced by director reorientation induced by the cooperation of the SCF and the applied ac electric field. A self-erasing phenomenon was observed in this cell. An explanation in terms of the movement of two kinds of carriers with opposite signs was proposed

A Low Cost Sensors Approach for Accurate Vehicle Localization and Autonomous Driving Application.

Science.gov (United States)

Vivacqua, Rafael; Vassallo, Raquel; Martins, Felipe

2017-10-16

Autonomous driving in public roads requires precise localization within the range of few centimeters. Even the best current precise localization system based on the Global Navigation Satellite System (GNSS) can not always reach this level of precision, especially in an urban environment, where the signal is disturbed by surrounding buildings and artifacts. Laser range finder and stereo vision have been successfully used for obstacle detection, mapping and localization to solve the autonomous driving problem. Unfortunately, Light Detection and Ranging (LIDARs) are very expensive sensors and stereo vision requires powerful dedicated hardware to process the cameras information. In this context, this article presents a low-cost architecture of sensors and data fusion algorithm capable of autonomous driving in narrow two-way roads. Our approach exploits a combination of a short-range visual lane marking detector and a dead reckoning system to build a long and precise perception of the lane markings in the vehicle's backwards. This information is used to localize the vehicle in a map, that also contains the reference trajectory for autonomous driving. Experimental results show the successful application of the proposed system on a real autonomous driving situation.

Evaluation of a Dry EEG System for Application of Passive Brain-Computer Interfaces in Autonomous Driving.

Science.gov (United States)

Zander, Thorsten O; Andreessen, Lena M; Berg, Angela; Bleuel, Maurice; Pawlitzki, Juliane; Zawallich, Lars; Krol, Laurens R; Gramann, Klaus

2017-01-01

We tested the applicability and signal quality of a 16 channel dry electroencephalography (EEG) system in a laboratory environment and in a car under controlled, realistic conditions. The aim of our investigation was an estimation how well a passive Brain-Computer Interface (pBCI) can work in an autonomous driving scenario. The evaluation considered speed and accuracy of self-applicability by an untrained person, quality of recorded EEG data, shifts of electrode positions on the head after driving-related movements, usability, and complexity of the system as such and wearing comfort over time. An experiment was conducted inside and outside of a stationary vehicle with running engine, air-conditioning, and muted radio. Signal quality was sufficient for standard EEG analysis in the time and frequency domain as well as for the use in pBCIs. While the influence of vehicle-induced interferences to data quality was insignificant, driving-related movements led to strong shifts in electrode positions. In general, the EEG system used allowed for a fast self-applicability of cap and electrodes. The assessed usability of the system was still acceptable while the wearing comfort decreased strongly over time due to friction and pressure to the head. From these results we conclude that the evaluated system should provide the essential requirements for an application in an autonomous driving context. Nevertheless, further refinement is suggested to reduce shifts of the system due to body movements and increase the headset's usability and wearing comfort.

Active control system upgrade design for lower hybrid current drive system on Alcator C-Mod

Energy Technology Data Exchange (ETDEWEB)

Kanojia, A.D., E-mail: akanojia@mit.edu [Massachusetts Institute of Technology Plasma Science and Fusion Center, Cambridge, MA (United States); Wallace, G.M.; Terry, D.R.; Stillerman, J.A.; Burke, W.M.; MacGibbon, P.A.; Johnson, D.K. [Massachusetts Institute of Technology Plasma Science and Fusion Center, Cambridge, MA (United States)

2012-12-15

Highlights: Black-Right-Pointing-Pointer Initial tests of the Hittite microwave components show good or better control of phase and amplitude when compared to the vector modulators used in the current system. Black-Right-Pointing-Pointer With an analog based control component system the system complexity is dramatically reduced. Black-Right-Pointing-Pointer Historically, D-tAcq hardware/software has performed more reliably on DPCS and FFT controllers than the current lower hybrid control system Black-Right-Pointing-Pointer Cost and lead time of the Hittite microwave components is significantly small compared to vector modulators. - Abstract: As a part of the scheduled expansion of the Alcator C-Mod lower hybrid current drive (LHCD) system from 12 to 16 klystrons to accommodate installation of a second LH antenna, the active control system (ACS) is being redesigned to accommodate the additional klystrons. Digitizers and output modules will be cPCI modules provided by D-tAcq Solutions. The real-time application will run on a standard PC server running Linux. Initially, the new ACS system will be designed to control 8 klystrons on the second LH antenna and the existing ACS will control the remaining 8 klystrons on the existing LH antenna. Experience gained operating the existing LHCD system has given us insight into the design of a more robust, compact, efficient and simple system for the new ACS. The design upgrade will be patterned on the digital plasma control system (DPCS [1]) in use on C-Mod.

The targeted heating and current drive applications for the ITER electron cyclotron system

Energy Technology Data Exchange (ETDEWEB)

Henderson, M.; Darbos, C.; Gandini, F.; Gassmann, T.; Loarte, A.; Omori, T.; Purohit, D. [ITER Organization, Route de Vinon-sur-Verdon, CS 90 046, 13067 St. Paul Lez Durance Cedex (France); Saibene, G.; Gagliardi, M. [Fusion for Energy, Josep Pla 2, Barcelona 08019 (Spain); Farina, D.; Figini, L. [Istituto di Fisica del Plasma CNR, 20125 Milano (Italy); Hanson, G. [US ITER Project Office, ORNL, 1055 Commerce Park, PO Box 2008, Oak Ridge, Tennessee 37831 (United States); Poli, E. [Max-Planck-Institut für Plasmaphysik, D-85748 Garching (Germany); Takahashi, K. [Japan Atomic Energy Agency (JAEA), Naka, Ibaraki 311-0193 (Japan)

2015-02-15

A 24 MW Electron Cyclotron (EC) system operating at 170 GHz and 3600 s pulse length is to be installed on ITER. The EC plant shall deliver 20 MW of this power to the plasma for Heating and Current Drive (H and CD) applications. The EC system is designed for plasma initiation, central heating, current drive, current profile tailoring, and Magneto-hydrodynamic control (in particular, sawteeth and Neo-classical Tearing Mode) in the flat-top phase of the plasma. A preliminary design review was performed in 2012, which identified a need for extended application of the EC system to the plasma ramp-up, flattop, and ramp down phases of ITER plasma pulse. The various functionalities are prioritized based on those applications, which can be uniquely addressed with the EC system in contrast to other H and CD systems. An initial attempt has been developed at prioritizing the allocated H and CD applications for the three scenarios envisioned: ELMy H-mode (15 MA), Hybrid (∼12 MA), and Advanced (∼9 MA) scenarios. This leads to the finalization of the design requirements for the EC sub-systems.

Advanced AC permanent magnet axial flux disc motor for electric passenger vehicle

Science.gov (United States)

Kliman, G. B.

1982-01-01

An ac permanent magnet axial flux disc motor was developed to operate with a thyristor load commutated inverter as part of an electric vehicle drive system. The motor was required to deliver 29.8 kW (40 hp) peak and 10.4 kW (14 hp) average with a maximum speed of 11,000 rpm. It was also required to run at leading power factor to commutate the inverter. Three motors were built.

3D MODELING OF DRIVE SHAFT OF A MONORAIL CONVEYOR

Directory of Open Access Journals (Sweden)

STĂNĂŞEL Iulian

2016-11-01

Full Text Available The conveyors are used to transport various products in successive steps until they reach their destination and to ensure cargo volumes to balance the flow buffer. The conveyors monorail type are used for the transfer of the products, piece by piece and they can be suspended and can operate at heights and different tasks. In this paper is presented a method for the design of the drive shaft of a monorail conveyor, by using CAD-CAE applications.

Activation volume and interaction of metal particulate media

Energy Technology Data Exchange (ETDEWEB)

Tetsukawa, Hiroki [Sony Corporation, 6-7-35 Kitashinagawa, Shinagawa-ku, Tokyo 141-0001 (Japan)]. E-mail: tetsukaw@arc.sony.co.jp; Kondo, Hirofumi [Sony Corporation, 6-7-35 Kitashinagawa, Shinagawa-ku, Tokyo 141-0001 (Japan)

2005-09-15

We have investigated the activation volume (V{sub ac}) and magnetostatic interaction of metal particulate (MP) media. The activation volume of MP media decreases with the decrease of physical volume (V{sub phy}) of metal particles. The activation volume and the ratio of V{sub phy}/V{sub ac} of advanced metal particles are 6x10{sup -24}m{sup 3} and 1.5, respectively. It can be predicted that the physical volume of metal particle is about 3x10{sup -24}m{sup 3} when the physical volume is equal to the activation volume. This value is agreement with the practical lower limit of physical volume of metal particle predicted by Sharrock. The negative interaction (demagnetization effect) in MP media decreases with low saturation magnetization of the metal particles, a thin magnetic layer, a high orientation of MP media, and a low packing fraction of metal particles in the MP media. The activation volume of the MP media decreased as the negative interactions decreased. In advanced MP media with low M{sub r}.t (M{sub r}=remanent magnetization and t=thickness), the influence of interaction on the activation volume is reduced.

Activation volume and interaction of metal particulate media

International Nuclear Information System (INIS)

Tetsukawa, Hiroki; Kondo, Hirofumi

2005-01-01

We have investigated the activation volume (V ac ) and magnetostatic interaction of metal particulate (MP) media. The activation volume of MP media decreases with the decrease of physical volume (V phy ) of metal particles. The activation volume and the ratio of V phy /V ac of advanced metal particles are 6x10 -24 m 3 and 1.5, respectively. It can be predicted that the physical volume of metal particle is about 3x10 -24 m 3 when the physical volume is equal to the activation volume. This value is agreement with the practical lower limit of physical volume of metal particle predicted by Sharrock. The negative interaction (demagnetization effect) in MP media decreases with low saturation magnetization of the metal particles, a thin magnetic layer, a high orientation of MP media, and a low packing fraction of metal particles in the MP media. The activation volume of the MP media decreased as the negative interactions decreased. In advanced MP media with low M r .t (M r =remanent magnetization and t=thickness), the influence of interaction on the activation volume is reduced

Peltier ac calorimeter

OpenAIRE

Jung, D. H.; Moon, I. K.; Jeong, Y. H.

2001-01-01

A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

Three-Phase Multistage System (DC-AC-DC-AC for Connecting Solar Cells to the Grid

Directory of Open Access Journals (Sweden)

Mahmudreza Changizian

2017-11-01

Full Text Available Inverter systems that feed electrical power from photovoltaic (PV system into the grid must convert the direct current of the PV array into the alternating current of the grid. In many applications, it is important for a converter to be lightweight, highly reliable, input/output isolated, flexible and operable in a boost mode. These features can be achieved by using a High-Frequency inverter which involves an isolated DC-DC stage and DC-AC section, which provides AC output. This paper proposes a new three phase topology, based on multi stage converter and PV system in order to use in medium and high power applications. The Perturb and Observe (P&O method is used for maximum power point tracking (MPPT control of PV array. The switching control signals for three-phase inverter are provided by hysteresis control method. Also, the comparison between the proposed topology and traditional structures has been conducted and finally the simulation researches are performed in a closed-loop control system by MATLAB/Simulink software to verify the operation of the proposed structure. The results represent better performance of the introduced system over traditional topologies.

Digital model for harmonic interactions in AC/DC/AC systems

Energy Technology Data Exchange (ETDEWEB)

Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

1994-12-31

The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

Direct electromechanical driving systems: diversity, constraints and solutions; Les entrainements electromecaniques directs: diversite, contraintes et solutions

Energy Technology Data Exchange (ETDEWEB)

Multon, B. [Ecole Normale Superieure, 94 - Cachan (France); Bonal, J. [Promethee Groupe Schneider Electric S.A., 92 - Boulogne-Billancourt (France)

1999-11-01

Direct electromechanical drives are the simplest possible transmission systems requiring no additional mechanical components such as gearboxes or rotary to linear converters. This simplicity leads a number of advantages including greater reliability, less maintenance, improved dynamic characteristics and reduced weight and volume. However, the performance specification of direct drives is usually high, with a correspondingly high cost, and often this cannot be justified in complete systems where the other components limit the overall performance. This factor alone has been sufficient to restrict the market penetration of direct drives. The majority of applications are in linear actuators, and in motors operating at very high or very low speeds. New developments are constantly being introduced, especially in relation to structures.

Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

Directory of Open Access Journals (Sweden)

Evi Ploumpidou

2017-12-01

Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

Composite Based EHV AC Overhead Transmission Lines

DEFF Research Database (Denmark)

Sørensen, Thomas Kjærsgaard

and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

Electrical motor/generator drive apparatus and method

Science.gov (United States)

Su, Gui Jia

2013-02-12

The present disclosure includes electrical motor/generator drive systems and methods that significantly reduce inverter direct-current (DC) bus ripple currents and thus the volume and cost of a capacitor. The drive methodology is based on a segmented drive system that does not add switches or passive components but involves reconfiguring inverter switches and motor stator winding connections in a way that allows the formation of multiple, independent drive units and the use of simple alternated switching and optimized Pulse Width Modulation (PWM) schemes to eliminate or significantly reduce the capacitor ripple current.

Effects of AC Electric Field on Small Laminar Nonpremixed Flames

KAUST Repository

Xiong, Yuan

2015-04-01

Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the

Influence of System Parameters on Fuse Protection Use in Regenerative DC Drives

Directory of Open Access Journals (Sweden)

Isa Salman Qamber

2009-06-01

Full Text Available Current limiting fuses are widely used to protect the thyristors in DC drive systems. One very important problem is the choice of the correct voltage rating for fuses protecting regenerative DC drives, where many types of fault may occur, which makes fuse protection difficult. In the event of a commutation failure while regenerating, the fuses need to interrupt the loop supplied by the AC and DC voltages acting in series, which is the most difficult case for protection by fuses. In this paper a detailed study of the complete interruption process has been investigated by modeling of arcing process of the fuse protection against the regenerative circuit internal commutation fault. The effect of varying the motor time constant, supply impedance, number of fuses used to clear the fault and DC machine rating on the total transient response is studied. The model of a 200 A fuse is employed in this study. Fuses in series with both the semiconductor devices (F1 and fuses in AC lines (F2 are considered. Comparison was made between arc energy produced for fuses protecting the regenerative circuit if failure occurs, with the arc energy produced in a standard AC test in order to investigate the required voltage rating for the fuse.

Bearingless AC Homopolar Machine Design and Control for Distributed Flywheel Energy Storage

Science.gov (United States)

Severson, Eric Loren

magnetic modeling, winding design, control, and power-electronic drive implementation. While these contributions are oriented towards facilitating more optimal flywheel designs, they will also be useful in applying the bearingless ac homopolar machine in other applications. Example designs are considered through finite element analysis and experimental validation is provided from a proof-of-concept prototype that has been designed and constructed as a part of this dissertation.

Regulation of Dynamical Systems to Optimal Solutions of Semidefinite Programs: Algorithms and Applications to AC Optimal Power Flow

Energy Technology Data Exchange (ETDEWEB)

Dall' Anese, Emiliano; Dhople, Sairaj V.; Giannakis, Georgios B.

2015-07-01

This paper considers a collection of networked nonlinear dynamical systems, and addresses the synthesis of feedback controllers that seek optimal operating points corresponding to the solution of pertinent network-wide optimization problems. Particular emphasis is placed on the solution of semidefinite programs (SDPs). The design of the feedback controller is grounded on a dual e-subgradient approach, with the dual iterates utilized to dynamically update the dynamical-system reference signals. Global convergence is guaranteed for diminishing stepsize rules, even when the reference inputs are updated at a faster rate than the dynamical-system settling time. The application of the proposed framework to the control of power-electronic inverters in AC distribution systems is discussed. The objective is to bridge the time-scale separation between real-time inverter control and network-wide optimization. Optimization objectives assume the form of SDP relaxations of prototypical AC optimal power flow problems.

Rotating field current drive in spherical plasmas

International Nuclear Information System (INIS)

Brotherton-Ratcliffe, D.; Storer, R.G.

1988-01-01

The technique of driving a steady Hall current in plasmas using a rotating magnetic field is studied both numerically and analytically in the approximation of negligible ion flow. A spherical plasma bounded by an insulating wall and immersed in a uniform magnetic field which has both a rotating component (for current drive) and a constant ''vertical'' component (for MHD equilibrium) is considered. The problem is formulated in terms of an expansion of field quantities in vector spherical harmonics. The numerical code SPHERE solves the resulting pseudo-harmonic equations by a multiple shooting technique. The results presented, in addition to being relevant to non-inductive current drive generally, have a direct relevance to the rotamak experiments. For the case of no applied vertical field the steady state toroidal current driven by the rotating field per unit volume of plasma is several times less than in the long cylinder limit for a plasma of the same density, resistivity and radius. The application of a vertical field, which for certain parameter regimes gives rise to a compact torus configuration, improves the current drive dramatically and in many cases gives ''better'' current drive than the long cylinder limit. This result is also predicted by a second order perturbation analysis of the pseudo-harmonic equations. A steady state toroidal field is observed which appears consistent with experimental observations in rotamaks regarding magnitude and spatial dependence. This is an advance over previous analytical theory which predicted an oppositely directed toroidal field of undefined magnitude. (author)

Combined Optimal Control System for excavator electric drive

Science.gov (United States)

Kurochkin, N. S.; Kochetkov, V. P.; Platonova, E. V.; Glushkin, E. Y.; Dulesov, A. S.

2018-03-01

The article presents a synthesis of the combined optimal control algorithms of the AC drive rotation mechanism of the excavator. Synthesis of algorithms consists in the regulation of external coordinates - based on the theory of optimal systems and correction of the internal coordinates electric drive using the method "technical optimum". The research shows the advantage of optimal combined control systems for the electric rotary drive over classical systems of subordinate regulation. The paper presents a method for selecting the optimality criterion of coefficients to find the intersection of the range of permissible values of the coordinates of the control object. There is possibility of system settings by choosing the optimality criterion coefficients, which allows one to select the required characteristics of the drive: the dynamic moment (M) and the time of the transient process (tpp). Due to the use of combined optimal control systems, it was possible to significantly reduce the maximum value of the dynamic moment (M) and at the same time - reduce the transient time (tpp).

ACS Zero Point Verification

Science.gov (United States)

Dolphin, Andrew

2005-07-01

The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

Adjustable speed drive study, part 1

Science.gov (United States)

Wallace, A.

1989-08-01

Advances in speed control for motors in recent years, notably those in power electronics, have widened the range of application for several adjustable speed drive (ASD) types to include the smaller horsepower sizes. The dc motor drive, formerly in almost universal use for speed control, is being challenged by the high efficiency induction motor/pulse width modulation (PWM) drive; and for special small horsepower size applications, by the permanent magnet motor/PWM inverter drive or by the switched reluctance motor drive. The main characteristics of the several ASD types suitable for small horsepower size applications are discussed, as well as their unwanted side effects: poor power factor, harmonic distortion of the supply, acoustic noise, and electromagnetic interference. A procedure is recommended for determining which, if any, ASD to use.

Microcontroller’s Applications in Driving of Industrial Robots

Directory of Open Access Journals (Sweden)

Marius Tufoi

2010-10-01

Full Text Available Microcontrollers and microprocessors are distinct in that, to be able to use a microprocessor, one has to integrate peripheral components like memory chip or data transmitters-receivers, while microcontrollers have integrated all the necessary components for an autonomous operation. There is no need for additional external part because all the required ones are already incorporated in microcontroller’s capsule. Thus using microcontrollers on device construction it can be saved time and space, in terms of geometrical dimensions. The present paper describes an application regarding driving and controlling a automatic guided vehicle using microcontrollers. The kinematic curvature is performed using two guiding wheels that have immobile shafts and distinct velocities.

Electrical actuation of electrically conducting and insulating droplets using ac and dc voltages

International Nuclear Information System (INIS)

Kumari, N; Bahadur, V; Garimella, S V

2008-01-01

Electrical actuation of liquid droplets at the microscale offers promising applications in the fields of microfluidics and lab-on-chip devices. Much prior research has targeted the electrical actuation of electrically conducting liquid droplets using dc voltages (classical electrowetting). Electrical actuation of conducting droplets using ac voltages and the actuation of insulating droplets (using dc or ac voltages) has remained relatively unexplored. This paper utilizes an energy-minimization-based analytical framework to study the electrical actuation of a liquid droplet (electrically conducting or insulating) under ac actuation. It is shown that the electromechanical regimes of classical electrowetting, electrowetting under ac actuation and insulating droplet actuation can be extracted from the generic electromechanical actuation framework, depending on the electrical properties of the droplet, the underlying dielectric layer and the frequency of the actuation voltage. This paper also presents experiments which quantify the influence of the ac frequency and the electrical properties of the droplet on its velocity under electrical actuation. The velocities of droplets moving between two parallel plates under ac actuation are experimentally measured; these velocities are then related to the actuation force on the droplet which is predicted by the electromechanical model developed in this work. It is seen that the droplet velocities are strongly dependent on the frequency of the ac actuation voltage; the cut-off ac frequency, above which the droplet fails to actuate, is experimentally determined and related to the electrical conductivity of the liquid. This paper then analyzes and directly compares the various electromechanical regimes for the actuation of droplets in microfluidic applications

Drunk driving warning system (DDWS). Volume 1, System concept and description

Science.gov (United States)

1983-11-01

The Drunk Driving Warning System (DDWS) is a vehicle-mounted device for testing driver impairment and activating alarms. The driver must pass a steering competency test in order to drive the car in a normal manner. The emergency flasher system operat...

Predicting AC loss in practical superconductors

International Nuclear Information System (INIS)

Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P

2006-01-01

Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time

Graphical User Interfaces for Volume Rendering Applications in Medical Imaging

OpenAIRE

Lindfors, Lisa; Lindmark, Hanna

2002-01-01

Volume rendering applications are used in medical imaging in order to facilitate the analysis of three-dimensional image data. This study focuses on how to improve the usability of graphical user interfaces of these systems, by gathering user requirements. This is achieved by evaluations of existing systems, together with interviews and observations at clinics in Sweden that use volume rendering to some extent. The usability of the applications of today is not sufficient, according to the use...

Impact Of Real-World Driving Characteristics On Vehicular Emissions

OpenAIRE

Nesamani, K S; Subramanian, K. P.

2005-01-01

With increase in traffic volume and change in travel related characteristics, vehicular emissions and energy consumption have increased significantly since two decades in India. Current models are not capable of estimating vehicular emissions accurately due to inadequate representation of real-world driving. The focus of this paper is to understand the level of Indian Driving cycle (IDC) in representing the real-world driving and to assess the impact of real-world driving on vehicular emissio...

Sixth international conference on electrical machines and drives

International Nuclear Information System (INIS)

1993-01-01

This volume contains 111 papers presented at the Sixth International Conference on Electrical Machines and Drives. The topics covered include: miniature and micro motors; induction motors; DC machines; reluctance motors; condition monitoring; synchronous machines and drives; induction machines; induction generators; simulation; design; and operating experience; linear machines; noise and vibration; special machines. Separate abstracts have been prepared for a paper on linear step motors for control rod drives and for a paper on a motor drive for gas filtration in gas-cooled reactors. (UK)

Spectroscopic AC susceptibility imaging (sASI) of magnetic nanoparticles

International Nuclear Information System (INIS)

Ficko, Bradley W.; Nadar, Priyanka M.; Diamond, Solomon G.

2015-01-01

This study demonstrates a method for alternating current (AC) susceptibility imaging (ASI) of magnetic nanoparticles (mNPs) using low cost instrumentation. The ASI method uses AC magnetic susceptibility measurements to create tomographic images using an array of drive coils, compensation coils and fluxgate magnetometers. Using a spectroscopic approach in conjunction with ASI, a series of tomographic images can be created for each frequency measurement set and is termed sASI. The advantage of sASI is that mNPs can be simultaneously characterized and imaged in a biological medium. System calibration was performed by fitting the in-phase and out-of-phase susceptibility measurements of an mNP sample with a hydrodynamic diameter of 100 nm to a Brownian relaxation model (R 2 =0.96). Samples of mNPs with core diameters of 10 and 40 nm and a sample of 100 nm hydrodynamic diameter were prepared in 0.5 ml tubes. Three mNP samples were arranged in a randomized array and then scanned using sASI with six frequencies between 425 and 925 Hz. The sASI scans showed the location and quantity of the mNP samples (R 2 =0.97). Biological compatibility of the sASI method was demonstrated by scanning mNPs that were injected into a pork sausage. The mNP response in the biological medium was found to correlate with a calibration sample (R 2 =0.97, p<0.001). These results demonstrate the concept of ASI and advantages of sASI. - Highlights: • Development of an AC susceptibility imaging model. • Comparison of AC susceptibility imaging (ASI) and susceptibility magnitude imaging (SMI). • Demonstration of ASI and spectroscopic ASI (sASI) using three different magnetic nanoparticle types. • SASI scan separation of three different magnetic nanoparticles samples using 5 spectroscopic frequencies. • Demonstration of biological feasibility of sASI

Electroporation of cells using EM induction of ac fields by a magnetic stimulator

International Nuclear Information System (INIS)

Chen, C; Robinson, M P; Evans, J A; Smye, S W; O'Toole, P

2010-01-01

This paper describes a method of effectively electroporating mammalian cell membranes with pulsed alternating-current (ac) electric fields at field strengths of 30-160 kV m -1 . Although many in vivo electroporation protocols entail applying square wave or monotonically decreasing pulses via needles or electrode plates, relatively few have explored the use of pulsed ac fields. Following our previous study, which established the effectiveness of ac fields for electroporating cell membranes, a primary/secondary coil system was constructed to produce sufficiently strong electric fields by electromagnetic induction. The primary coil was formed from the applicator of an established transcranial magnetic stimulation (TMS) system, while the secondary coil was a purpose-built device of a design which could eventually be implanted into tissue. The effects of field strength, pulse interval and cumulative exposure time were investigated using microscopy and flow cytometry. Results from experiments on concentrated cell suspensions showed an optimized electroporation efficiency of around 50%, demonstrating that electroporation can be practicably achieved by inducing such pulsed ac fields. This finding confirms the possibility of a wide range of in vivo applications based on magnetically coupled ac electroporation.

Electroporation of cells using EM induction of ac fields by a magnetic stimulator

Energy Technology Data Exchange (ETDEWEB)

Chen, C; Robinson, M P [Department of Electronics, University of York, Heslington, York YO10 5DD (United Kingdom); Evans, J A [Academic Unit of Medical Physics, University of Leeds, Leeds LS2 9JT (United Kingdom); Smye, S W [Department of Medical Physics and Engineering, Leeds Teaching Hospitals, St. James' s University Hospital, Leeds LS9 7TF (United Kingdom); O' Toole, P [Department of Biology, University of York, Heslington, York YO10 5DD (United Kingdom)

2010-02-21

This paper describes a method of effectively electroporating mammalian cell membranes with pulsed alternating-current (ac) electric fields at field strengths of 30-160 kV m{sup -1}. Although many in vivo electroporation protocols entail applying square wave or monotonically decreasing pulses via needles or electrode plates, relatively few have explored the use of pulsed ac fields. Following our previous study, which established the effectiveness of ac fields for electroporating cell membranes, a primary/secondary coil system was constructed to produce sufficiently strong electric fields by electromagnetic induction. The primary coil was formed from the applicator of an established transcranial magnetic stimulation (TMS) system, while the secondary coil was a purpose-built device of a design which could eventually be implanted into tissue. The effects of field strength, pulse interval and cumulative exposure time were investigated using microscopy and flow cytometry. Results from experiments on concentrated cell suspensions showed an optimized electroporation efficiency of around 50%, demonstrating that electroporation can be practicably achieved by inducing such pulsed ac fields. This finding confirms the possibility of a wide range of in vivo applications based on magnetically coupled ac electroporation.

A new method to estimate the atomic volume of ternary intermetallic compounds

International Nuclear Information System (INIS)

Pani, M.; Merlo, F.

2011-01-01

The atomic volume of an A x B y C z ternary intermetallic compound can be calculated starting from volumes of some proper A-B, A-C and B-C binary phases. The three methods by Colinet, Muggianu and Kohler, originally used to estimate thermodynamic quantities, and a new method here proposed, were tested to derive volume data in eight systems containing 91 ternary phases with the known structure. The comparison between experimental and calculated volume values shows the best agreement both for the Kohler method and for the new proposed procedure. -- Graphical abstract: Synopsys: the volume of a ternary intermetallic compound can be calculated starting from volumes of some binary phases, selected by the methods of Colinet, Muggianu, Kohler and a new method proposed here. The so obtained values are compared with the experimental ones for eight ternary systems. Display Omitted Research highlights: → The application of some thermodinamic methods to a crystallochemical problem. → The prevision of the average atomic volume of ternary intermetallic phases. → The proposal of a new procedure to select the proper starting set of binary phases.

Right ventricular volume estimation with cine MRI; A comparative study between Simpson's rule and a new modified area-length method

Energy Technology Data Exchange (ETDEWEB)

Sawachika, Takashi (Yamaguchi Univ., Ube (Japan). School of Medicine)

1993-04-01

To quantitate right ventricular (RV) volumes easily using cine MRI, we developed a new method called 'modified area-length method (MOAL method)'. To validate this method, we compared it to the conventional Simpson's rule. Magnetom H15 (Siemens) was used and 6 normal volunteers and 21 patients with various RV sizes were imaged with ECG triggered gradient echo method (FISP, TR 50 ms, TE 12 ms, slice thickness 9 mm). For Simpson's rule transverse images of 12 sequential views which cover whole heart were acquired. For the MOAL method, two orthogonal views were imaged. One was the sagittal view which includes RV outflow tract and the other was the coronal view defined from the sagittal image to cover the whole RV. From these images the area (As, Ac) of RV and the longest distance between RV apex and pulmonary valve (Lmax) were determined. By correlating RV volumes measured by Simpson's rule to As*Ac/Lmax the RV volume could be estimated as follows: V=0.85*As*Ac/Lmax+4.55. Thus the MOAL method demonstrated excellent accuracy to quantitate RV volume and the acquisition time abbreviated to one fifth compared with Simpson's rule. This should be a highly promising method for routine clinical application. (author).

Low Offset AC Correlator.

Science.gov (United States)

This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)

Modular PM Motor Drives for Automotive Traction Applications

International Nuclear Information System (INIS)

Su, G.J.

2001-01-01

This paper presents modular permanent magnet (PM) motor drives for automotive traction applications. A partially modularized drive system consisting of a single PM motor and multiple inverters is described. The motor has multiple three-phase stator winding sets and each winding set is driven with a separate three-phase inverter module. A truly modularized inverter and motor configuration based on an axial-gap PM motor is then introduced, in which identical PM motor modules are mounted on a common shaft and each motor module is powered by a separate inverter module. The advantages of the modular approach for both inverter and motor include: (1) power rating scalability-one design meets different power requirements by simply stacking an adequate number of modules, thus avoiding redesigning and reducing the development cost, (2) increased fault tolerance, and (3) easy repairing. A prototype was constructed by using two inverters and an axial-gap PM motor with two sets of three-phase stat or windings, and it is used to assist the diesel engine in a hybrid electric vehicle converted from a Chevrolet Suburban. The effect of different pulse-width-modulation strategies for both motoring and regenerative modes on current control is analyzed. Torque and regenerative control algorithms are implemented with a digital signal processor. Analytical and initial testing results are included in the paper

AC power supply systems

International Nuclear Information System (INIS)

Law, H.

1987-01-01

An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

AC susceptometry on the single-molecule magnet Ni{sub 2}Dy

Energy Technology Data Exchange (ETDEWEB)

Wendler, Pascal; Sundt, Alexander; Waldmann, Oliver [Physikalisches Institut, Universitaet Freiburg (Germany); Khan, Amin; Lan, Yanhua; Powell, Annie K. [Institute of Inorganic Chemistry, Karlsruhe Institute of Technology (Germany)

2013-07-01

Molecular nanomagnets are molecules which show novel and fascinating magnetic properties. The best known phenomenon is the observation of magnetic hysteresis on the molecular scale in the single-molecule magnets (SMMs), such as Mn{sub 12}ac. In addition, quantum mechanical effects, such as the tunneling of the magnetization, can be observed in bulk samples of SMMs. A key goal for understanding the underlying physics is the measurement of the magnetization dynamics, which can be accomplished using ac susceptometry. However, the magnetic moments of samples of SMMs are weak since the volume density of the magnetic ions is very small as compared to e.g. inorganic compounds. In this talk we will describe the construction of an ac susceptometer suitable for investigating molecular nanomagnets. A particular goal was to reach frequencies of the ac field of 100 kHz, extending the frequency range of commercial devices typically used in this research area by two decades. The device can be operated in the temperature range of 1.5 to 300 K and was characterized by comparing data recorded on Mn{sub 19} with available literature results. Lastly, we will present our experimental results on the novel SMM Ni{sub 2}Dy and discuss the different magnetic relaxation regimes observed in it.

6th international symposium on finite volumes for complex applications

CERN Document Server

Halama, Jan; Herbin, Raphaèle; Hubert, Florence; Fort, Jaroslav; FVCA 6; Finite Volumes for Complex Applications VI : Problems and perspectives

2011-01-01

Finite volume methods are used for various applications in fluid dynamics, magnetohydrodynamics, structural analysis or nuclear physics. A closer look reveals many interesting phenomena and mathematical or numerical difficulties, such as true error analysis and adaptivity, modelling of multi-phase phenomena or fitting problems, stiff terms in convection/diffusion equations and sources. To overcome existing problems and to find solution methods for future applications requires many efforts and always new developments. The goal of The International Symposium on Finite Volumes for Complex Applica

Analysis of application of alternative drive systems for international heavy-duty transport on Wroclaw-Dresden-Prague routes

Science.gov (United States)

Skrętowicz, Maria; Sroka, Zbigniew

2017-11-01

The depletion of the fossil fuels resources, significant increase of the air pollution caused by the use of internal combustion engines, and emission of carbon dioxide which is responsible for the greenhouse effect escalates the development of vehicle's alternative drive systems. Generally, the emphasis is given to the alternative fuels (natural gas CNG, mixture of propane-butane gases LPG, hydrogen, alcohol fuels, biofuels) and hybrid or electric vehicles. Roads between large industrial and commercial centres, i.e. Wroclaw - Dresden - Prague, are used mainly by heavy-duty vehicles. Consequently, the contribution of the road transport to the ecological threat in this realm is significant. The objectives of this research were the assessment of the traffic volume and emission rate of exhaust gases caused by heavy-duty vehicles on the analysed roads and evaluation of the possibility of using existing and alternative drive systems in vehicles driving on the roads in the analysed region.

Application of a flow generated by IR laser and AC electric field in micropumping and micromixing

International Nuclear Information System (INIS)

Nakano, M; Mizuno, A

2008-01-01

In this paper, it is described that measurement of fluid flow generated by simultaneous operation of an infrared (IR) laser and AC electric field in a microfabricated channel. When an IR laser (1026 nm) was focused under an intense AC electric field, a circulating flow was generated around the laser focus. The IR laser and the electric field generate two flow patterns of the electrohydrodynamicss. When the laser focus is placed at the center of the gap between electrodes, the flow pattern is parallel to the AC electric field toward electrodes from the centre. On the other hand, when the laser focus is placed close to one of the electrodes, one directional flow is generated. First flow pattern can be used as a micromixer and the second one as a micropump. Flow velocity profiles of the two flow patterns were measured as a function of the laser power, intensity of the AC electric field and AC frequency.

Usefulness of indirect alcohol biomarkers for predicting recidivism of drunk-driving among previously convicted drunk-driving offenders: results from the recidivism of alcohol-impaired driving (ROAD) study.

Science.gov (United States)

Maenhout, Thomas M; Poll, Anneleen; Vermassen, Tijl; De Buyzere, Marc L; Delanghe, Joris R

2014-01-01

In several European countries, drivers under the influence (DUI), suspected of chronic alcohol abuse are referred for medical and psychological examination. This study (the ROAD study, or Recidivism Of Alcohol-impaired Driving) investigated the usefulness of indirect alcohol biomarkers for predicting drunk-driving recidivism in previously convicted drunk-driving offenders. The ROAD study is a prospective study (2009-13) that was performed on 517 randomly selected drivers in Belgium. They were convicted for drunk-driving for which their licence was confiscated. The initial post-arrest blood samples were collected and analysed for percentage carbohydrate-deficient transferrin (%CDT), transaminsase activities [alanine amino transferase (ALT), aspartate amino transferase (AST)], gamma-glutamyltransferase (γGT) and red cell mean corpuscular volume (MCV). The observation time for each driver was 3 years and dynamic. A logistic regression analysis revealed that ln(%CDT) (P drunk-driving. The ROAD index (which includes ln(%CDT), ln(γGT), -ln(ALT) and the sex of the driver) was calculated and had a significantly higher area under the receiver operator characteristic curve (0.71) than the individual biomarkers for drunk-driving recidivism. Drivers with a high risk of recidivating (ROAD index ≥ 25%; third tertile) could be distinguished from drivers with an intermediate risk (16% ≤ ROAD index drunk-driving. The association with gamma-glutamyltransferase, alanine amino transferase and the sex of the driver could have additional value for identifying drunk-drivers at intermediate risk of recidivism. Non-specific indirect alcohol markers, such as alanine amino transferase, gamma-glutamyltransferase, aspartate amino transferase and red cell mean corpuscular volume have minimal added value to % carbohydrate-deficient transferrin for distinguishing drunk drivers with a low or high risk of recidivism. © 2013 Society for the Study of Addiction.

A Transformerless Medium Voltage Multiphase Motor Drive System

Directory of Open Access Journals (Sweden)

Dan Wang

2016-04-01

Full Text Available A multiphase motor has several major advantages, such as high reliability, fault tolerance, and high power density. It is a critical issue to develop a reliable and efficient multiphase motor drive system. In this paper, a transformerless voltage source converter-based drive system for a medium-voltage (MV multiphase motor is proposed. This drive converter employs cascaded H-bridge rectifiers loaded by H-bridge inverters as the interface between the grid and multiphase motor. The cascaded H-bridge rectifier technique makes the drive system able to be directly connected to the MV grid without the phase-shifting transformer because it can offset the voltage level gap between the MV grid and the semiconductor devices, provide near-sinusoidal AC terminal voltages without filters, and draw sinusoidal line current from the grid. Based on a digital signal processor (DSP, a complete improved Phase Disposition Pulse Width Modulation (PD-PWM method is developed to ensure the individual DC-link capacitor voltage balancing for enhancing the controllability and limiting the voltage and power stress on the H-bridge cells. A downscaled prototype is designed and developed based on a nine-phase motor. The experimental results verify the excellent performances of the proposed drive system and control strategy in steady-state and variant-frequency startup operations.

ACS Photometric Zero Point Verification

Science.gov (United States)

Dolphin, Andrew

2003-07-01

The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

SU-E-T-762: Toward Volume-Based Independent Dose Verification as Secondary Check

International Nuclear Information System (INIS)

Tachibana, H; Tachibana, R

2015-01-01

Purpose: Lung SBRT plan has been shifted to volume prescription technique. However, point dose agreement is still verified using independent dose verification at the secondary check. The volume dose verification is more affected by inhomogeneous correction rather than point dose verification currently used as the check. A feasibility study for volume dose verification was conducted in lung SBRT plan. Methods: Six SBRT plans were collected in our institute. Two dose distributions with / without inhomogeneous correction were generated using Adaptive Convolve (AC) in Pinnacle3. Simple MU Analysis (SMU, Triangle Product, Ishikawa, JP) was used as the independent dose verification software program, in which a modified Clarkson-based algorithm was implemented and radiological path length was computed using CT images independently to the treatment planning system. The agreement in point dose and mean dose between the AC with / without the correction and the SMU were assessed. Results: In the point dose evaluation for the center of the GTV, the difference shows the systematic shift (4.5% ± 1.9 %) in comparison of the AC with the inhomogeneous correction, on the other hands, there was good agreement of 0.2 ± 0.9% between the SMU and the AC without the correction. In the volume evaluation, there were significant differences in mean dose for not only PTV (14.2 ± 5.1 %) but also GTV (8.0 ± 5.1 %) compared to the AC with the correction. Without the correction, the SMU showed good agreement for GTV (1.5 ± 0.9%) as well as PTV (0.9% ± 1.0%). Conclusion: The volume evaluation for secondary check may be possible in homogenous region. However, the volume including the inhomogeneous media would make larger discrepancy. Dose calculation algorithm for independent verification needs to be modified to take into account the inhomogeneous correction

Data qualification summary for 1985 L-Area AC Flow Tests

International Nuclear Information System (INIS)

Edwards, T.B.; Eghbali, D.A.; Liebmann, M.L.; Shine, E.P.

1992-03-01

The 1985 L-Area AC Flow Tests were conducted to provide an extended data base for upgrading the reactor system models employed in predicting normal process water flows. This report summarizes the results of the recently completed, formal, technical review of the data from the 1985 L-Area AC Flow Tests as detailed in document SCS-CMAS-910045. The purpose of that review was to provide corroborating technical information as to the quality (fitness for use) of these experimental data. Reference [1] required three volumes to fully document the results of that Data Qualification process. This report has been prepared to provide the important conclusions from that process in a manageable and understandable format. Consult reference [1] if any additional information or detail is needed. This report provides highlights from that study: an overview of the tests and data, a description of the instrumentation used, an explanation of the data qualification methods employed to review the data, and the important conclusions reached from the study. Reference 1: Edwards, T.B., D.A. Eghbali, M.L. Liebmann, and E.P. Shine, open-quotes Data Qualification for 1985 L-Area AC Flow Tests,close quotes SCS-CMAS-910045, December 31, 1991

AC electric field induced vortex in laminar coflow diffusion flames

KAUST Repository

Xiong, Yuan

2014-09-22

Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.

AC electric field induced vortex in laminar coflow diffusion flames

KAUST Repository

Xiong, Yuan; Cha, Min; Chung, Suk-Ho

2014-01-01

Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.

A low-volume cavity ring-down spectrometer for sample-limited applications

Science.gov (United States)

Stowasser, C.; Farinas, A. D.; Ware, J.; Wistisen, D. W.; Rella, C.; Wahl, E.; Crosson, E.; Blunier, T.

2014-08-01

In atmospheric and environmental sciences, optical spectrometers are used for the measurements of greenhouse gas mole fractions and the isotopic composition of water vapor or greenhouse gases. The large sample cell volumes (tens of milliliters to several liters) in commercially available spectrometers constrain the usefulness of such instruments for applications that are limited in sample size and/or need to track fast variations in the sample stream. In an effort to make spectrometers more suitable for sample-limited applications, we developed a low-volume analyzer capable of measuring mole fractions of methane and carbon monoxide based on a commercial cavity ring-down spectrometer. The instrument has a small sample cell (9.6 ml) and can selectively be operated at a sample cell pressure of 140, 45, or 20 Torr (effective internal volume of 1.8, 0.57, and 0.25 ml). We present the new sample cell design and the flow path configuration, which are optimized for small sample sizes. To quantify the spectrometer's usefulness for sample-limited applications, we determine the renewal rate of sample molecules within the low-volume spectrometer. Furthermore, we show that the performance of the low-volume spectrometer matches the performance of the standard commercial analyzers by investigating linearity, precision, and instrumental drift.

Dynamic model tracking design for low inertia, high speed permanent magnet ac motors.

Science.gov (United States)

Stewart, P; Kadirkamanathan, V

2004-01-01

Permanent magnet ac (PMAC) motors have existed in various configurations for many years. The advent of rare-earth magnets and their associated highly elevated levels of magnetic flux makes the permanent magnet motor attractive for many high performance applications from computer disk drives to all electric racing cars. The use of batteries as a prime storage element carries a cost penalty in terms of the unladen weight of the vehicle. Minimizing this cost function requires the minimum electric motor size and weight to be specified, while still retaining acceptable levels of output torque. This tradeoff can be achieved by applying a technique known as flux weakening which will be investigated in this paper. The technique allows the speed range of a PMAC motor to be greatly increased, giving a constant power range of more than 4:1. A dynamic model reference controller is presented which has advantages in ease of implementation, and is particularly suited to dynamic low inertia applications such as clutchless gear changing in high performance electric vehicles. The benefits of this approach are to maximize the torque speed envelope of the motor, particularly advantageous when considering low inertia operation. The controller is examined experimentally, confirming the predicted performance.

FLUIDIC AC AMPLIFIERS.

Science.gov (United States)

Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems

Analysis of Wheel Hub Motor Drive Application in Electric Vehicles

Directory of Open Access Journals (Sweden)

Sun Yuechao

2017-01-01

Full Text Available Based on the comparative analysis of the performance characteristics of centralized and distributed drive electric vehicles, we found that the wheel hub motor drive mode of the electric vehicles with distributed drive have compact structure, high utilization ratio of interior vehicle space, lower center of vehicle gravity, good driving stability, easy intelligent control and many other advantages, hence in line with the new requirements for the development of drive performance of electric vehicles, and distributed drive will be the ultimate mode of electric vehicles in the future.

Effects of AC Electric Field on Small Laminar Nonpremixed Flames

KAUST Repository

Xiong, Yuan

2015-01-01

Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received

Application of evolutionary algorithm methods to polypeptide folding: comparison with experimental results for unsolvated Ac-(Ala-Gly-Gly)5-LysH+

DEFF Research Database (Denmark)

Damsbo, Martin; Kinnear, Brian S; Hartings, Matthew R

2004-01-01

We present an evolutionary method for finding the low-energy conformations of polypeptides. The application, called FOLDAWAY,is based on a generic framework and uses several evolutionary operators as well as local optimization to navigate the complex energy landscape of polypeptides. It maintains...... mobility measurements. It has a flat energy landscape where helical and globular conformations have similar energies. FOLDAWAY locates several large groups of structures not found in previous molecular dynamics simulations for this peptide, including compact globular conformations, which are probably...... two complementary representations of the structures and uses the CHARMM force field for evaluating the energies. The method is applied to unsolvated Met-enkephalin and Ac-(Ala-Gly-Gly)(5)-Lys(+)H(+). Unsolvated Ac-(Ala-Gly-Gly)(5)-Lys(+)H(+) has been the object of recent experimental studies using ion...

78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

Science.gov (United States)

2013-08-13

...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...

Enhanced DC-Link Capacitor Voltage Balancing Control of DC–AC Multilevel Multileg Converters

DEFF Research Database (Denmark)

Busquets-Monge, Sergio; Maheshwari, Ram Krishan; Nicolas-Apruzzese, Joan

2015-01-01

This paper presents a capacitor voltage balancing control applicable to any multilevel dc–ac converter formed by a single set of series-connected capacitors implementing the dc link and semiconductor devices, such as the diode-clamped topology. The control is defined for any number of dc-link vol......This paper presents a capacitor voltage balancing control applicable to any multilevel dc–ac converter formed by a single set of series-connected capacitors implementing the dc link and semiconductor devices, such as the diode-clamped topology. The control is defined for any number of dc...

Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious

International Nuclear Information System (INIS)

Fang Minggang; Nie, Yingchao; Theilmann, David A.

2009-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.

Development of a hardware-based AC microgrid for AC stability assessment

Science.gov (United States)

Swanson, Robert R.

As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

Impact Strength of Composite Materials Based on EN AC-44200 Matrix Reinforced with Al2O3 Particles

Directory of Open Access Journals (Sweden)

Kurzawa A.

2017-09-01

Full Text Available The paper presents the results of research of impact strength of aluminum alloy EN AC-44200 based composite materials reinforced with alumina particles. The research was carried out applying the materials produced by the pressure infiltration method of ceramic preforms made of Al2O3 particles of 3-6μm with the liquid EN AC-44200 Al alloy. The research was aimed at determining the composite resistance to dynamic loads, taking into account the volume of reinforcing particles (from 10 to 40% by volume at an ambient of 23°C and at elevated temperatures to a maximum of 300°C. The results of this study were referred to the unreinforced matrix EN AC-44200 and to its hardness and tensile strength. Based on microscopic studies, an analysis and description of crack mechanics of the tested materials were performed. Structural analysis of a fracture surface, material structures under the crack surfaces of the matrix and cracking of the reinforcing particles were performed.

AC losses and stability on large cable-in-conduit superconductors

Science.gov (United States)

Bruzzone, Pierluigi

1998-12-01

The cable-in-conduit superconductors are preferred for applications where the AC losses and stability are a major concern, e.g., fusion magnets and SMES. A review of coupling currents loss results for both NbTi and Nb 3Sn cable-in-conduit conductors (CICC) is presented and the AC loss relevant features are listed, with special emphasis for the role of the interstrand resistance and strand coating. The transient stability approach for CICCs is discussed and the analytical models are quoted as well as the relevant experimental database. The likely spectrum of transient disturbance in CICC is reviewed and the need to account for interstrand current sharing in the design is outlined. Eventually a practical criterion for the interstrand resistance is proposed to link the stability and AC loss design.

A CMOS AC/DC charge pump for a wireless sensor network

International Nuclear Information System (INIS)

Zhang Qiang; Ni Weining; Shi Yin; Yu Yude

2012-01-01

An AC/DC charge pump implemented with MOS FETs has been presented for wireless sensor network applications. The proposed AC/DC charge pump can generate a stable output with low power dissipation and high pumping efficiency, which has been implemented in 0.13 μm CMOS technology. The proposed charge pump employs MOSFET diodes with low thresholds, and improves the conversion efficiency. The analytical model of the voltage multiplier, the simulation results, and the chip testing results are presented.

Design Considerations of a Transverse Flux Machine for Direct-Drive Wind Turbine Applications: Preprint

Energy Technology Data Exchange (ETDEWEB)

Husain, Tausif; Hasan, Iftekhar; Sozer, Yilmaz; Husain, Iqbal; Muljadi, Eduard

2017-01-01

This paper presents the design considerations of a double-sided transverse flux machine (TFM) for direct-drive wind turbine applications. The TFM has a modular structure with quasi-U stator cores and ring windings. The rotor is constructed with ferrite magnets in a flux-concentrating arrangement to achieve high air gap flux density. The design considerations for this TFM with respect to initial sizing, pole number selection, key design ratios, and pole shaping are presented in this paper. Pole number selection is critical in the design process of a TFM because it affects both the torque density and power factor under fixed magnetic and changing electrical loading. Several key design ratios are introduced to facilitate the design procedure. The effect of pole shaping on back-emf and inductance is also analyzed. These investigations provide guidance toward the required design of a TFM for direct-drive applications. The analyses are carried out using analytical and three-dimensional finite element analysis. A prototype is under construction for experimental verification.

Hysteresis losses in MgB{sub 2} superconductors exposed to combinations of low AC and high DC magnetic fields and transport currents

Energy Technology Data Exchange (ETDEWEB)

Magnusson, N., E-mail: niklas.magnusson@sintef.no [SINTEF Energy Research, NO-7465 Trondheim (Norway); Abrahamsen, A.B. [DTU Wind Energy, Technical University of Denmark, DK-4000 Roskilde (Denmark); Liu, D. [Electrical Power Processing Group, TU Delft, Mekelweg 4, NL-2628 CD Delft (Netherlands); Runde, M. [SINTEF Energy Research, NO-7465 Trondheim (Norway); Polinder, H. [Electrical Power Processing Group, TU Delft, Mekelweg 4, NL-2628 CD Delft (Netherlands)

2014-11-15

Highlights: • A method for calculating hysteresis losses in the low AC – high DC magnetic field and transport current range has been shown. • The method can be used in the design of wind turbine generators for calculating the losses in the generator DC rotor. • First estimates indicate tolerable current ripple in the 0.1% range for a 4 T DC MgB{sub 2} generator rotor coil. - Abstract: MgB{sub 2} superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must be evaluated in the design of the generator to ensure a sufficient overall efficiency. A major loss component is the hysteresis losses in the superconductor itself. In the high DC – low AC current and magnetic field region experimental results still lack for MgB{sub 2} conductors. In this article we reason towards a simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting equations use the DC in-field critical current, the geometry of the superconductor and the magnitude of the AC magnetic field component as parameters. This simplified approach can be valuable in the design of MgB{sub 2} DC coils in the 1–4 T range with low AC magnetic field and current ripples.

8th conference on Finite Volumes for Complex Applications

CERN Document Server

Omnes, Pascal

2017-01-01

This first volume of the proceedings of the 8th conference on "Finite Volumes for Complex Applications" (Lille, June 2017) covers various topics including convergence and stability analysis, as well as investigations of these methods from the point of view of compatibility with physical principles. It collects together the focused invited papers comparing advanced numerical methods for Stokes and Navier–Stokes equations on a benchmark, as well as reviewed contributions from internationally leading researchers in the field of analysis of finite volume and related methods, offering a comprehensive overview of the state of the art in the field. The finite volume method in its various forms is a space discretization technique for partial differential equations based on the fundamental physical principle of conservation, and recent decades have brought significant advances in the theoretical understanding of the method. Many finite volume methods preserve further qualitative or asymptotic properties, including m...

Prospects for HTS applications

International Nuclear Information System (INIS)

Gamble, B.B.; Snitchler, G.L.; Schwall, R.E.

1996-01-01

High temperature superconductor (HTS) wire is rapidly maturing into a working material being produced in ever larger quantities and being used in more significant demonstrations and prototypes. Conductor is now produced routinely in several hundred meter lengths with reproducible results. Current density has progressed to a level suitable for demonstration of many applications. Wire strength has improved and large prototypes fabricated or under consideration using HTS include Superconducting Magnetic Energy Storage (SMES), rotating electrical machines including synchronous ac and dc homopolar motors and drives, generators and condensers, underground transmission cables, utility distribution equipment such as transformers and current limiters, commercial processing applications such as magnetic separation, and specialty magnets such as high field inserts. In this paper the requirements, progress toward these requirements, and the prospects for the future are reviewed

Modelling and Design of Active Thermal Controls for Power Electronics of Motor Drive Applications

DEFF Research Database (Denmark)

Vernica, Ionut; Blaabjerg, Frede; Ma, Ke

2017-01-01

of active thermal control methods for the power devices of a motor drive application. The motor drive system together with the thermal cycling of the power devices have been modelled, and adverse temperature swings could be noticed during the start-up and deceleration periods of the motor. Based...... on the electrical response of the system, the junction temperature of the semiconductor devices is estimated, and consequently three active thermal control methods are proposed and practically designed with respect to the following parameters: switching frequency, deceleration slope and modulation technique....... Finally, experimental results are provided in order to validate the effectiveness of the proposed control methods....

A New Servo Control Drive for Electro Discharge Texturing System Industrial Applications Using Ultrasonic Technology

Directory of Open Access Journals (Sweden)

M. Shafik

2013-07-01

Full Text Available This paper presents a new ultrasonic servo control drive for electro discharge texturing system industrial applications. The new drive is aiming to overcome the current teething issues of the existing electro discharge texturing system, servo control drive level of precision, processing stability, dynamic response and surface profile of the machined products. The new ultrasonic servo control drive consists of three main apparatuses, an ultrasonic motor, electronic driver and control unit. The ultrasonic motor consists of three main parts, the stator, rotor and sliding element. The motor design process, basic configuration, principles of motion, finite element analysis and experimental examination of the main characteristics is discussed in this paper. The electronic driver of the motor consists of two main stages which are the booster and piezoelectric amplifier. The experimental test and validation of the developed servo control drive in electro discharge texturing platform is also discussed and presented in this paper. The initial results showed that the ultrasonic servo control drive is able to provide: a bidirectional of motion, a resolution of <50μm and a dynamic response of <10msec. The electron microscopic micro examination into the textured samples showed that: a clear improvement in machining stability, products surface profile, a notable reduction in the processing time, arcing and short-circuiting teething phenomena.

THE CALCULATION OF THE ENERGY RECOVERY ELECTRIFIED URBAN TRANSPORT DURING THE INSTALLATION DRIVE FOR TRACTION SUBSTATION

Directory of Open Access Journals (Sweden)

A. A. Sulim

2014-01-01

Full Text Available At present a great attention is paid to increasing of energy efficiency at operated electrified urban transport. Perspective direction for increasing energy efficiency at that type of transport is the application of regenerative braking. For additional increasing of energy efficiency there were suggested the use of capacitive drive on tires of traction substation. One of the main task is the analysis of energy recovery application  with drive and without it.These analysis demonstrated that the calculation algorithms don’t allow in the full volume to carry out calculations of amount and cost of energy recovery without drive and with it. That is why we see the current interest to this topic. The purpose of work is to create methods of algorithms calculation for definite amount and cost of consumed, redundant and recovery energy of electrified urban transport due to definite regime of motion on wayside. There is algorithm developed, which allow to calculate amount and cost of consumed, redundant and recovery energy of electrified urban transport on wayside during the installation capacitive drive at traction substation. On the basis of developed algorithm for the definite regime of wagon motion of subway there were fulfilled the example of energy recovery amount and its cost calculation, among them with limited energy intensity drive, when there are 4 trains on wayside simultaneously.

Modeling photovoltaic systems for AC appliances

Directory of Open Access Journals (Sweden)

Andreea Maria Neaca

2009-10-01

Full Text Available In this paper is described the development of a model which can simulate the performance of a photovoltaic (PV system under specific meteorological conditions and transforming the DC current into AC current. In this model, the accent stands on the design of a series charge regulator. It is treated also the benefit of creating a circuit, with different methods, that can test the maximum power point trackers (MPPT for different photovoltaic applications.

Application of Face-Gear Drives in Helicopter Transmissions

Science.gov (United States)

Litvin, F. L.; Wang, J.-C.; Bossler, R. B., Jr.; Chen, Y.-J. D.; Heath, G.; Lewicki, D. G.

1992-01-01

The use of face gears in helicopter transmissions was explored. A light-weight, split torque transmission design utilizing face gears was described. Face-gear design and geometry were investigated. Topics included tooth generation, limiting inner and outer radii, tooth contact analysis, contact ratio, gear eccentricity, and structural stiffness. Design charts were developed to determine minimum and maximum face-gear inner and outer radii. Analytical study of transmission error showed face-gear drives were relatively insensitive to gear misalignment, but tooth contact was affected by misalignment. A method of localizing bearing contact to compensate for misalignment was explored. The proper choice of shaft support stiffness enabled good load sharing in the split torque transmission design. Face-gear experimental studies were also included and the feasibility of face gears in high-speed, high-load applications such as helicopter transmissions was demonstrated.

AC Electric Field Communication for Human-Area Networking

Science.gov (United States)

Kado, Yuichi; Shinagawa, Mitsuru

We have proposed a human-area networking technology that uses the surface of the human body as a data transmission path and uses an AC electric field signal below the resonant frequency of the human body. This technology aims to achieve a “touch and connect” intuitive form of communication by using the electric field signal that propagates along the surface of the human body, while suppressing both the electric field radiating from the human body and mutual interference. To suppress the radiation field, the frequency of the AC signal that excites the transmitter electrode must be lowered, and the sensitivity of the receiver must be raised while reducing transmission power to its minimally required level. We describe how we are developing AC electric field communication technologies to promote the further evolution of a human-area network in support of ubiquitous services, focusing on three main characteristics, enabling-transceiver technique, application-scenario modeling, and communications quality evaluation. Special attention is paid to the relationship between electro-magnetic compatibility evaluation and regulations for extremely low-power radio stations based on Japan's Radio Law.

Estimating BrAC from transdermal alcohol concentration data using the BrAC estimator software program.

Science.gov (United States)

Luczak, Susan E; Rosen, I Gary

2014-08-01

Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.

Smartphone Based Approach For Monitoring Inefficient And Unsafe Driving Behavior And Recognizing Drink And Drive Conditions.

Directory of Open Access Journals (Sweden)

G. V. Mane

2015-08-01

Full Text Available Many automobile drivers having knowledge of the driving behaviours and habits that can lead to inefficient and unsafe driving. However it is often the case that these same drivers unknowingly manifest these inefficient and unsafe driving behaviours in their everyday driving activity. The proposed system proposes a practical and economical way to capture measure and alert drives of inefficient and unsafe driving as well as highly efficient system aimed at early detection and alert of dangerous vehicle maneuvers typically related to drunk driving. The upcoming solution consists of a mobile application running on a modern smartphone device paired with a compatible OBDII On-board diagnostics II reader.

The feasibility of 225Ac as a source of α-particles in radioimmunotherapy

International Nuclear Information System (INIS)

Geerlings, M.W.; Hout, R. van der; Kaspersen, F.M.; Apostolides, C.

1993-01-01

This paper proposes the utilization of 225 Ac for the α-radioimmunotherapy of cancer. The isotope decays with a radioactive half-life of 10 days into a cascade of short-lived α-and β-emitting isotopes. In addition, when indicated by the pharmacokinetic requirements of particular clinical applications, 213 Bi, with a radioactive half-life of 47 min, can be chosen as an alternative source of α-particles in radioimmunotherapy. This isotope is the last α emitter in the 225 Ac decay-cascade and can be extracted from a 225 Ac source at the bedside of the patient. 225 Ac can quasi ad infinitum be obtained from one of its precursors, 229 Th, which can be made available by various means. The indications for the use of α-particles as an alternative to more traditional classes of radiation are derived from the particle-kinetic characteristics and the radioactive half-life of their source isotope, as well as from the properties of the target-selective carrier moiety for the source isotope. It may be expected that useful applications, complementary to and/or in conjunction with other means of therapy will be identified. (author)

Investigation of Drive-Reinforcement Learning and Application of Learning to Flight Control

Science.gov (United States)

1993-08-01

WL-TR-93-1153 INVESTIGATION OF DRIVE-REINFORCEMEN% LEARNING AND APPLICATION OF LEARNING TO FLIGHT CONTROL AD-A277 442 WALTER L. BAKER (ED), STEPHEN ...OF LEARNING TO FUIGHT CONTROL PE 62204 ___ ___ ___ ___ __ ___ ___ ___ ___ ___ ___ __ PR 2003 6. AUTHOR(S) TA 05 WALTER L. BAKER (ED), STEPHEN C. ATKINS...34 Computers and Thought, E. A. Freigenbaum and J. Feldman (eds.), Mc- Graw Hill, New York, (1959). [19] Holland, J. H., "Escaping Brittleness: The Possibility

Clinical application of AcMAR (accelerated multiple-arc radiotherapy) for head and neck tumors. Results of a randomized, two-dose study in Kitami Red-Cross General Hospital

International Nuclear Information System (INIS)

Arimoto, Takuro; Yamazaki, Akira; Yonesaka, Akio; Matsuzawa, Tooru; Kanai, Naoki

2003-01-01

Enhanced acute mucositis is the limiting factor for accelerated, hyperfractionated radiotherapy in head and neck (H and N) squamous cell carcinomas (SCCs). We have developed a simple, new form of conformal radiotherapy, accelerated multiple arc radiotherapy (AcMAR), which covers the target volume by combined, segmental, and rotational arc fields. Two to three rotational fields were placed with CT guidance, each covering the primary tumor and lymph nodes separately. The optimal inter-isocenter distance was determined by 3D dose calculation. The surface area of oro-pharyngeal mucosa irradiated by more than a 50% dose by this method was reduced by 37-73% compared to that with a conventional parallel opposing technic. Dose searching, randomized two-dose study was initiated in Kitami Red-cross General Hospital (KRCGH) in January 1995, and 101 patients were registered and completed AcMAR in Oct 2000. All the patients were followed for up to 96 months (24-96 mo, median 48 mo) at the time of analysis. Fifty-one out of 101 patients were Stage III (17) and IV (34). Primary site of tumors were; 38 larynx, 25 oropharynx, 15 hypopharynx, 13 oral cavity, and 10 other miscellaneous sites. Patients were randomly allocated either to 60 Gy/24 fr/bid/3 wks to gross tumor volume (GTV) (Group A), or 66 Gy/33 fr/bid/4 wks to GTV (Group B). Forty Gy/16 fr/bid/2 wks was given to the volume of prophylactic'' irradiation in both groups of patients. Results were as follows: All the patients, except for one, completed AcMAR without treatment interruption. Acute mucositis at the site of high-dose irradiation was intense; 72% of Group A and 62.5% of Group B experienced World Health Organization (WHO) Grade 3 (confluent) mucositis focally. Fifty-one out of 53 in Group A and 48/48 in Group B, however, could maintain oral food intake (WHO Grade 1 or 2) even at the peak of their mucositis, because of the limited area of severe mucositis. With regard to late morbidity, however, 6/46 (followed >24 mo

Parallel and series 4 switch Z-source converters in induction motor drives

DEFF Research Database (Denmark)

Baba, Mircea; Lascu, Cristian; Boldea, Ion

2014-01-01

This paper presents a control strategy for four switch three-phase Z-source Inverter with parallel and series Z-source network fed 0.5 kW induction motor drive with V/f control and the algorithm to control the dc boost, split capacitor voltage balance and the ac output voltage. The proposed control...... algorithm is validated through simulation and experiment....

Effect of substrate temperature on ac conduction properties of amorphous and polycrystalline GaSe thin films

International Nuclear Information System (INIS)

Thamilselvan, M.; PremNazeer, K.; Mangalaraj, D.; Narayandass, Sa.K.; Yi, Junsin

2004-01-01

X-ray diffraction analysis of GaSe thin films used in the present investigation showed that the as-deposited and the one deposited at higher substrate temperature are in amorphous and polycrystalline state, respectively. The alternating current (ac) conduction properties of thermally evaporated films of GaSe were studied ex situ employing symmetric aluminium ohmic electrodes in the frequency range of 120-10 5 Hz at various temperature regimes. For the film deposited at elevated substrate temperature (573 K) the ac conductivity was found to increase with improvement of its crystalline structure. The ac conductivity (σ ac ) is found to be proportional to (ω s ) where s m calculated from ac conductivity measurements are compared with optical studies of our previous reported work for a-GaSe and poly-GaSe thin films. The distance between the localized centres (R), activation energy (ΔE σ ) and the number of sites per unit energy per unit volume N(E F ) at the Fermi level were evaluated for both a-GaSe and poly-GaSe thin films. Goswami and Goswami model has been invoked to explain the dependence of capacitance on frequency and temperature

i3Drive, a 3D interactive driving simulator.

Science.gov (United States)

Ambroz, Miha; Prebil, Ivan

2010-01-01

i3Drive, a wheeled-vehicle simulator, can accurately simulate vehicles of various configurations with up to eight wheels in real time on a desktop PC. It presents the vehicle dynamics as an interactive animation in a virtual 3D environment. The application is fully GUI-controlled, giving users an easy overview of the simulation parameters and letting them adjust those parameters interactively. It models all relevant vehicle systems, including the mechanical models of the suspension, power train, and braking and steering systems. The simulation results generally correspond well with actual measurements, making the system useful for studying vehicle performance in various driving scenarios. i3Drive is thus a worthy complement to other, more complex tools for vehicle-dynamics simulation and analysis.

Using PBL to Improve Educational Outcomes and Student Satisfaction in the Teaching of DC/DC and DC/AC Converters

Science.gov (United States)

Martinez-Rodrigo, Fernando; Herrero-De Lucas, Luis Carlos; de Pablo, Santiago; Rey-Boue, Alexis B.

2017-01-01

This paper examines the question of how to use project-based learning to increase student performance and satisfaction in a power electronics course addressing the topics of dc/dc and dc/ac converters, the assembly of a dc/dc converter, and the use of a commercial speed drive. A detailed presentation of the methodology is shown, and the results…

AC quantum voltmeter for the industry; AC-Quantenvoltmeter fuer die Industrie

Energy Technology Data Exchange (ETDEWEB)

Behr, Ralf [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Arbeitsgruppe 2.63 ' ' Josephson-Effekt, Spannung' ' ; Smandek, Bernhard [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Arbeitsgruppe Q.33 ' ' Technologietransfer' '

2016-09-15

In a first part difficulties and challenges of the novel operation principle, the ''differential scanning system'' are discussed and explained, how with highest metrological precision the proof of principle succeeded. By common research with other national metrology institutes the concept was consolidated and improved. In a second part it was exemplarically illuminated, how by an efficient dovetailing of European and national promotion programs with different application neighbourhood consolidated knowledge of basic metrological research could be transferred to economy and especially small and medium companies. With an AC quantum voltmeter up to 10 V and 1 kHz already a unique commercial device is available. How the development foreseeable goes on illuminates the final part of the article.

e73.pdf.pdf | 92 | OnlineResources | jgenet | www.ias.ac.in | http ...

Indian Academy of Sciences (India)

Home; public; Volumes; jgen; 092; online; http; www.ias.ac.in; jgenet; OnlineResources; 92; e73.pdf.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 ...

The application of volume-outcome contouring in data warehousing.

Science.gov (United States)

Studnicki, James; Berndt, Donald J; Luther, Stephen L; Fisher, John W

2004-01-01

Despite a compelling body of published research on the nature of provider volume and clinical outcomes, healthcare executives and policymakers have not managed to develop and implement systems that are useful in directing patients to higher volume providers via selective referral or avoidance. A specialized data warehouse application, utilizing hospital discharge data linked to physician biographical information, allows detailed analysis of physician and hospital volume and the resulting pattern (contour) of related outcomes such as mortality, complications, and medical errors. The approach utilizes a historical repository of hospital discharge data in which the outcomes of interest, important patient characteristics and risk factors used in severity-adjusting of the outcomes are derived from the coding structure of the data.

Testing of a direct drive generator for wind turbines

Energy Technology Data Exchange (ETDEWEB)

Sondergaard, L.M. [Riso National Laboratory, Roskilde (Denmark)

1996-12-31

The normal drive train of a wind turbine consists a gearbox and a 4 to 8 poles asynchronous generator. The gearbox is an expensive and unreliable components and this paper deals with testing of a direct drive synchronous generator for a gearless wind turbine. The Danish company Belt Electric has constructed and manufactured a 27 kW prototype radial flux PM-generator (DD600). They have used cheap hard ferrite magnets in the rotor of this PM-generator. This generator has been tested at Riso and the test results are investigated and analyzed in this paper. The tests have been done with three different load types (1: resistance; 2: diode rectifier, DC-capacitor, resistance; 3: AC-capacitor, diode rectifier, DC-capacitor, resistance). 1 ref., 9 figs., 5 tabs.

Method of driving liquid flow at or near the free surface using magnetic microparticles

Science.gov (United States)

Snezhko, Oleksiy [Woodridge, IL; Aronson, Igor [Darien, IL; Kwok, Wai-Kwong [Evanston, IL; Belkin, Maxim V [Woodridge, IL

2011-10-11

The present invention provides a method of driving liquid flow at or near a free surface using self-assembled structures composed of magnetic particles subjected to an external AC magnetic field. A plurality of magnetic particles are supported at or near a free surface of liquid by surface tension or buoyancy force. An AC magnetic field traverses the free surface and dipole-dipole interaction between particles produces in self-assembled snake structures which oscillate at the frequency of the traverse AC magnetic field. The snake structures independently move across the free surface and may merge with other snake structures or break up and coalesce into additional snake structures experiencing independent movement across the liquid surface. During this process, the snake structures produce asymmetric flow vortices across substantially the entirety of the free surface, effectuating liquid flow across the free surface.

RHIC spin flipper AC dipole controller

Energy Technology Data Exchange (ETDEWEB)

Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

2011-03-28

The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

Disturbance observer based current controller for vector controlled IM drives

DEFF Research Database (Denmark)

Teodorescu, Remus; Dal, Mehmet

2008-01-01

induction motor (IM) drives. The control design, based on synchronously rotating d-q frame model of the machine, has a simple structure that combines the proportional portion of a conventional PI control and output of the observer. The observer is predicted to estimate the disturbances caused by parameters...... coupling effects and increase robustness against parameters change without requiring any other compensation strategies. The experimental implementation results are provided to demonstrate validity and performance of the proposed control scheme.......In order to increase the accuracy of the current control loop, usually, well known parameter compensation and/or cross decoupling techniques are employed for advanced ac drives. In this paper, instead of using these techniques an observer-based current controller is proposed for vector controlled...

Comparative analyses of the neuron numbers and volumes of the amygdaloid complex in old and new world primates.

Science.gov (United States)

Carlo, C N; Stefanacci, L; Semendeferi, K; Stevens, C F

2010-04-15

The amygdaloid complex (AC), a key component of the limbic system, is a brain region critical for the detection and interpretation of emotionally salient information. Therefore, changes in its structure and function are likely to provide correlates of mood and emotion disorders, diseases that afflict a large portion of the human population. Previous gross comparisons of the AC in control and diseased individuals have, however, mainly failed to discover these expected correlations with diseases. We have characterized AC nuclei in different nonhuman primate species to establish a baseline for more refined comparisons between the normal and the diseased amygdala. AC nuclei volume and neuron number in 19 subdivisions are reported from 13 Old and New World primate brains, spanning five primate species, and compared with corresponding data from humans. Analysis of the four largest AC nuclei revealed that volume and neuron number of one component, the central nucleus, has a negative allometric relationship with total amygdala volume and neuron number, which is in contrast with the isometric relationship found in the other AC nuclei (for both neuron number and volume). Neuron density decreases across all four nuclei according to a single power law with an exponent of about minus one-half. Because we have included quantitative comparisons with great apes and humans, our conclusions apply to human brains, and our scaling laws can potentially be used to study the anatomical correlates of the amygdala in disorders involving pathological emotion processing. (c) 2009 Wiley-Liss, Inc.

Fiscal 1999 research and development of technologies for practical application of photovoltaic power generation systems. Research and development of photovoltaic power utilizing system and peripheral technologies (Study of peripheral device for AC module); 1999 nendo taiyoko hatsuden system jitsuyoka gijutsu kaihatsu seika hokokusho. Taiyoko hatsuden riyo system shuhen gijutsu no kenkyu kaihatsu (AC module yo shuhen sochi no kenkyu)

Energy Technology Data Exchange (ETDEWEB)

NONE

2000-03-01

For widening the application of photovoltaic power generation, the AC (alternating current) module technology was examined for validity, and effective ways to utilize the technology and tasks to solve for its further development were studied. In fiscal 1999, concerning the validity of the AC module technology, it was shown quantitatively that attention should be paid to the inhibition of radio interference although the AC module was the more advantageous when under the influence of shadow. In the study of various measures for utilizing the technology, it was shown that, although the technology contained many tasks to discharge, such as need for downsizing and cost reduction, improvement on environmental resistance, and the prevention of radio interference, yet it had many advantages expected to turn up in the future, such as reduced influence of shadow, high flexibility in system design, and decreased installation cost. In the study of technical tasks to discharge in the course of development, it was stated that AC module integrated inverters (MICs) were already on the market, that an autonomous distributed type system control method suited the purpose of AC module systems, and that it was important to develop a thin MIC technology for application in the next generation. (NEDO)

Design principle for improved three-dimensional ac electro-osmotic pumps

Science.gov (United States)

Burch, Damian; Bazant, Martin Z.

2008-05-01

Three-dimensional (3D) ac electro-osmotic (ACEO) pumps have recently been developed that are much faster and more robust than previous planar designs. The basic idea is to create a “fluid conveyor belt” by placing opposing ACEO slip velocities at different heights. Current designs involve electrodes with electroplated steps, whose heights have been optimized in simulations and experiments. Here, we consider changing the boundary conditions—rather than the geometry—and predict that flow rates can be further doubled by fabricating 3D features with nonpolarizable materials. This amplifies the fluid conveyor belt by removing opposing flows on the vertical surfaces, and it increases the slip velocities that drive the flow.

Impact Strength of Composite Materials Based on EN AC-44200 Matrix Reinforced with Al2O3 Particles

OpenAIRE

Kurzawa A.; Kaczmar J.W.

2017-01-01

The paper presents the results of research of impact strength of aluminum alloy EN AC-44200 based composite materials reinforced with alumina particles. The research was carried out applying the materials produced by the pressure infiltration method of ceramic preforms made of Al2O3 particles of 3-6μm with the liquid EN AC-44200 Al alloy. The research was aimed at determining the composite resistance to dynamic loads, taking into account the volume of reinforcing particles (from 10 to 40% by ...

Design of an Axial-Flux permanent magnet machine for an in-wheel direct drive application

NARCIS (Netherlands)

Bastiaens, K.; Jansen, J.W.; Jumayev, S.; Lomonova, E.A.

2017-01-01

This paper concerns the optimization and comparison of six different axial-flux permanent magnet (AFPM) machine topologies for an in-wheel direct drive application. The objective of the optimization is to reach maximum power density, which is of essence for an in-wheel motor. The machine topologies

Performance improvement of a slip energy recovery drive system by a voltage-controlled technique

Energy Technology Data Exchange (ETDEWEB)

Tunyasrirut, Satean [Department of Instrumentation Engineering, Faculty of Engineering, Pathumwan Institute of Technology, 833 Rama1 Road, Pathumwan, Bangkok 10330 (Thailand); Kinnares, Vijit [Department of Electrical Engineering, Faculty of Engineering, King Mongkut' s Institute of Technology Ladkrabang, Bangkok 10520 (Thailand); Ngamwiwit, Jongkol [Department of Control Engineering, Faculty of Engineering, King Mongkut' s Institute of Technology Ladkrabang, Bangkok 10520 (Thailand)

2010-10-15

This paper introduces the performance improvement of a slip energy recovery drive system for the speed control of a wound rotor induction motor by a voltage-controlled technique. The slip energy occurred in the rotor circuit is transferred back to ac mains supply through a reactor instead of a step up transformer. The objective of the voltage-controlled technique is to increase power factor of the system and to reduce low order harmonics of the input line current. The drive system is designed and implemented using a voltage source inverter in conjunction with a boost chopper for DC link voltage, instead of a conventional drive using a 6 pulse converter or a Scherbius system. The slip power is recovered by the help of a voltage source inverter (VSI) based on a space vector pulse width modulation (SVPWM) technique. In order to keep the speed of the wound rotor induction motor constant over a certain range of operating conditions, the servo state feedback controller designed by a linear quadratic regulator (LQR) is also introduced in this paper. The overall control system is implemented on DSP, DS1104'TMS320F240 controller board. The performance improvement of the proposed system is tested in comparison with the conventional Scherbius system and the modified conventional Scherbius system by a 12 pulse converter in conjunction with a chopper at steady state and at dynamic conditions. A 220 W wound motor is employed for testing. It is found that the motor speed can be controlled to be constant in the operating range of 450-1200 rpm at no load and full load. It is also found that the efficiency of the proposed system is remarkably increased since the harmonics of the input ac line current is reduced while the ac line input power factor is increased. (author)

Finite element model predicts current density distribution for clinical applications of tDCS and tACS

Directory of Open Access Journals (Sweden)

Toralf eNeuling

2012-09-01

Full Text Available Transcranial direct current stimulation (tDCS has been applied in numerous scientific studies over the past decade. However, the possibility to apply tDCS in therapy of neuropsychiatric disorders is still debated. While transcranial magnetic stimulation (TMS has been approved for treatment of major depression in the United States by the Food and Drug Administration (FDA, tDCS is not as widely accepted. One of the criticisms against tDCS is the lack of spatial specificity. Focality is limited by the electrode size (35 cm2 are commonly used and the bipolar arrangement. However, a current flow through the head directly from anode to cathode is an outdated view. Finite element (FE models have recently been used to predict the exact current flow during tDCS. These simulations have demonstrated that the current flow depends on tissue shape and conductivity. Toface the challenge to predict the location, magnitude and direction of the current flow induced by tDCS and transcranial alternating current stimulation (tACS, we used a refined realistic FE modeling approach. With respect to the literature on clinical tDCS and tACS, we analyzed two common setups for the location of the stimulation electrodes which target the frontal lobe and the occipital lobe, respectively. We compared lateral and medial electrode configuration with regard to theirusability. We were able to demonstrate that the lateral configurations yielded more focused stimulation areas as well as higher current intensities in the target areas. The high resolution of our simulation allows one to combine the modeled current flow with the knowledge of neuronal orientation to predict the consequences of tDCS and tACS. Our results not only offer a basis for a deeper understanding of the stimulation sites currently in use for clinical applications but also offer a better interpretation of observed effects.

Motor models and transient analysis for high-temperature, superconductor switch-based adjustable speed drive applications. Final report

International Nuclear Information System (INIS)

Bailey, J.M.

1996-06-01

New high-temperature superconductor (HTSC) technology may allow development of an energy-efficient power electronics switch for adjustable speed drive (ASD) applications involving variable-speed motors, superconducting magnetic energy storage systems, and other power conversion equipment. This project developed a motor simulation module for determining optimal applications of HTSC-based power switches in ASD systems

FLC based adjustable speed drives for power quality enhancement

Directory of Open Access Journals (Sweden)

Sukumar Darly

2010-01-01

Full Text Available This study describes a new approach based on fuzzy algorithm to suppress the current harmonic contents in the output of an inverter. Inverter system using fuzzy controllers provide ride-through capability during voltage sags, reduces harmonics, improves power factor and high reliability, less electromagnetic interference noise, low common mode noise and extends output voltage range. A feasible test is implemented by building a model of three-phase impedance source inverter, which is designed and controlled on the basis of proposed considerations. It is verified from the practical point of view that these new approaches are more effective and acceptable to minimize the harmonic distortion and improves the quality of power. Due to the complex algorithm, their realization often calls for a compromise between cost and performance. The proposed optimizing strategies may be applied in variable-frequency dc-ac inverters, UPSs, and ac drives.

Efficiency estimation method of three-wired AC to DC line transfer

Science.gov (United States)

Solovev, S. V.; Bardanov, A. I.

2018-05-01

The development of power semiconductor converters technology expands the scope of their application to medium voltage distribution networks (6-35 kV). Particularly rectifiers and inverters of appropriate power capacity complement the topology of such voltage level networks with the DC links and lines. The article presents a coefficient that allows taking into account the increase of transmission line capacity depending on the parameters of it. The application of the coefficient is presented by the example of transfer three-wired AC line to DC in various methods. Dependences of the change in the capacity from the load power factor of the line and the reactive component of the resistance of the transmission line are obtained. Conclusions are drawn about the most efficient ways of converting a three-wired AC line to direct current.

Design and Implementation of the Permanent- Magnet Synchronous Generator Drive in Wind Generation Systems

Directory of Open Access Journals (Sweden)

Yuan-Chih Chang

2018-06-01

Full Text Available The design and implementation of the permanent-magnet synchronous generator drive in wind generation systems is presented in this paper. The permanent-magnet synchronous generator (PMSG can converse the alternating current (AC power of the wind turbine to direct current (DC power. In this paper, the dynamic model of a PMSG is first introduced. The current controller is designed based on T-S fuzzy models of the PMSG. The stability of the proposed PMSG drive system is analyzed and proved. The proposed T-S fuzzy current control possesses a disturbance suppression ability. Compared with the traditional fuzzy logic system, its stability can be proved and verified. Finally, the control performance of the PMSG drive is verified by experimental results.

Volume 2. Probabilistic analysis of HTGR application studies. Supporting data

International Nuclear Information System (INIS)

1980-09-01

Volume II, Probabilistic Analysis of HTGR Application Studies - Supporting Data, gives the detail data, both deterministic and probabilistic, employed in the calculation presented in Volume I. The HTGR plants and the fossil plants considered in the study are listed. GCRA provided the technical experts from which the data were obtained by MAC personnel. The names of the technical experts (interviewee) and the analysts (interviewer) are given for the probabilistic data

Feedforward Synchronised PWM for Adjustable Speed AC Drives with Different Control Modes

DEFF Research Database (Denmark)

Oleschuk, Valentin; Blaabjerg, Frede; Jensen, Flemming Buus

2002-01-01

This paper presents a novel method of direct synchronised pulswidth modulation (PWM) for three-phase voltage source inverters, feeding induction motors with different control regimes. It is based on the universal algorithm with either simplified algebraic or accurate trigonometric control functions......, with vector approached for determination of the pulse patterns, with vector approach for determination of the pulse patterns. Different control modes of the drive system with synchronised PWM, including standard scalar V/F control, and also V2/F = constant and V/F2 = constant control regimes, have been...... analysed in the paper. Simulations give the behaviour of the PWM techniques proposed. Both continuous and discontinuous schemes of synchronised PWM, applied for the corresponding control regime, have been analysed and compared....

The AC photovoltaic module is here!

Science.gov (United States)

Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.

1997-02-01

This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).

Experimental infection with Escherichia coli 0149 : F4ac in weaned piglets

DEFF Research Database (Denmark)

Jensen, Gerda M.; Frydendahl, Kai; Svendsen, Ove

2006-01-01

adhesion test made after slaughter of piglets. However, in an experimental infection study with the purpose to obtain diarrhoeic piglets, it would be an advantage to test for susceptibility prior to experimentation. The Mucin 4 gene on porcine chromosome 13 has been proposed as a candidate gene...... for the production of the specific ETEC F4ab/ac receptor, and a DNA marker-based test has been developed to allow genotyping for ETEC F4ab/ac resistance/susceptibility [Jorgensen, C.B., Cirera, S., Archibald, A.L., Anderson, L., Fredholm, M., Edfors-Lilja, I., 2004. Porcine polymorphisms and methods for detecting...... them. International application published under the patent cooperation treaty (PCT). PCT/DK2003/000807 or WO2004/048606-A2]. The aim of this study was to test an experimental model for ETEC O149:F4ac-induced diarrhoea in piglets, selected for susceptibility towards ETEC O149:F4ac adhesion prior...

Incorporating solid state drives into distributed storage systems

OpenAIRE

Wacha, Rosie

2012-01-01

Big data stores are becoming increasingly important in a variety of domains including scientific computing, internet applications, and business applications. For price and performance reasons, such storage is comprised of magnetic hard drives. To achieve the necessary degree of performance and reliability, the drives are configured into storage subsystems based on RAID (Redundant Array of Independent Disks). Because of their mechanical nature, hard drives are relatively power-hungry and slow ...

Nonlinear Magnus-induced dynamics and Shapiro spikes for ac and dc driven skyrmions on periodic quasi-one-dimensional substrates

Science.gov (United States)

Reichhardt, Charles; Reichhardt, Cynthia J. Olson

We numerically examine skyrmions interacting with a periodic quasi-one-dimensional substrate. When we drive the skyrmions perpendicular to the substrate periodicity direction, a rich variety of nonlinear Magnus-induced effects arise, in contrast to an overdamped system that shows only a linear velocity-force curve for this geometry. The skyrmion velocity-force curve is strongly nonlinear and we observe a Magnus-induced speed-up effect when the pinning causes the Magnus velocity response to align with the dissipative response. At higher applied drives these components decouple, resulting in strong negative differential conductivity. For skyrmions under combined ac and dc driving, we find a new class of phase locking phenomena in which the velocity-force curves contain a series of what we call Shapiro spikes, distinct from the Shapiro steps observed in overdamped systems. There are also regimes in which the skyrmion moves in the direction opposite to the applied dc drive to give negative mobility.

Novel dielectric reduces corona breakdown in ac capacitors

Science.gov (United States)

Loehner, J. L.

1972-01-01

Dielectric system was developed which consists of two layers of 25-gage paper separated by one layer of 50-gage polypropylene to reduce corona breakdown in ac capacitors. System can be used in any alternating current application where constant voltage does not exceed 400 V rms. With a little research it could probably be increased to 700 to 800 V rms.

Wind Turbine Driving a PM Synchronous Generator Using Novel Recurrent Chebyshev Neural Network Control with the Ideal Learning Rate

Directory of Open Access Journals (Sweden)

Chih-Hong Lin

2016-06-01

Full Text Available A permanent magnet (PM synchronous generator system driven by wind turbine (WT, connected with smart grid via AC-DC converter and DC-AC converter, are controlled by the novel recurrent Chebyshev neural network (NN and amended particle swarm optimization (PSO to regulate output power and output voltage in two power converters in this study. Because a PM synchronous generator system driven by WT is an unknown non-linear and time-varying dynamic system, the on-line training novel recurrent Chebyshev NN control system is developed to regulate DC voltage of the AC-DC converter and AC voltage of the DC-AC converter connected with smart grid. Furthermore, the variable learning rate of the novel recurrent Chebyshev NN is regulated according to discrete-type Lyapunov function for improving the control performance and enhancing convergent speed. Finally, some experimental results are shown to verify the effectiveness of the proposed control method for a WT driving a PM synchronous generator system in smart grid.

Levitação acústica

OpenAIRE

Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar

2015-01-01

A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...

Modeling Types of Pedal Applications Using a Driving Simulator.

Science.gov (United States)

Wu, Yuqing; Boyle, Linda Ng; McGehee, Daniel; Roe, Cheryl A; Ebe, Kazutoshi; Foley, James

2015-11-01

The aim of this study was to examine variations in drivers' foot behavior and identify factors associated with pedal misapplications. Few studies have focused on the foot behavior while in the vehicle and the mishaps that a driver can encounter during a potentially hazardous situation. A driving simulation study was used to understand how drivers move their right foot toward the pedals. The study included data from 43 drivers as they responded to a series of rapid traffic signal phase changes. Pedal application types were classified as (a) direct hit, (b) hesitated, (c) corrected trajectory, and (d) pedal errors (incorrect trajectories, misses, slips, or pressed both pedals). A mixed-effects multinomial logit model was used to predict the likelihood of one of these pedal applications, and linear mixed models with repeated measures were used to examine the response time and pedal duration given the various experimental conditions (stimuli color and location). Younger drivers had higher probabilities of direct hits when compared to other age groups. Participants tended to have more pedal errors when responding to a red signal or when the signal appeared to be closer. Traffic signal phases and locations were associated with pedal response time and duration. The response time and pedal duration affected the likelihood of being in one of the four pedal application types. Findings from this study suggest that age-related and situational factors may play a role in pedal errors, and the stimuli locations could affect the type of pedal application. © 2015, Human Factors and Ergonomics Society.

Three-phase multilevel inverter configuration for open-winding high power application

DEFF Research Database (Denmark)

Sanjeevikumar, Padmanaban; Blaabjerg, Frede; Wheeler, Patrick William

2015-01-01

This paper work exploits a new dual open-winding three-phase multilevel inverter configuration suitable for high power medium-voltage applications. Modular structure comprised of standard three-phase voltage source inverter (VSI) along with one additional bi-directional semiconductor device (MOSFET...... for implementation purpose. Proposed dual-inverter configuration generates multilevel outputs with benefit includes reduced THD and dv/dt in comparison to other dual-inverter topologies. Complete model of the multilevel ac drive is developed with simple MSCFM modulation in Matlab/PLECs numerical software...

Simulation of the AC corona phenomenon with experimental validation

International Nuclear Information System (INIS)

Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R

2017-01-01

The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach. (paper)

The Cryogenic Anti-Coincidence detector for ATHENA X-IFU: pulse analysis of the AC-S7 single pixel prototype

Science.gov (United States)

D'Andrea, M.; Argan, A.; Lotti, S.; Macculi, C.; Piro, L.; Biasotti, M.; Corsini, D.; Gatti, F.; Torrioli, G.

2016-07-01

The ATHENA observatory is the second large-class mission in ESA Cosmic Vision 2015-2025, with a launch foreseen in 2028 towards the L2 orbit. The mission addresses the science theme "The Hot and Energetic Universe", by coupling a high-performance X-ray Telescope with two complementary focal-plane instruments. One of these is the X-ray Integral Field Unit (X-IFU): it is a TES based kilo-pixel order array able to provide spatially resolved high-resolution spectroscopy (2.5 eV at 6 keV) over a 5 arcmin FoV. The X-IFU sensitivity is degraded by the particles background expected at L2 orbit, which is induced by primary protons of both galactic and solar origin, and mostly by secondary electrons. To reduce the background level and enable the mission science goals, a Cryogenic Anticoincidence (CryoAC) detector is placed address the final design of the CryoAC. It will verify some representative requirements at single-pixel level, especially the detector operation at 50 mK thermal bath and the threshold energy at 20 keV. To reach the final DM design we have developed and tested the AC-S7 prototype, with 1 cm2 absorber area sensed by 65 Ir TESes. Here we will discuss the pulse analysis of this detector, which has been illuminated by the 60 keV line from a 241Am source. First, we will present the analysis performed to investigate pulses timings and spectrum, and to disentangle the athermal component of the pulses from the thermal one. Furthermore, we will show the application to our dataset of an alternative method of pulse processing, based upon Principal Component Analysis (PCA). This kind of analysis allow us to recover better energy spectra than achievable with traditional methods, improving the evaluation of the detector threshold energy, a fundamental parameter characterizing the CryoAC particle rejection efficiency.

AC Loss Reduction in Filamentized YBCO Coated Conductors with Virtual Transverse Cross-cuts

Energy Technology Data Exchange (ETDEWEB)

Zhang, Yifei [ORNL; Duckworth, Robert C [ORNL; Ha, Tam T [ORNL; List III, Frederick Alyious [ORNL; Gouge, Michael J [ORNL; Chen, Y [SuperPower Incorporated, Schenectady, New York; X, Xiong, [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

2011-01-01

While the performance of YBa{sub 2}Cu{sub 3}O{sub 7-x} (YBCO)-based coated conductors under dc currents has improved significantly in recent years, filamentization is being investigated as a technique to reduce ac loss so that the 2nd generation (2G) high temperature superconducting (HTS) wires can also be utilized in various ac power applications such as cables, transformers and fault current limiters. Experimental studies have shown that simply filamentizing the superconducting layer is not effective enough to reduce ac loss because of incomplete flux penetration in between the filaments as the length of the tape increases. To introduce flux penetration in between the filaments more uniformly and further reduce the ac loss, virtual transverse cross-cuts were made in superconducting filaments of the coated conductors fabricated using the metal organic chemical vapor deposition (MOCVD) method. The virtual transverse cross-cuts were formed by making cross-cuts (17 - 120 {micro}m wide) on the IBAD (ion beam assisted deposition)-MgO templates using laser scribing followed by depositing the superconducting layer ({approx} 0.6 {micro}m thick). AC losses were measured and compared for filamentized conductors with and without the cross-cuts under applied peak ac fields up to 100 mT. The results were analyzed to evaluate the efficacy of filament decoupling and the feasibility of using this method to achieve ac loss reduction.

Impedance and ac conductivity studies of Ba (Pr1/2Nb1/2) O3 ceramic

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science; Volume 36; Issue 4. Impedance and a.c. conductivity studies of ... Abstract. Impedance and electrical conduction studies of Ba(Pr1/2Nb1/2)O3 ceramic prepared through conventional ceramic fabrication technique are presented. The crystal symmetry, space group and unit cell ...

The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

International Nuclear Information System (INIS)

Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

2001-11-01

Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

Big Cat Coalitions: A Comparative Analysis of Regional Brain Volumes in Felidae.

Science.gov (United States)

Sakai, Sharleen T; Arsznov, Bradley M; Hristova, Ani E; Yoon, Elise J; Lundrigan, Barbara L

2016-01-01

Broad-based species comparisons across mammalian orders suggest a number of factors that might influence the evolution of large brains. However, the relationship between these factors and total and regional brain size remains unclear. This study investigated the relationship between relative brain size and regional brain volumes and sociality in 13 felid species in hopes of revealing relationships that are not detected in more inclusive comparative studies. In addition, a more detailed analysis was conducted of four focal species: lions ( Panthera leo ), leopards ( Panthera pardus ), cougars ( Puma concolor ), and cheetahs ( Acinonyx jubatus ). These species differ markedly in sociality and behavioral flexibility, factors hypothesized to contribute to increased relative brain size and/or frontal cortex size. Lions are the only truly social species, living in prides. Although cheetahs are largely solitary, males often form small groups. Both leopards and cougars are solitary. Of the four species, leopards exhibit the most behavioral flexibility, readily adapting to changing circumstances. Regional brain volumes were analyzed using computed tomography. Skulls ( n = 75) were scanned to create three-dimensional virtual endocasts, and regional brain volumes were measured using either sulcal or bony landmarks obtained from the endocasts or skulls. Phylogenetic least squares regression analyses found that sociality does not correspond with larger relative brain size in these species. However, the sociality/solitary variable significantly predicted anterior cerebrum (AC) volume, a region that includes frontal cortex. This latter finding is despite the fact that the two social species in our sample, lions and cheetahs, possess the largest and smallest relative AC volumes, respectively. Additionally, an ANOVA comparing regional brain volumes in four focal species revealed that lions and leopards, while not significantly different from one another, have relatively larger AC

Big Cat Coalitions: A comparative analysis of regional brain volumes in Felidae

Directory of Open Access Journals (Sweden)

Sharleen T Sakai

2016-10-01

Full Text Available Broad-based species comparisons across mammalian orders suggest a number of factors that might influence the evolution of large brains. However, the relationship between these factors and total and regional brain size remains unclear. This study investigated the relationship between relative brain size and regional brain volumes and sociality in 13 felid species in hopes of revealing relationships that are not detected in more inclusive comparative studies. In addition, a more detailed analysis was conducted of 4 focal species: lions (Panthera leo, leopards (Panthera pardus, cougars (Puma concolor, and cheetahs (Acinonyx jubatus. These species differ markedly in sociality and behavioral flexibility, factors hypothesized to contribute to increased relative brain size and/or frontal cortex size. Lions are the only truly social species, living in prides. Although cheetahs are largely solitary, males often form small groups. Both leopards and cougars are solitary. Of the four species, leopards exhibit the most behavioral flexibility, readily adapting to changing circumstances. Regional brain volumes were analyzed using computed tomography (CT. Skulls (n=75 were scanned to create three-dimensional virtual endocasts, and regional brain volumes were measured using either sulcal or bony landmarks obtained from the endocasts or skulls. Phylogenetic least squares (PGLS regression analyses found that sociality does not correspond with larger relative brain size in these species. However, the sociality/solitary variable significantly predicted anterior cerebrum (AC volume, a region that includes frontal cortex. This latter finding is despite the fact that the two social species in our sample, lions and cheetahs, possess the largest and smallest relative AC volumes, respectively. Additionally, an ANOVA comparing regional brain volumes in 4 focal species revealed that lions and leopards, while not significantly different from one another, have relatively

AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene

International Nuclear Information System (INIS)

McCarthy, Christina B.; Theilmann, David A.

2008-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription

A Single Phase to Three Phase PFC Half-Bridge Converter Using BLDC Drive with SPWM Technique.

OpenAIRE

Srinu Duvvada; Manmadha Kumar B

2014-01-01

In this paper, a buck half-bridge DC-DC converter is used as a single-stage power factor correction (PFC) converter for feeding a voltage source inverter (VSI) based permanent magnet brushless DC motor (BLDC) drive. The front end of this PFC converter is a diode bridge rectifier (DBR) fed from single-phase AC mains. The BLDC is used to drive a compressor load of an air conditioner through a three-phase VSI fed from a controlled DC link voltage. The speed of the compressor is controlled to ach...

First AC loss test and analysis of a Bi2212 cable-in-conduit conductor for fusion application

Science.gov (United States)

Qin, Jinggang; Shi, Yi; Wu, Yu; Li, Jiangang; Wang, Qiuliang; He, Yuxiang; Dai, Chao; Liu, Fang; Liu, Huajun; Mao, Zhehua; Nijhuis, Arend; Zhou, Chao; Devred, Arnaud

2018-01-01

The main goal of the Chinese fusion engineering test reactor (CFETR) is to build a fusion engineering tokamak reactor with a fusion power of 50-200 MW, and plan to test the breeding tritium during the fusion reaction. This may require a maximum magnetic field of the central solenoid and toroidal field coils up to 15 T. New magnet technologies should be developed for the next generation of fusion reactors with higher requirements. Bi2Sr2CaCu2Ox (Bi2212) is considered as a potential and promising superconductor for the magnets in the CFETR. R&D activities are ongoing at the Institute of Plasma Physics, Chinese Academy of Sciences for demonstration of the feasibility of a CICC based on Bi2212 round wire. One sub-size conductor cabled with 42 wires was designed, manufactured and tested with limited strand indentation during cabling and good transport performance. In this paper, the first test results and analysis on the AC loss of Bi2212 round wires and cabled conductor samples are presented. Furthermore, the impact of mechanical load on the AC loss of the sub-size conductor is investigated to represent the operation conditions with electromagnetic loads. The first tests provide an essential basis for the validation of Bi2212 CICC and its application in fusion magnets.

49 CFR 383.77 - Substitute for driving skills tests.

Science.gov (United States)

2010-10-01

... 49 Transportation 5 2010-10-01 2010-10-01 false Substitute for driving skills tests. 383.77... Substitute for driving skills tests. At the discretion of a State, the driving skill test as specified in... acceptable skills test, or an applicant's driving record in combination with certain driving experience. The...

High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

Science.gov (United States)

Abbas, Qamar; Béguin, François

2016-06-01

We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

Rancang Bangun dan Studi Eksperimen Alat Penukar Panas untuk Memanfaatkan Energi Refrigerant Keluar Kompresor AC sebagai Pemanas Air pada ST/D=8 dengan Variasi Volume Air

Directory of Open Access Journals (Sweden)

Fajri Chairbowo

2017-01-01

Full Text Available Abstrak­- Kebutuhan masyarakat terhadap air hangat semakin meningkat. Hal itu disebabkan air hangat mempunyai berbagai manfaat. Air hangat efektif dalam melarutkan lemak ataupun sabun, serta air hangat dapat melancarkan peredaran darah manusia ketika digunakan. Demi efisiensi dalam penggunaan energi, penelitian yang dilakukan tentang pemanfaatan panas buang dari sistem refrigerasi.. Sebelum panas dibuang ke lingkungan, water heater ditambahkan oleh penulis ke sistem refrigerasi yang peletakkannya sesudah proses kompresi. Dimana water heater akan mengambil kalor dari refrigeran pemanas yang melintas sesudah dari kompresor. Sistem refrigerasi yang digunakan mempunyai daya  1 HP (746 Watt. Dalam penelitian ini sudah ditetapkan diameter tube dari water heater adalah 1 cm dengan jarak transversal setiap tube 8 cm, fluida yang mengalir di dalam tube adalah R-22 dan fluida diam yang berada di dalam tangki adalah air. Langkah awal dari penelitian ini  adalah melakukan pengujian  sistem AC split untuk mendapatkan data-data yang dibutuhkan dalam perancangan water heater. Tahap selanjutnya adalah studi numerik dimana studi numerik dilakukan secara dua dimensi dengan kondisi steady, incompressible, dan laminar dengan prinsip Computational Fluid Dynamics (CFD, menggunakan perangkat lunak GAMBIT 2.4.6 untuk tahap pembuatan domain dan disimulasikan dengan perangkat lunak FLUENT 6.3.26. Tahap terakhir adalah eksperimen yang bertujuan untuk mengetahui water heater yang dibuat sesuai dengan rancangan penulis. Kemudian water heater yang sudah dibuat, dipasang ke sistem AC split. Pada tahap eksperimen, penulis melakukan variasi terhadap volume air di tangki, yaitu 75 liter, 85 liter dan 100 liter. Hasil dari simulasi numerik menunjukkan fenomena perpindahan panas pada water heater, yang berupa kontur temperatur, kontur kecepatan dan velocity vector dalam bentuk dua dimensi tampak samping water heater. Hasil dari studi eksperimen ini menunjukkan nilai

Design of a DC-AC Link Converter for 500W Residential Wind Generator

Directory of Open Access Journals (Sweden)

Riza Muhida

2012-12-01

Full Text Available  As one of alternative sources of renewable energy, wind energy has an excellence prospect in Indonesia, particularly in coastal and hilly areas which have potential wind to generate electricity for residential uses. There is urgent need to locally develop low cost inverter of wind generator system for residential use. Recent developments in power electronic converters and embedded computing allow improvement of power electronic converter devices that enable integration of microcontrollers in its design. In this project, an inverter circuit with suitable control scheme design was developed. The circuit was to be used with a selected topology of Wind Energy Conversion System (WECS to convert electricity generated by a 500W direct-drive permanent magnet type wind generator which is typical for residential use. From single phase AC output of the generator, a rectifier circuit is designed to convert AC to DC voltage. Then a DC-DC boost converter is used to step up the voltage to a nominal DC voltage suitable for domestic use. The proposed inverter then will convert the DC voltage to sinusoidal AC. The duty cycle of sinusoidal Pulse-Width Modulated (SPWM signal controlling switches in the inverter was generated by a microcontroller. The lab-scale experimental rig involves simulation of wind generator by running a geared DC motor coupled with 500W wind generator where the prototype circuit was connected at the generator output. The experimental circuit produced single phase 240V sinusoidal AC voltage with frequency of 50Hz. Measured total harmonics distortion (THD of the voltage across load was 4.0% which is within the limit of 5% as recommended by IEEE Standard 519-1992.

Variation in critical care unit admission rates and outcomes for patients with acute coronary syndromes or heart failure among high- and low-volume cardiac hospitals.

Science.gov (United States)

van Diepen, Sean; Bakal, Jeffrey A; Lin, Meng; Kaul, Padma; McAlister, Finlay A; Ezekowitz, Justin A

2015-02-27

Little is known about cross-hospital differences in critical care units admission rates and related resource utilization and outcomes among patients hospitalized with acute coronary syndromes (ACS) or heart failure (HF). Using a population-based sample of 16,078 patients admitted to a critical care unit with a primary diagnosis of ACS (n=14,610) or HF (n=1467) between April 1, 2003 and March 31, 2013 in Alberta, Canada, we stratified hospitals into high (>250), medium (200 to 250), or low (<200) volume based on their annual volume of all ACS and HF hospitalization. The percentage of hospitalized patients admitted to critical care units varied across low, medium, and high-volume hospitals for both ACS and HF as follows: 77.9%, 81.3%, and 76.3% (P<0.001), and 18.0%, 16.3%, and 13.0% (P<0.001), respectively. Compared to low-volume units, critical care patients with ACS and HF admitted to high-volume hospitals had shorter mean critical care stays (56.6 versus 95.6 hours, P<0.001), more critical care procedures (1.9 versus 1.2 per patient, <0.001), and higher resource-intensive weighting (2.8 versus 1.5, P<0.001). No differences in in-hospital mortality (5.5% versus 6.2%, adjusted odds ratio 0.93; 95% CI, 0.61 to 1.41) were observed between high- and low-volume hospitals; however, 30-day cardiovascular readmissions (4.6% versus 6.8%, odds ratio 0.77; 95% CI, 0.60 to 0.99) and cardiovascular emergency-room visits (6.6% versus 9.5%, odds ratio 0.80; 95% CI, 0.69 to 0.94) were lower in high-volume compared to low-volume hospitals. Outcomes stratified by ACS or HF admission diagnosis were similar. Cardiac patients hospitalized in low-volume hospitals were more frequently admitted to critical care units and had longer hospitals stays despite lower resource-intensive weighting. These findings may provide opportunities to standardize critical care utilization for ACS and HF patients across high- and low-volume hospitals. © 2015 The Authors. Published on behalf of the American

Efficiency improvement of variable speed electrical drives for HVAC applications

Energy Technology Data Exchange (ETDEWEB)

Abrahamsen, F.; Blaabjerg, F.; Pedersen, J.K. [Aalborg Univ., Inst. of Energy Technology, Aalborg East (Denmark)

2000-07-01

A large part of the produced electrical energy is consumed by ventilators, pumps and compressors, the so-called HVAC applications. A lot of this energy can be saved by speed control, but even with the large saving obtained alone by introduction of variable speed, it is still essential to optimise the control of the variable speed drive and to optimise the electrical machine with respect to efficiency. Experiments are made with energy optimal induction motor control on a 2.2 kW variable speed pump system. It is demonstrated that 10% of the consumed energy can typically be saved by energy optimal motor control compared with constant V/Hz control. In a comparison of induction motors and permanent magnet synchronous motors for a variable speed pump application it is shown that for 2.2 kW motors an investment in high-efficiency or PM motors are typically paid back within 2.5 years and 7 years respectively. For a 90 kW PM motor the pay-back time would be 24 years. It is today not profitable to use PM motors for variable speed HVAC applications above 2 kW rated motor power. A further study is required to determine this limit in power rating more precisely. (orig.)

AcEST: DK954361 [AcEST

Lifescience Database Archive (English)

Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

Hysteresis losses in MgB₂ superconductors exposed to combinations of low AC and high DC magnetic fields and transport currents

DEFF Research Database (Denmark)

Magnusson, N.; Abrahamsen, Asger Bech; Liu, Dawei

2014-01-01

MgB2 superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must...... a simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting...

Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)

International Nuclear Information System (INIS)

Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.

2007-01-01

Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured

Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)

Science.gov (United States)

Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.

2007-10-01

Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured.

ac electrokinetic micropumps: The effect of geometrical confinement, Faradaic current injection, and nonlinear surface capacitance

DEFF Research Database (Denmark)

Olesen, Laurits Højgaard; Bruus, Henrik; Ajdari, A.

2006-01-01

therefore extend the latter theories to account for three experimentally relevant effects: (i) vertical confinement of the pumping channel, (ii) Faradaic currents from electrochemical reactions at the electrodes, and (iii) nonlinear surface capacitance of the Debye layer. We report here that these effects......Recent experiments have demonstrated that ac electrokinetic micropumps permit integrable, local, and fast pumping (velocities similar to mm/s) with low driving voltage of a few volts only. However, they also displayed many quantitative and qualitative discrepancies with existing theories. We...

21 CFR 886.4440 - AC-powered magnet.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

A-C Estrogens as Potent and Selective Estrogen Receptor-Beta Agonists (SERBAs) to Enhance Memory Consolidation under Low-Estrogen Conditions.

Science.gov (United States)

Hanson, Alicia M; Perera, K L Iresha Sampathi; Kim, Jaekyoon; Pandey, Rajesh K; Sweeney, Noreena; Lu, Xingyun; Imhoff, Andrea; Mackinnon, Alexander Craig; Wargolet, Adam J; Van Hart, Rochelle M; Frick, Karyn M; Donaldson, William A; Sem, Daniel S

2018-06-04

Estrogen receptor-beta (ERβ) is a drug target for memory consolidation in postmenopausal women. Herein is reported a series of potent and selective ERβ agonists (SERBAs) with in vivo efficacy that are A-C estrogens, lacking the B and D estrogen rings. The most potent and selective A-C estrogen is selective for activating ER relative to seven other nuclear hormone receptors, with a surprising 750-fold selectivity for the β over α isoform and with EC 50 s of 20-30 nM in cell-based and direct binding assays. Comparison of potency in different assays suggests that the ER isoform selectivity is related to the compound's ability to drive the productive conformational change needed to activate transcription. The compound also shows in vivo efficacy after microinfusion into the dorsal hippocampus and after intraperitoneal injection (0.5 mg/kg) or oral gavage (0.5 mg/kg). This simple yet novel A-C estrogen is selective, brain penetrant, and facilitates memory consolidation.

29 CFR 1926.603 - Pile driving equipment.

Science.gov (United States)

2010-07-01

... 29 Labor 8 2010-07-01 2010-07-01 false Pile driving equipment. 1926.603 Section 1926.603 Labor... Operations § 1926.603 Pile driving equipment. (a) General requirements. (1) Boilers and piping systems which are a part of, or used with, pile driving equipment shall meet the applicable requirements of the...

AC Loss Analysis of MgB2-Based Fully Superconducting Machines

Science.gov (United States)

Feddersen, M.; Haran, K. S.; Berg, F.

2017-12-01

Superconducting electric machines have shown potential for significant increase in power density, making them attractive for size and weight sensitive applications such as offshore wind generation, marine propulsion, and hybrid-electric aircraft propulsion. Superconductors exhibit no loss under dc conditions, though ac current and field produce considerable losses due to hysteresis, eddy currents, and coupling mechanisms. For this reason, many present machines are designed to be partially superconducting, meaning that the dc field components are superconducting while the ac armature coils are conventional conductors. Fully superconducting designs can provide increases in power density with significantly higher armature current; however, a good estimate of ac losses is required to determine the feasibility under the machines intended operating conditions. This paper aims to characterize the expected losses in a fully superconducting machine targeted towards aircraft, based on an actively-shielded, partially superconducting machine from prior work. Various factors are examined such as magnet strength, operating frequency, and machine load to produce a model for the loss in the superconducting components of the machine. This model is then used to optimize the design of the machine for minimal ac loss while maximizing power density. Important observations from the study are discussed.

Five-Phase Five-Level Open-Winding/Star-Winding Inverter Drive for Low-Voltage/High-Current Applications

DEFF Research Database (Denmark)

Padmanaban, Sanjeevi Kumar; Blaabjerg, Frede; Wheeler, Patrick

2016-01-01

This paper work proposed a five-phase five-level open-/star-winding multilevel AC converter suitable for low-voltage/high-current applications. Modular converter consists of classical two-level five-phase voltage source inverter (VSI) with slight reconfiguration to serve as a multilevel converter...... for open-/star-winding loads. Elaborately, per phase of the VSI is built with one additional bi-directional switch (MOSFET/IGBT) and all five legs links to the neutral through two capacitors. The structure allows multilevel generation to five-level output with greater potential for fault tolerability under...

Inductively coupled plasma emission spectroscopy. Part II: applications and fundamentals. Volume 2

International Nuclear Information System (INIS)

Boumans, P.W.J.M.

1987-01-01

This is the second part of the two-volume treatise by this well-known and respected author. This volume reviews applications of inductively coupled plasma atomic emission spectroscopy (ICP-AES), summarizes fundamental studies, and compares ICP-AES methods with other methods of analysis. The first six chapters are devoted to specific fields of application, including the following: metals and other industrial materials, geology, the environment, agriculture and food, biology and clinical analysis, and organic materials. The chapter on the analysis of organic materials also covers the special instrumental considerations required when organic solvents are introduced into an inductively coupled plasma. A chapter on the direct analysis of solids completes the first part of this volume. Each of the applications chapters begins with a summary of the types of samples that are encountered in that field, and the kinds of problems that an elemental analysis can help to solve. This is followed by a tutorial approach covering applicability, advantages, and limitations of the methods. The coverage is thorough, including sample handling, storage, and preparation, acid, and fusion dissolution, avoiding contamination, methods of preconcentration, the types of interferences that can be expected and ways to reduce them, and the types of ICP plasmas that are used. The second half of the volume covers fundamental studies of ICP-AES: basic processes of aerosol generation, plasma modeling and computer simulation, spectroscopic diagnostics, excitation mechanisms, and discharge characteristics. This section introduces the experimental and modeling methods that have been used to obtain fundamental information about ICPs

A thermodynamic approach to compare the performance of rhombic-drive and crank-drive mechanisms for a beta-type Stirling engine

International Nuclear Information System (INIS)

Aksoy, F.; Solmaz, H.; Karabulut, H.; Cinar, C.; Ozgoren, Y.O.; Polat, Seyfi

2016-01-01

Highlights: • Rhombic drive and crank drive mechanisms of a beta type engine were compared. • Nodal analysis method was used to compare engines having different drive mechanism. • Maximum specific power was 1410 W/L for rhombic-drive engine. • Heat transfer coefficient was determined as 475 W/m"2K for rhombic-drive engine. • Rhombic drive provided higher efficiency because of its better kinematic behaviours. - Abstract: In this study, the effect of rhombic drive and crank drive mechanisms on the performance of a beta-type Stirling engine was investigated by nodal analysis. Kinematic and thermodynamic relations for both drive mechanisms were introduced and a Fortran code was written for the solution. Piston strokes, cylinder and displacer diameters, hot and cold end temperatures, regenerator volumes and heat transfer surface areas were taken equal for both engines with two different drive mechanisms. In the analysis, air was used as the working gas. Engine power and efficiency were compared for different charge pressure values, working gas mass values, heat transfer coefficients and hot end temperatures. Maximum specific engine power was 1410 W/L for the engine with rhombic drive mechanism and 1200 W/L for the engine with crank drive mechanism at 4 bars of charge pressure and 500 W/m"2K heat transfer coefficient. Rhombic drive mechanism was relatively advantageous at low working gas mass values and high hot end temperatures. In comparison with the engine having rhombic drive mechanism, the relatively poor kinematic behaviour of the engine having crank drive mechanism caused lower engine efficiency and performance. Heat transfer coefficient was also predicted by using an experimental pressure trace.

Advanced reliability improvement of AC-modules (ARIA)

International Nuclear Information System (INIS)

Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.

2001-09-01

The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string

Comparison of different application systems and CT- assisted treatment planning procedures in primary endometrium cancer: Is it technically possible to include the whole uterus volume in the volume treated by brachytherapy

International Nuclear Information System (INIS)

Mock, U.; Knocke, Th.; Fellner, C.; Poetter, R.

1996-01-01

Purpose: Brachytherapy is regarded as the definitive component of treatment for inoperable patients with endometrium cancer. In published series the whole uterus has been claimed to represent the target volume independently of the individual tumor spread. The purpose of this work is to compare different planning and application procedures and to analyze the target volumes (whole uterus), treatment volumes and their respective relation for the given various conditions. Material and Methods: In ten patients with primary endometrium cancer the correlation between target- and treatment volume was analysed based on standard one-channel applicators or individual Heyman applicators. A comparative analysis of target volumes resulting from two different planning procedures of Heyman applications was performed. CT was carried out after insertion of the Heyman ovoids. Target volume was estimated by measuring the uterus size at different cross sections of the CT images. Dose calculation was performed with (PLATO-system) or without (NPS-system) transferring these data directly to the planning system. We report on the differences in treatment volumes resulting from the two application and planning systems. Results: The mean value of the uterus volume was 180 ccm (range 57 ccm to 316 ccm). Four out of 10 patients had an asymmetric uterus configuration with a side-difference (in longitudinal or transversal direction) of more than 1 cm. On average 70% (range 48-95%) of the uterus volume was included by the treatment volume when Heymann applicators were used compared to 45 % (range 25-89%) when standard one channel applicators were used. This represents an improvement of 25% (range from 11%-35%). By utilizing the more sophisticated way of treatment planning a more adequate coverage of the uterus volume was achieved in five out of ten patients. The treated volume increased on the average by 20 % (range 11 %-32%). In three cases changes in the irradiation volume were less than 5%. In

Energy efficiency improvement of medical electric tools and devices

Directory of Open Access Journals (Sweden)

Meshkov Aleksandr S.

2014-01-01

Full Text Available With the ever-increasing volume of applications of various kinds of electric drives in all spheres of human activity, the issues in improving the efficiency of the electromechanical converters of electric energy, one of the most important components of the electric drive (ED, are becoming increasingly important. Such issues include reducing their weight and size, improving the functional characteristics of these devices to increase their operational life and reducing the cost of manufacture. Taking full advantage of these opportunities relates to the AC and DC single-phase commutator motor (SCM, which is widely used in regulated and high-speed motor drives in medical electric hand tools. The SCM is used in machinery where the load torque has a hyperbolic dependence on the rotational speed and the need to work with a large motor overload due to the “soft” mechanical characteristics of such motors.

Performance comparison of a novel configuration of beta-type Stirling engines with rhombic drive engine

International Nuclear Information System (INIS)

Solmaz, Hamit; Karabulut, Halit

2014-01-01

Highlights: • The paper describes a novel arrangement of a beta-type Stirling engine. • Its performance was compared with rhombic drive engine. • The power output of the engine was found to be greater than rhombic drive. • Efficiency was found to be higher than rhombic drive at the same working fluid mass. • Efficiency was found to be lower than rhombic drive at the same charge pressure. - Abstract: This study presents a beta type Stirling engine mechanism and its performance analysis. The displacer motion of the engine is performed by a lever mechanism. The performance of the engine was investigated via comparing with a rhombic-drive engine possessing an equal sided rhombic. Comparison was made for kinematic behaviors, power and thermal efficiency. For comparison; the piston swept volume, the inner heat transfer area, the hot and cold end temperatures, the inner heat transfer coefficient, charge pressure and dead volumes were kept equal for both engines. As working fluid the helium was used. Thermodynamic treatments of engines were performed via the nodal analysis. The power of the lever driven engine was found to be greater than the power of the rhombic drive engine. Under the equal charge pressure, the thermal efficiency of the lever driven engine was found to be lower than the efficiency of the rhombic drive engine however, under the equal working fluid mass the thermal efficiency of the lever driven engine was found to be greater than that of the rhombic drive engine. The external volume and mass of the lever driven engine is lower than the rhombic drive engine

Simultaneous distribution of AC and DC power

Science.gov (United States)

Polese, Luigi Gentile

2015-09-15

A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

Volume Regulated Channels

DEFF Research Database (Denmark)

Klausen, Thomas Kjær

of volume perturbations evolution have developed system of channels and transporters to tightly control volume homeostasis. In the past decades evidence has been mounting, that the importance of these volume regulated channels and transporters are not restricted to the defense of cellular volume...... but are also essential for a number of physiological processes such as proliferation, controlled cell death, migration and endocrinology. The thesis have been focusing on two Channels, namely the swelling activated Cl- channel (ICl, swell) and the transient receptor potential Vanilloid (TRPV4) channel. I: Cl......- serves a multitude of functions in the mammalian cell, regulating the membrane potential (Em), cell volume, protein activity and the driving force for facilitated transporters giving Cl- and Cl- channels a major potential of regulating cellular function. These functions include control of the cell cycle...

Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

Directory of Open Access Journals (Sweden)

LISTYA UTAMI KARMAWAN

2009-03-01

Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

Production of Ac-225 for cancer therapy by photon-induced transmutation of Ra-226.

Science.gov (United States)

Melville, G; Meriarty, H; Metcalfe, P; Knittel, T; Allen, B J

2007-09-01

The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. The production of Ac-225 has been achieved using bremsstrahlung photons from an 18 MV medical linear accelerator (linac) to bombard a Ra-226 target. A linac dose of 2800 Gy produced about 64 microCi of Ra-225, which decays to Ac-225. This result, while consistent with the theoretical calculations, is far too low to be of practical use. A more powerful linac is required that runs at a higher current, longer pulse length and higher frequency for practical production. This process could also lead to the reduction of the nuclear waste product Ra-226.

Universality of ac conduction in disordered solids

DEFF Research Database (Denmark)

Dyre, Jeppe; Schrøder, Thomas

2000-01-01

The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

Flyback CCM inverter for AC module applications: iterative learning control and convergence analysis

Science.gov (United States)

Lee, Sung-Ho; Kim, Minsung

2017-12-01

This paper presents an iterative learning controller (ILC) for an interleaved flyback inverter operating in continuous conduction mode (CCM). The flyback CCM inverter features small output ripple current, high efficiency, and low cost, and hence it is well suited for photovoltaic power applications. However, it exhibits the non-minimum phase behaviour, because its transfer function from control duty to output current has the right-half-plane (RHP) zero. Moreover, the flyback CCM inverter suffers from the time-varying grid voltage disturbance. Thus, conventional control scheme results in inaccurate output tracking. To overcome these problems, the ILC is first developed and applied to the flyback inverter operating in CCM. The ILC makes use of both predictive and current learning terms which help the system output to converge to the reference trajectory. We take into account the nonlinear averaged model and use it to construct the proposed controller. It is proven that the system output globally converges to the reference trajectory in the absence of state disturbances, output noises, or initial state errors. Numerical simulations are performed to validate the proposed control scheme, and experiments using 400-W AC module prototype are carried out to demonstrate its practical feasibility.

Integrated Inverter And Battery Charger

Science.gov (United States)

Rippel, Wally E.

1988-01-01

Circuit combines functions of dc-to-ac inversion (for driving ac motor in battery-powered vehicle) and ac-to-dc conversion (for charging battery from ac line when vehicle not in use). Automatically adapts to either mode. Design of integrated inverter/charger eliminates need for duplicate components, saves space, reduces weight and cost of vehicle. Advantages in other applications : load-leveling systems, standby ac power systems, and uninterruptible power supplies.

77 FR 61048 - Distracted Driving Grant Program

Science.gov (United States)

2012-10-05

... DEPARTMENT OF TRANSPORTATION National Highway Traffic Safety Administration Distracted Driving Grant Program AGENCY: National Highway Traffic Safety Administration (NHTSA), Department of... distracted driving grants on August 24, 2012. In this notice, DOT is extending the application submission...

Ion cyclotron and lower hybrid arrays applicable to current drive in fusion reactors

Energy Technology Data Exchange (ETDEWEB)

Bosia, G.; Ragona, R. [Department of Physics, Università di Torino (Italy); Helou, W.; Goniche, M.; Hillaret, J. [CEA/DSM/IRFM F-13 108 St Paul Les Durance (France)

2014-02-12

This paper presents concepts for Ion Cyclotron and Lower Hybrid Current Drive arrays applicable to fusion reactors and based on periodically loaded line power division. It is shown that, in large arrays, such as the ones proposed for fusion reactor applications, these schemes can offer, in principle, a number of practical advantages, compared with currently adopted ones, such as in-blanket operation at significantly reduced power density, lay out suitable for water cooling, single ended or balanced power feed, simple and load independent impedance matching In addition, a remote and accurate real time measurement of the complex impedance of all array elements as well as detection, location, and measurement of the complex admittance of a single arc occurring anywhere in the structure is possible.

AC susceptibility as a tool to probe the dipolar interaction in magnetic nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Landi, Gabriel T., E-mail: gtlandi@gmail.com [Universidade Federal do ABC, 09210-580 Santo André (Brazil); Arantes, Fabiana R. [Universidade Federal do ABC, 09210-580 Santo André (Brazil); Cornejo, Daniel R. [Instituto de Física da Universidade de São Paulo, São Paulo 05508-090 (Brazil); Bakuzis, Andris F. [Instituto de Física, Universidade Federal de Goiás, 74690-900 Goiânia-GO (Brazil); Andreu, Irene; Natividad, Eva [Instituto de Ciencia de Materiales de Aragón (ICMA), CSIC-Universidad de Zaragoza, Zaragoza 50018 (Spain)

2017-01-01

The dipolar interaction is known to substantially affect the properties of magnetic nanoparticles. This is particularly important when the particles are kept in a fluid suspension or packed within nano-carriers. In addition to its usual long-range nature, in these cases the dipolar interaction may also induce the formation of clusters of particles, thereby strongly modifying their magnetic anisotropies. In this paper we show how AC susceptibility may be used to obtain information regarding the influence of the dipolar interaction in a sample. We develop a model which includes both aspects of the dipolar interaction and may be fitted directly to the susceptibility data. The usual long-range nature of the interaction is implemented using a mean-field approximation, whereas the particle-particle aggregation is modeled using a distribution of anisotropy constants. The model is then applied to two samples studied at different concentrations. One consists of spherical magnetite nanoparticles dispersed in oil and the other of cubic magnetite nanoparticles embedded on polymeric nanospheres. We also introduce a simple technique to address the presence of the dipolar interaction in a given sample, based on the height of the AC susceptibility peaks for different driving frequencies. - Highlights: We discuss the importance of the dipolar interaction in magnetic nanoparticle samples. It is shown that AC susceptibility may be used to estimate the extent of this interaction. We develop a model that accounts for particle aggregation. The theoretical model is then fitted to distinct magnetite samples.

Enhanced adsorption of benzene vapor on granular activated carbon under humid conditions due to shifts in hydrophobicity and total micropore volume.

Science.gov (United States)

Liu, Han-Bing; Yang, Bing; Xue, Nan-Dong

2016-11-15

A series of hydrophobic-modified (polydimethylsiloxane (PDMS) coating) activated carbons (ACs) were developed to answer a fundamental question: what are the determinants that dominate the adsorption on ACs under humid conditions? Using column experiments, an inter-comparison among bare-AC and PDMS-coated ACs was conducted regarding the association of surface characteristics and adsorption capacity. Primary outcomes occurred in two dominating markers, hydrophobicity and total micropore volume, which played a key role in water adsorption on ACs. However, their contributions to water adsorption on ACs substantially differed under different Pwater/Pair conditions. Hydrophobicity was the only contributor in Pwater/Pair=0.1-0.6, while the two markers contributed equally in Pwater/Pair=0.7-1.0. Furthermore, PDMS-coated AC had a significant increase in benzene adsorption capacities compared to bare-AC at 0-90% relative humidity, while these differences were not significant among PDMS-coated ACs. It is thus presumed that the balance between the two markers can be shifted to favor almost unchanged benzene adsorption capacities among PDMS-coated ACs over a large range of relative humidity. These findings suggest potential benefits of PDMS coating onto ACs in enhancing selective adsorption of hydrophobic volatile organic compounds under high humid conditions. To develop new porous materials with both high total micropore volume and hydrophobicity should thus be considered. Copyright © 2016 Elsevier B.V. All rights reserved.

Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)

Science.gov (United States)

Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.

2012-01-01

The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.

A CMOS integrated voltage and power efficient AC/DC converter for energy harvesting applications

International Nuclear Information System (INIS)

Peters, Christian; Ortmanns, Maurits; Manoli, Yiannos; Spreemann, Dirk

2008-01-01

In this paper, a fully CMOS integrated active AC/DC converter for energy harvesting applications is presented. The rectifier is realized in a standard 0.35 µm CMOS process without special process options. It works as a full wave rectifier and can be separated into two stages—one passive and one active. The active part is powered from the storage capacitor and consumes about 600 nA at 2 V supply. The input voltage amplitude range is between 1.25 and 3.75 V, and the operating frequency range is from 1 Hz to as much as several 100 kHz. The series voltage drop over the rectifier is less than 20 mV. Measurements in combination with an electromagnetic harvester show a significant increase in the achievable output voltage and power compared to a common, discrete Schottky diode rectifier. The measured efficiency of the rectifier is over 95%. Measurements show a negligible temperature influence on the output voltage between −40 °C and +125 °C

Energy Optimal Control of Induction Motor Drives

DEFF Research Database (Denmark)

Abrahamsen, Flemming

This thesis deals with energy optimal control of small and medium-size variable speed induction motor drives for especially Heating, Ventilation and Air-Condition (HVAC) applications. Optimized efficiency is achieved by adapting the magnetization level in the motor to the load, and the basic...... demonstrated that energy optimal control will sometimes improve and sometimes deteriorate the stability. Comparison of small and medium-size induction motor drives with permanent magnet motor drives indicated why, and in which applications, PM motors are especially good. Calculations of economical aspects...... improvement by energy optimal control for any standard induction motor drive between 2.2 kW and 90 kW. A simple method to evaluate the robustness against load disturbances was developed and used to compare the robustness of different motor types and sizes. Calculation of the oscillatory behavior of a motor...

AcMNPV

African Journals Online (AJOL)

USER

2010-08-16

Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...

Predictive Reliability Assessment of the Automatic Clutch on a Primary Sodium Pump Drive

International Nuclear Information System (INIS)

Westwell, P.

1975-01-01

This paper examines the reliability of a group of three clutch couplings each mounted between a pony motor and the main drive for the primary sodium pumps. The sodium pumps specification requires that continuously running AC pony motors be fitted to give a guaranteed 10% drive to the pumps in the event of a main supply failure. The drive to the main shaft is via 3 : 1 reduction gearing such that a six pole pony motor running at 300 rpm would drive the main shaft at 100 rpm i.e., 10% of its rated speed. In order that the pony motor drive could be permanently energised during normal operation a free wheeling clutch is fitted between the motor and the reduction gearing. The type of clutch chosen is. the Synchro-Self Shifting (SSS) clutch, shown in Figure 1. This type of clutch has proved itself under fairly onerous operating conditions, but is normally mounted on a horizontal driving shaft whereas in this case because of space limitations, it is necessary to mount it vertically. The reliability target set is that the chance of losing all three independent back-up pony motor drives on loss of main supplies should fall within the 10 -5 - 10 -6 band. Since the electrical supplies and other parts of the pony motor drives have been assessed within this target and some doubts expressed about the clutch it was now necessary to look at this in some detail

Modeling and reliability analysis of three phase z-source AC-AC converter

Directory of Open Access Journals (Sweden)

Prasad Hanuman

2017-12-01

Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

Development of Electromechanical Architectures for AC Voltage Metrology

Directory of Open Access Journals (Sweden)

Alexandre BOUNOUH

2010-12-01

Full Text Available This paper presents results of work undertaken for exploring MEMS capabilities to fabricate AC voltage references for electrical metrology and high precision instrumentation through the mechanical-electrical coupling in MEMS. From first MEMS test structures previously realized, a second set of devices with improved characteristics has been developed and fabricated with Silicon on Insulator (SOI Surface Micromachining process. These MEMS exhibit pull-in voltages of 5 V and 10 V to match with the best performance of the read-out electronics developed for driving the MEMS. Deep Level Transient Spectroscopy measurements carried out on the new design show resonance frequencies of about only some kHz, and the stability of the MEMS output voltage measured at 100 kHz has been found very promising for the best samples where the relative deviation from the mean value over almost 12 hours showed a standard deviation of about 6.3 ppm.

Driving Circuitry for Focused Ultrasound Noninvasive Surgery and Drug Delivery Applications

Directory of Open Access Journals (Sweden)

Kullervo Hynynen

2011-01-01

Full Text Available Recent works on focused ultrasound (FUS have shown great promise for cancer therapy. Researchers are continuously trying to improve system performance, which is resulting in an increased complexity that is more apparent when using multi-element phased array systems. This has led to significant efforts to reduce system size and cost by relying on system integration. Although ideas from other fields such as microwave antenna phased arrays can be adopted in FUS, the application requirements differ significantly since the frequency range used in FUS is much lower. In this paper, we review recent efforts to design efficient power monitoring, phase shifting and output driving techniques used specifically for high intensity focused ultrasound (HIFU.

The application of prepared porous carbon materials: Effect of different components on the heavy metal adsorption.

Science.gov (United States)

Song, Min; Wei, Yuexing; Yu, Lei; Tang, Xinhong

2016-06-01

In this study, five typical municipal solid waste (MSW) components (tyres, cardboard, polyvinyl chloride (PVC), acrylic textile, toilet paper) were used as raw materials to prepare four kinds of MSW-based carbon materials (paperboard-based carbon materials (AC1); the tyres and paperboard-based carbon materials (AC2); the tyres, paperboard and PVC-based carbon materials (AC3); the tyres, paperboard, toilet paper, PVC and acrylic textile-based carbon materials (AC4)) by the KOH activation method. The characteristic results illustrate that the prepared carbon adsorbents exhibited a large pore volume, high surface area and sufficient oxygen functional groups. Furthermore, the application of AC1, AC2, AC3, AC4 on different heavy metal (Cu(2+), Zn(2+), Pb(2+), Cr(3+)) removals was explored to investigate their adsorption properties. The effects of reaction time, pH, temperature and adsorbent dosage on the adsorption capability of heavy metals were investigated. Comparisons of heavy metal adsorption on carbon of different components were carried out. Among the four samples, AC1 exhibits the highest adsorption capacity for Cu(2+); the highest adsorption capacities of Pb(2+) and Zn(2+) are obtained for AC2; that of Cr(3+) are obtained for AC4. In addition, the carbon materials exhibit better adsorption capability of Cu(2+) and Pb(2+) than the other two kind of metal ions (Zn(2+) and Cr(3+)). © The Author(s) 2016.

A Modular Active Front-End Rectifier with Electronic Phase-Shifting for Harmonic Mitigation in Motor Drive Applications

DEFF Research Database (Denmark)

Zare, Firuz; Davari, Pooya; Blaabjerg, Frede

2017-01-01

In this paper, an electronic phase-shifting strategy has been optimized for a multi-parallel configuration of line-commutated rectifiers with a common dc-bus voltage used in motor drive application. This feature makes the performance of the system independent of the load profile and maximizes its...

Efficient Driving of Piezoelectric Transducers Using a Biaxial Driving Technique.

Directory of Open Access Journals (Sweden)

Samuel Pichardo

Full Text Available Efficient driving of piezoelectric materials is desirable when operating transducers for biomedical applications such as high intensity focused ultrasound (HIFU or ultrasound imaging. More efficient operation reduces the electric power required to produce the desired bioeffect or contrast. Our preliminary work [Cole et al. Journal of Physics: Condensed Matter. 2014;26(13:135901.] suggested that driving transducers by applying orthogonal electric fields can significantly reduce the coercivity that opposes ferroelectric switching. We present here the experimental validation of this biaxial driving technique using piezoelectric ceramics typically used in HIFU. A set of narrow-band transducers was fabricated with two sets of electrodes placed in an orthogonal configuration (following the propagation and the lateral mode. The geometry of the ceramic was chosen to have a resonance frequency similar for the propagation and the lateral mode. The average (± s.d. resonance frequency of the samples was 465.1 (± 1.5 kHz. Experiments were conducted in which each pair of electrodes was driven independently and measurements of effective acoustic power were obtained using the radiation force method. The efficiency (acoustic/electric power of the biaxial driving method was compared to the results obtained when driving the ceramic using electrodes placed only in the pole direction. Our results indicate that the biaxial method increases efficiency from 50% to 125% relative to the using a single electric field.

Recent Research Results in the Field of Electric Drives and Mechatronics

Directory of Open Access Journals (Sweden)

Jan Vittek

2003-01-01

Full Text Available The paper presents an overview of research results achieved in the field of Electrical Drives and Mechatronics for the period of three years. The achieved outputs are formed into three individual parts. In the field of Electric Drives the most significant outputs have been achieved in the development of a new control algorithms for a.c. drives under general name 'Forced Dynamics Control' , in improvement of shaft sensorless control methods and in implementation of developed algorithms via digital signal processors. In the field of Electric Traction the most important results have been gained in optimization of power of traction vehicles andat development of diagnostic systems for evaluation of technical conditions of traction devices. In the field of Electric Machines the most important outputs have been achieved in the research of modern electronically commutated electrical machines, their performances in steady and transient states, new design method for their configuration and new methods for automatic parameters identification. In the end the list of the most important publications for all three parts is enclosed.

ACS sampling system: design, implementation, and performance evaluation

Science.gov (United States)

Di Marcantonio, Paolo; Cirami, Roberto; Chiozzi, Gianluca

2004-09-01

By means of ACS (ALMA Common Software) framework we designed and implemented a sampling system which allows sampling of every Characteristic Component Property with a specific, user-defined, sustained frequency limited only by the hardware. Collected data are sent to various clients (one or more Java plotting widgets, a dedicated GUI or a COTS application) using the ACS/CORBA Notification Channel. The data transport is optimized: samples are cached locally and sent in packets with a lower and user-defined frequency to keep network load under control. Simultaneous sampling of the Properties of different Components is also possible. Together with the design and implementation issues we present the performance of the sampling system evaluated on two different platforms: on a VME based system using VxWorks RTOS (currently adopted by ALMA) and on a PC/104+ embedded platform using Red Hat 9 Linux operating system. The PC/104+ solution offers, as an alternative, a low cost PC compatible hardware environment with free and open operating system.

Obstacles using amorphous materials for volume applications

Energy Technology Data Exchange (ETDEWEB)

Kiessling, Albert [Festo AG and Co. KG, 73734, Esslingen (Germany); Reininger, Thomas, E-mail: drn@de.festo.com [Festo AG and Co. KG, 73734, Esslingen (Germany)

2012-10-15

This contribution is especially focussed on the attempt to use amorphous or nanocrystalline metals in position sensor applications and to describe the difficulties and obstacles encountered in coherence with the development of appropriate industrial high volume series products in conjunction with the related quality requirements. The main motivation to do these investigations was to beat the generally known sensors especially silicon based Hall-sensors as well as AMR- and GMR-sensors - well known from mobile phones and electronic storage devices like hard discs and others - in terms of cost-effectiveness and functionality.

Effect of alkali content on AC conductivity of borate glasses containing two transition metals

International Nuclear Information System (INIS)

Kashif, I.; Rahman, Samy A.; Soliman, A.A.; Ibrahim, E.M.; Abdel-Khalek, E.K.; Mostafa, A.G.; Sanad, A.M.

2009-01-01

Sodium borate glasses containing iron and molybdenum ions with the total concentration of transition ions constant and gradual substitution of sodium oxide (network modifier) by borate oxide (network former) was prepared. Densities, molar volume, DC and AC conductivities are measured. The trends of these properties are attributed to changes in the glass network structure. Their DC and AC conductivity increased with increasing NaO concentration. The increase of AC conductivity of sodium borate glasses is attributed to the chemical composition and the hopping mechanism of conduction. Measurements of the dielectric constant (ε) and dielectric loss (tan δ) as a function of frequency (50 Hz-100 kHz) and temperature (RT-600 K) indicate that the increase in dielectric constant and loss (ε and tan δ) values with increasing sodium ion content could be attributed to the assumption that Fe and Mo ions tend to assume network-forming position in the glass compositions studied. The variation of the value of frequency exponent s for all glass samples as the function of temperature at a definite frequency indicates that the value of s decreases with increasing the temperature which agrees with the correlated barrier-hopping (CBH) model.

Creating a driving profile for older adults using GPS devices and naturalistic driving methodology.

Science.gov (United States)

Babulal, Ganesh M; Traub, Cindy M; Webb, Mollie; Stout, Sarah H; Addison, Aaron; Carr, David B; Ott, Brian R; Morris, John C; Roe, Catherine M

2016-01-01

volumes of data. Driving Profiles for older adults can be created and compared month-to-month or year-to-year, allowing researchers to identify changes in driving patterns that are unavailable in controlled conditions.

Ac-conductivity and dielectric response of new zinc-phosphate glass/metal composites

Energy Technology Data Exchange (ETDEWEB)

Maaroufi, A., E-mail: maaroufi@fsr.ac.ma [University of Mohammed V, Laboratory of Composite Materials, Polymers and Environment, Department of Chemistry, Faculty of Sciences, P.B. 1014, Rabat-Agdal (Morocco); Oabi, O. [University of Mohammed V, Laboratory of Composite Materials, Polymers and Environment, Department of Chemistry, Faculty of Sciences, P.B. 1014, Rabat-Agdal (Morocco); Lucas, B. [XLIM UMR 7252 – Université de Limoges/CNRS, 123 avenue Albert Thomas, 87060 Limoges Cedex (France)

2016-07-01

The ac-conductivity and dielectric response of new composites based on zinc-phosphate glass with composition 45 mol%ZnO–55 mol%P{sub 2}O{sub 5}, filled with metallic powder of nickel (ZP/Ni) were investigated by impedance spectroscopy in the frequency range from 100 Hz to 1 MHz at room temperature. A high percolating jump of seven times has been observed in the conductivity behavior from low volume fraction of filler to the higher fractions, indicating an insulator – semiconductor phase transition. The measured conductivity at higher filler volume fraction is about 10{sup −1} S/cm and is frequency independent, while, the obtained conductivity for low filler volume fraction is around 10{sup −8} S/cm and is frequency dependent. Moreover, the elaborated composites are characterized by high dielectric constants in the range of 10{sup 5} for conductive composites at low frequencies (100 Hz). In addition, the distribution of the relaxation processes was also evaluated. The Debye, Cole-Cole, Davidson–Cole and Havriliak–Negami models in electric modulus formalism were used to model the observed relaxation phenomena in ZP/Ni composites. The observed relaxation phenomena are fairly simulated by Davidson–Cole model, and an account of the interpretation of results is given. - Highlights: • Composites of ZnO-P{sub 2}O{sub 5}/metal were investigated by impedance spectroscopy. • Original ac-conductivity behavior was discovered in ZnO-P{sub 2}O{sub 5}/metal composites. • High dielectric constant is measured in ZnO-P{sub 2}O{sub 5}/metal composites. • Dielectric constant as filler function is well interpreted with percolation theory. • Observed relaxation processes are well described using electric modulus formalism.

Modeling Driving Performance Using In-Vehicle Speech Data From a Naturalistic Driving Study.

Science.gov (United States)

Kuo, Jonny; Charlton, Judith L; Koppel, Sjaan; Rudin-Brown, Christina M; Cross, Suzanne

2016-09-01

We aimed to (a) describe the development and application of an automated approach for processing in-vehicle speech data from a naturalistic driving study (NDS), (b) examine the influence of child passenger presence on driving performance, and (c) model this relationship using in-vehicle speech data. Parent drivers frequently engage in child-related secondary behaviors, but the impact on driving performance is unknown. Applying automated speech-processing techniques to NDS audio data would facilitate the analysis of in-vehicle driver-child interactions and their influence on driving performance. Speech activity detection and speaker diarization algorithms were applied to audio data from a Melbourne-based NDS involving 42 families. Multilevel models were developed to evaluate the effect of speech activity and the presence of child passengers on driving performance. Speech activity was significantly associated with velocity and steering angle variability. Child passenger presence alone was not associated with changes in driving performance. However, speech activity in the presence of two child passengers was associated with the most variability in driving performance. The effects of in-vehicle speech on driving performance in the presence of child passengers appear to be heterogeneous, and multiple factors may need to be considered in evaluating their impact. This goal can potentially be achieved within large-scale NDS through the automated processing of observational data, including speech. Speech-processing algorithms enable new perspectives on driving performance to be gained from existing NDS data, and variables that were once labor-intensive to process can be readily utilized in future research. © 2016, Human Factors and Ergonomics Society.

The attenuation of the levitation force of HTS bulk exposed to AC magnetic field on the above NdFeB guideway

International Nuclear Information System (INIS)

Liu Minxian; Wang Yan

2012-01-01

The characteristic of the levitation force relaxation was studied by experiment. The levitation force is attenuated with the application of the AC external magnetic field. The decay increases with the amplitude of the A external magnetic field. The decay is almost independent of the frequency of AC field. In the present High Temperature Superconducting (HTS) maglev vehicle system, the air gaps between the adjacent permanent magnets make the magnetic fields above the NdFeB guideway non-uniform. So it is required to study the characteristics of levitation force of the HTS bulk affected by the non-uniform applied magnetic fields along the moving direction. In this paper, we have studied the characteristics of the levitation force relaxation by an experiment in which AC magnetic field generated by an electromagnet is used to simulate the time-varying magnetic field caused by the inhomogeneity of the NdFeB guideway. From the experiment results, it is found that the levitation force is attenuated with the application of the AC field, and the attenuation is increased with the amplitude of the AC field, but the attenuation is almost independent of the frequency the AC magnetic field.

The attenuation of the levitation force of HTS bulk exposed to AC magnetic field on the above NdFeB guideway

Energy Technology Data Exchange (ETDEWEB)

Liu Minxian, E-mail: liukey_sjtu@263.net [School of Computer Science and Technology, Southwest University of Science and Technology, Mianyang, Sichuan 621010 (China); Wang Yan [Luoyang Institute of Science and Technology, Luoyang, Henan 471023 (China)

2012-01-15

The characteristic of the levitation force relaxation was studied by experiment. The levitation force is attenuated with the application of the AC external magnetic field. The decay increases with the amplitude of the A external magnetic field. The decay is almost independent of the frequency of AC field. In the present High Temperature Superconducting (HTS) maglev vehicle system, the air gaps between the adjacent permanent magnets make the magnetic fields above the NdFeB guideway non-uniform. So it is required to study the characteristics of levitation force of the HTS bulk affected by the non-uniform applied magnetic fields along the moving direction. In this paper, we have studied the characteristics of the levitation force relaxation by an experiment in which AC magnetic field generated by an electromagnet is used to simulate the time-varying magnetic field caused by the inhomogeneity of the NdFeB guideway. From the experiment results, it is found that the levitation force is attenuated with the application of the AC field, and the attenuation is increased with the amplitude of the AC field, but the attenuation is almost independent of the frequency the AC magnetic field.

Phase-insensitive detectors for ac resistance bridges with application to temperature control systems

International Nuclear Information System (INIS)

Duncan, M.G.

1977-01-01

A method of detecting AC resistance bridge error signals with low sensitivity to stray reactances is presented. The detector, which compares magnitudes of two bridge signals, can be used in a fast resistance temperature control to maintain constant resistance to better than 2 ppM at resistances down to 5 milliohms

Low ac loss geometries in YBCO coated conductors

International Nuclear Information System (INIS)

Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

2007-01-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

Low ac loss geometries in YBCO coated conductors

Energy Technology Data Exchange (ETDEWEB)

Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

2007-10-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

Modeling of Wi-Fi IEEE 802.11ac Offloading Performance For 1000x Capacity Expansion of LTE-Advanced

DEFF Research Database (Denmark)

Hu, Liang; Sanchez, Maria Laura Luque; Maternia, Michael

2013-01-01

This paper studies indoor Wi-Fi IEEE 802.11ac deployment as a capacity expansion solution of LTE-A (Long Term Evolution-Advanced) network to achieve 1000 times higher capacity. Besides increasing the traffic volume by a factor of x1000, we also increase the minimum target user data rate to 10Mbit...

Microelectronics in power electronics and electrical drives

Energy Technology Data Exchange (ETDEWEB)

1982-01-01

From October, 1214, 1982 at Darmstadt (FRG) a meeting took place on ''Microelectronics in power electronics and Electrical Drives''. This volume contains the papers of the 65 lectures, held at the symposium. For each of the 10 papers dealing with problems on electric-powered vehicles a separate subject analysis has been carried out.

Finite-element analysis and comparison of the AC loss performance of BSCCO and YBCO conductors

International Nuclear Information System (INIS)

Stavrev, Svetlomir; Grilli, Francesco; Dutoit, Bertrand; Ashworth, Stephen

2006-01-01

The AC loss performance of two BSCCO and two YBCO conductors of different geometry, characterized by the same self-field critical current of 150 A, is analysed and compared quantitatively. The comparison is made using the finite-element method with a nonlinear B-dependent E-J relation. A new shell-region model is utilised for the simulations of thin YBCO strips. Different AC working conditions are simulated: self-field, applied external field, and combined transport current and external perpendicular field application. Magnetic field and current density profiles are investigated in order to illustrate the reasons for the loss difference in the conductors. Depending on the application, the advantages of using BSCCO or YBCO conductors with specific geometry are outlined

Development of absorber rod drive mechanisms for PFBR

International Nuclear Information System (INIS)

Veerasamy, R.; Dash, S.K.; Natarajan, S.; Rajan, M.; Prabhakar, R.; Kale, R.D.

1997-01-01

The Prototype Fast Breeder Reactor has two independent, diverse and fast acting shutdown systems each having its own neutron detectors, logic circuits, drive mechanisms and absorber rods. The respective drive mechanisms are called the control and safety rod drive mechanism and the diverse safety rod drive mechanism. The reliability of the shutdown systems has a direct bearing on the safety of the reactor. Hence a lot of development and testing efforts are required to optimise the design of the drive mechanisms and finally to qualify the same for reactor application. (author)

Direct amplitude detuning measurement with ac dipole

Directory of Open Access Journals (Sweden)

S. White

2013-07-01

Full Text Available In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning. The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

Development of magneto-rheologial fluid (MRF) based clutch for output torque control of AC motors

Science.gov (United States)

Nguyen, Q. Hung; Do, H. M. Hieu; Nguyen, V. Quoc; Nguyen, N. Diep; Le, D. Thang

2018-03-01

In industry, the AC motor is widely used because of low price, power availability, low cost maintenance. The main disadvantages of AC motors compared to DC motors are difficulty in speed and torque control, requiring expensive controllers with complex control algorithms. This is the basic limitations in the widespread adoption of AC motor systems for industrial automation. One feasible solution for AC motor control is using MRF (magneto-rheological fluid) based clutches (shortly called MR clutches) Although there have been many studies on MR clutches, most of these clutches used traditional configuration with coils wound on the middle cylindrical part and a compotator is used to supply power to the coils. Therefore, this type of MR clutches possesses many disadvantages such as high friction and unstable applied current due to commutator, complex structure which causes difficulty in manufacture, assembly, and maintenance. In addition, the bottleneck problem of magnetic field is also a challenging issue. In this research, we will develop a new type of MR clutches that overcomes the abovementioned disadvantages of traditional MR clutches and more suitable for application in controlling of AC motor. Besides, in this study, speed and torque control system for AC motors using developed MR clutches is designed and experimental validated.

AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile

Science.gov (United States)

El-Nahass, M. M.; Ali, H. A. M.

2012-06-01

AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.

Inside Solid State Drives (SSDs)

CERN Document Server

Micheloni, Rino; Eshghi, Kam

2013-01-01

Solid State Drives (SSDs) are gaining momentum in enterprise and client applications, replacing Hard Disk Drives (HDDs) by offering higher performance and lower power. In the enterprise, developers of data center server and storage systems have seen CPU performance growing exponentially for the past two decades, while HDD performance has improved linearly for the same period. Additionally, multi-core CPU designs and virtualization have increased randomness of storage I/Os. These trends have shifted performance bottlenecks to enterprise storage systems. Business critical applications such as online transaction processing, financial data processing and database mining are increasingly limited by storage performance. In client applications, small mobile platforms are leaving little room for batteries while demanding long life out of them. Therefore, reducing both idle and active power consumption has become critical. Additionally, client storage systems are in need of significant performance improvement as well ...

Alpha radioisotopes Ac-225 and Bi-213: a production and labelling of antibodies and peptides for clinical use

Energy Technology Data Exchange (ETDEWEB)

Bruchertseifer, Frank, E-mail: frank.bruchertseifer@ec.europa.eu [European Commission, Joint Research Centre, Karlsruhe (Germany)

2017-07-01

Full text: In various preclinical and clinical works the potential of the alpha emitters {sup 225}Ac and {sup 213}Bi as therapeutic radionuclides for application in targeted alpha therapy of cancer and infectious diseases was demonstrated. Both alpha emitters are available with high specific activity from established radionuclide generators. Their favorable chemical and physical properties have led to the conduction of a large number of preclinical studies and several clinical trials, demonstrating the feasibility, safety and therapeutic efficacy of targeted alpha therapy with {sup 225}Ac and {sup 213}Bi. This presentation will give an overview about the methods for the production of {sup 225}Ac and {sup 213}Bi, the {sup 225}Ac/{sup 213}Bi radionuclide generator systems, labelling of peptides and antibodies with {sup 225}Ac and {sup 213}Bi and relevant in vivo and in vitro works. (author)

Inkjet printing of multifilamentary YBCO for low AC loss coated conductors

International Nuclear Information System (INIS)

Hopkins, S C; Joseph, D; Mitchell-Williams, T B; Glowacki, B A; Calleja, A; Vlad, V R; Vilardell, M; Ricart, S; Granados, X; Puig, T; Obradors, X; Usoskin, A; Falter, M; Bäcker, M

2014-01-01

Considerable progress has been made with the development of REBCO coated conductors in recent years, and high performance conductors are available commercially. For many applications, however, the cost remains prohibitive, and AC losses discourage their selection for higher frequency applications. Chemical solution deposition (CSD) methods are attractive for low-cost, scalable preparation of buffer and superconductor layers, and in many respects inkjet printing is the method of choice, permitting non-contact deposition with minimal materials wastage and excellent control of coating thickness. Highly textured coatings of YBCO and Gd-doped CeO 2 have previously been reported on buffered metal substrates. Inkjet printing also introduces the possibility of patterning - directly depositing two and three dimensional structures without subtractive processing - offering a low-cost route to coated conductors with reduced AC losses. In this contribution, the inkjet deposition of superconducting YBCO tracks is reported on industrially relevant buffered metal substrates both by direct printing and an inverse patterning approach. In the latter approach, ceria tracks were printed reported, which are a candidate both for resistive filament spacers and buffer layers. TFA-based precursor solutions have been printed on SS/ABAD-YSZ/CeO 2 and Ni-W/LZO/CeO 2 RABiTS substrates, and the resulting multifilamentary samples characterised by microscopy and scanning Hall probe measurements. The prospects for future inkjet-printed low AC loss coated conductors are discussed, including control of interfilamentary resistivity and bridging, transposed filamentary structures and stabilisation material.

Driving with music : Effects on arousal and performance

NARCIS (Netherlands)

Unal, Ayca Berfu; de Waard, Dick; Epstude, Kai; Steg, Linda

2013-01-01

In the current study, we aimed at exploring the influence of music on driving performance, arousal and mental effort while carrying out a monotonous car-following task in a low-complexity traffic setting. Participants (N = 47) were randomly assigned to loud and moderate volume music groups, and

Bifurcation theory of ac electric arcing

International Nuclear Information System (INIS)

Christen, Thomas; Peinke, Emanuel

2012-01-01

The performance of alternating current (ac) electric arcing devices is related to arc extinction or its re-ignition at zero crossings of the current (so-called ‘current zero’, CZ). Theoretical investigations thus usually focus on the transient behaviour of arcs near CZ, e.g. by solving the modelling differential equations in the vicinity of CZ. This paper proposes as an alternative approach to investigate global mathematical properties of the underlying periodically driven dynamic system describing the electric circuit containing the arcing device. For instance, the uniqueness of the trivial solution associated with the insulating state indicates the extinction of any arc. The existence of non-trivial attractors (typically a time-periodic state) points to a re-ignition of certain arcs. The performance regions of arcing devices, such as circuit breakers and arc torches, can thus be identified with the regions of absence and existence, respectively, of non-trivial attractors. Most important for applications, the boundary of a performance region in the model parameter space is then associated with the bifurcation of the non-trivial attractors. The concept is illustrated for simple black-box arc models, such as the Mayr and the Cassie model, by calculating for various cases the performance boundaries associated with the bifurcation of ac arcs. (paper)

Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.

Science.gov (United States)

Han, Xiaomin; Li, Guojing; Zhang, Shuqun

2017-01-01

Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.

Caffeine antagonism of alcohol-induced driving impairment.

Science.gov (United States)

Liguori, A; Robinson, J H

2001-07-01

The extent to which caffeine antagonizes alcohol-induced impairment of simulated automobile driving at the current lowest legal American limit (0.08% BrAC) was the focus of this study. Fifteen adults swallowed a capsule (0, 200, or 400 mg caffeine) then drank a beverage (0.0 or 0.6 g/kg ethanol) in a within-subject, double-blind, randomized procedure. Forty-five minutes later, participants completed a test battery of subjective effects scales, dynamic posturography, critical flicker fusion (CFF), choice reaction time (CRT), divided attention (Stroop test), and simulated driving. Alcohol alone increased ratings of 'dizzy', 'drug effect', and 'high', slowed CRT and brake latency, and increased body sway. Caffeine alone increased ratings of 'alert' and 'jittery', but did not significantly affect body sway or psychomotor performance. Both caffeine doses comparably counteracted alcohol impairment of brake latency but not CRT or body sway. Brake latency with either alcohol-caffeine combination remained significantly longer than that with placebo. Stroop and CFF performance were unaffected by any drug condition. The results suggest that caffeine may increase alertness and improve reaction time after alcohol use but will not completely counteract alcohol impairment in a driver.

Experiment of enhancing critical current and reducing ac loss in pancake coil comprised of Ni-coated Bi-2223/Ag tape

International Nuclear Information System (INIS)

Alamgir, A.K.M.; Gu, C.; Han, Z.

2006-01-01

An approach of realizing high performance HTS coil comprised of ferromagnetic material-coated BSCCO tape is proposed. The concept of influencing critical current and ac loss is based on the magnetic shielding effect resulting in redirection of self-field flux-lines. In the previous article, ac performance of Ni-coated tape was demonstrated where the Ni-coating was introduced at the edge-regime of the finished tape in order to redirect the perpendicular component of self-field lines. In order to investigate the shielding effect on ac performance in HTS coil, a two-turn pancake coil comprised of Ni-coated Bi-2223/Ag tape is demonstrated in the present article. About 6.4% of critical current was enhanced and 30% of transport current ac loss was reduced by means of 40 μm thick and 0.3 mm long (from the edge toward center of the tape) Ni-coating. This result suggests that additional ferromagnetic loss could be compensated well by the shielding effect of the partial Ni-coating. The degree of enhancement in critical current as well as ferromagnetic impact on ac losses depend on the volume and geometry of ferromagnetic coating introduced. Therefore, it is very important to control the parameter of ferromagnetic coating of the tape in order to balance the critical current and ac loss for optimum coil performance

Experiment of enhancing critical current and reducing ac loss in pancake coil comprised of Ni-coated Bi-2223/Ag tape

Energy Technology Data Exchange (ETDEWEB)

Alamgir, A.K.M. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)]. E-mail: alam643@hotmail.com; Gu, C. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Han, Z. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)

2006-07-01

An approach of realizing high performance HTS coil comprised of ferromagnetic material-coated BSCCO tape is proposed. The concept of influencing critical current and ac loss is based on the magnetic shielding effect resulting in redirection of self-field flux-lines. In the previous article, ac performance of Ni-coated tape was demonstrated where the Ni-coating was introduced at the edge-regime of the finished tape in order to redirect the perpendicular component of self-field lines. In order to investigate the shielding effect on ac performance in HTS coil, a two-turn pancake coil comprised of Ni-coated Bi-2223/Ag tape is demonstrated in the present article. About 6.4% of critical current was enhanced and 30% of transport current ac loss was reduced by means of 40 {mu}m thick and 0.3 mm long (from the edge toward center of the tape) Ni-coating. This result suggests that additional ferromagnetic loss could be compensated well by the shielding effect of the partial Ni-coating. The degree of enhancement in critical current as well as ferromagnetic impact on ac losses depend on the volume and geometry of ferromagnetic coating introduced. Therefore, it is very important to control the parameter of ferromagnetic coating of the tape in order to balance the critical current and ac loss for optimum coil performance.

DOE Fundamentals Handbook: Electrical Science, Volume 2

International Nuclear Information System (INIS)

1992-06-01

The Electrical Science Fundamentals Handbook was developed to assist nuclear facility operating contractors provide operators, maintenance personnel, and the technical staff with the necessary fundamentals training to ensure a basic understanding terminology, and application. The handbook includes information on alternating current (AC) and direct current (DC) theory, circuits, motors, and generators; AC power and reactive components; batteries; AC and DC voltage regulators; transformers; and electrical test instruments and measuring devices. This information will provide personnel with a foundation for understanding the basic operation of various types of DOE nuclear facility electrical equipment

DOE Fundamentals Handbook: Electrical Science, Volume 1

International Nuclear Information System (INIS)

1992-06-01

The Electrical Science Fundamentals Handbook was developed to assist nuclear facility operating contractors provide operators, maintenance personnel, and the technical staff with the necessary fundamentals training to ensure a basic understanding of electrical theory, terminology, and application. The handbook includes information on alternating current (AC) and direct current (DC) theory, circuits, motors, and generators; AC power and reactive components; batteries; AC and DC voltage regulators; transformers; and electrical test instruments and measuring devices. This information will provide personnel with a foundation for understanding the basic operation of various types of DOE nuclear facility electrical equipment

DOE Fundamentals Handbook: Electrical Science, Volume 3

International Nuclear Information System (INIS)

1992-06-01

The Electrical Science Fundamentals Handbook was developed to assist nuclear facility operating contractors provide operators, maintenance personnel, and the technical staff with the necessary fundamentals training to ensure a basic understanding of electrical theory, terminology, and application. The handbook includes information on alternating current (AC) and direct current (DC) theory, circuits, motors and generators; AC power and reactive components; batteries; AC and DC voltage regulators; transformers; and electrical test instruments and measuring devices. This information will provide personnel with a foundation for understanding the basic operation of various types of DOE nuclear facility electrical equipment

DOE Fundamentals Handbook: Electrical Science, Volume 4

International Nuclear Information System (INIS)

1992-06-01

The Electrical Science Fundamentals Handbook was developed to assist nuclear facility operating contractors provide operators, maintenance personnel, and the technical staff with the necessary fundamentals training to ensure a basic understanding of electrical theory, terminology, and application. The handbook includes information on alternating current (AC) and direct current (DC) theory, circuits, motors, and generators; AC power and reactive transformers; and electrical test components; batteries; AC and DC voltage regulators; instruments and measuring devices. This information will provide personnel with a foundation for understanding the basic operation of various types of DOE nuclear facility electrical equipment

High-power piezo drive amplifier for large stack and PFC applications

Science.gov (United States)

Clingman, Dan J.; Gamble, Mike

2001-08-01

This paper describes the continuing development of Boeing High Power Piezo Drive Amplifiers. Described is the development and testing of a 1500 Vpp, 8 amp switching amplifier. This amplifier is used to drive a piezo stack driven rotor blade trailing edge flap on a full size helicopter. Also discuss is a switching amplifier designed to drive a Piezo Fiber Composite (PFC) active twist rotor blade. This amplifier was designed to drive the PFC material at 2000 Vpp and 0.5 amps. These amplifiers recycle reactive energy, allowing for a power and weight efficient amplifier design. This work was done in conjunction with the DARPA sponsored Phase II Smart Rotor Blade program and the NASA Langley Research Center sponsored Active Twist Rotor (ATR) blade program.

Hybrid immersed interface-immersed boundary methods for AC dielectrophoresis

International Nuclear Information System (INIS)

Hossan, Mohammad Robiul; Dillon, Robert; Dutta, Prashanta

2014-01-01

Dielectrophoresis, a nonlinear electrokinetic transport mechanism, has become popular in many engineering applications including manipulation, characterization and actuation of biomaterials, particles and biological cells. In this paper, we present a hybrid immersed interface–immersed boundary method to study AC dielectrophoresis where an algorithm is developed to solve the complex Poisson equation using a real variable formulation. An immersed interface method is employed to obtain the AC electric field in a fluid media with suspended particles and an immersed boundary method is used for the fluid equations and particle transport. The convergence of the proposed algorithm as well as validation of the hybrid scheme with experimental results is presented. In this paper, the Maxwell stress tensor is used to calculate the dielectrophoretic force acting on particles by considering the physical effect of particles in the computational domain. Thus, this study eliminates the approximations used in point dipole methods for calculating dielectrophoretic force. A comparative study between Maxwell stress tensor and point dipole methods for computing dielectrophoretic forces are presented. The hybrid method is used to investigate the physics of dielectrophoresis in microfluidic devices using an AC electric field. The numerical results show that with proper design and appropriate selection of applied potential and frequency, global electric field minima can be obtained to facilitate multiple particle trapping by exploiting the mechanism of negative dielectrophoresis. Our numerical results also show that electrically neutral particles form a chain parallel to the applied electric field irrespective of their initial orientation when an AC electric field is applied. This proposed hybrid numerical scheme will help to better understand dielectrophoresis and to design and optimize microfluidic devices

Application of second order sliding mode algorithms for output feedback control in hydraulic cylinder drives with profound valve dynamics

DEFF Research Database (Denmark)

Schmidt, Lasse; Andersen, Torben O.

2016-01-01

The application of second order sliding mode algorithms for output feedback control in hydraulic valve-cylinder drives appear attractive due to their simple realization and parametrization, and strong robustness toward bounded parameter variations and uncertainties. However, intrinsic nonlinear...

Neutral-beam current drive in tokamaks

International Nuclear Information System (INIS)

Devoto, R.S.

1986-01-01

The theory of neutral-beam current drive in tokamaks is reviewed. Experiments are discussed where neutral beams have been used to drive current directly and also indirectly through neoclassical effects. Application of the theory to an experimental test reactor is described. It is shown that neutral beams formed from negative ions accelerated to 500 to 700 keV are needed for this device

Neutral-beam current drive in tokamaks

International Nuclear Information System (INIS)

Devoto, R.S.

1987-01-01

The theory of neutral-beam current drive in tokamaks is reviewed. Experiments are discussed where neutral beams have been used to drive current directly and also indirectly through neoclassical effects. Application of the theory to an experimental test reactor is described. It is shown that neutral beams formed from negative ions accelerated to 500-700 keV are needed for this device

RNA interference suppression of mucin 5AC (MUC5AC reduces the adhesive and invasive capacity of human pancreatic cancer cells

Directory of Open Access Journals (Sweden)

Yamada Nobuya

2010-05-01

Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.

Gamma-irradiation produces active chlorine species (ACS) in physiological solutions: Secoisolariciresinol diglucoside (SDG) scavenges ACS - A novel mechanism of DNA radioprotection.

Science.gov (United States)

Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo

2016-09-01

Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged

Hopping models and ac universality

DEFF Research Database (Denmark)

Dyre, Jeppe; Schrøder, Thomas

2002-01-01

Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

Small Screen Use and Driving Safety.

Science.gov (United States)

Atchley, Paul; Strayer, David L

2017-11-01

The increased availability of "small screens," wireless devices with Internet-enabled connections, and their associated applications has almost overnight changed the way that we interact with our phones. The current work outlines some of the aspects of this problem as it relates to the influence of small screens on driving safety. Small screens are highly compelling to drivers, both for the information they convey and because the ability to ignore them while driving is impaired by cognitive resources used by the driving task itself. However, much is unknown about why people make choices to multitask while driving. Given the safety risks, it is recommended that parents, the public, and regulators take a stand against the use of Internet-enabled small screens unrelated to driving when the vehicle is in motion. Copyright © 2017 by the American Academy of Pediatrics.

Computer quantification of “angle of collapse” on maximum expiratory flow volume curve for diagnosing asthma-COPD overlap syndrome

Directory of Open Access Journals (Sweden)

Wang W

2016-12-01

Full Text Available Wei Wang, Mengshuang Xie, Shuang Dou, Liwei Cui, Wei Xiao Department of Pulmonary Medicine, Qilu Hospital, Shandong University, Jinan, People’s Republic of China Background: In a previous study, we demonstrated that asthma patients with signs of emphysema on quantitative computed tomography (CT fulfill the diagnosis of asthma-COPD overlap syndrome (ACOS. However, quantitative CT measurements of emphysema are not routinely available for patients with chronic airway disease, which limits their application. Spirometry was a widely used examination tool in clinical settings and shows emphysema as a sharp angle in the maximum expiratory flow volume (MEFV curve, called the “angle of collapse (AC”. The aim of this study was to investigate the value of the AC in the diagnosis of emphysema and ACOS. Methods: This study included 716 participants: 151 asthma patients, 173 COPD patients, and 392 normal control subjects. All the participants underwent pulmonary function tests. COPD and asthma patients also underwent quantitative CT measurements of emphysema. The AC was measured using computer models based on Matlab software. The value of the AC in the diagnosis of emphysema and ACOS was evaluated using receiver-operating characteristic (ROC curve analysis. Results: The AC of COPD patients was significantly lower than that of asthma patients and control subjects. The AC was significantly negatively correlated with emphysema index (EI; r=-0.666, P<0.001, and patients with high EI had a lower AC than those with low EI. The ROC curve analysis showed that the AC had higher diagnostic efficiency for high EI (area under the curve =0.876 than did other spirometry parameters. In asthma patients, using the AC ≤137° as a surrogate criterion for the diagnosis of ACOS, the sensitivity and specificity were 62.5% and 89.1%, respectively. Conclusion: The AC on the MEFV curve quantified by computer models correlates with the extent of emphysema. The AC may become a

A Multi-Pulse Front-End Rectifier System with Electronic Phase-Shifting for Harmonic Mitigation in Motor Drive Applications

DEFF Research Database (Denmark)

Zare, Firuz; Davari, Pooya; Blaabjerg, Frede

2016-01-01

In this paper, an electronic phase-shifting strategy has been optimized for a multi-parallel configuration of line-commutated rectifiers with a common dc-bus voltage used in motor drive application. This feature makes the performance of the system independent of the load profile and maximizes its...

Wave-function analysis of dynamic cancellation of ac Stark shifts in optical lattice clocks by use of pulsed Raman and electromagnetically-induced-transparency techniques

International Nuclear Information System (INIS)

Yoon, Tai Hyun

2007-01-01

We study analytically the dynamic cancellation of ac Stark shift in the recently proposed pulsed electromagnetically-induced-transparency (EIT-)Raman optical lattice clock based on the wave-function formalism. An explicit expression for the time evolution operator corresponding to the effective two-level interaction Hamiltonian has been obtained in order to explain the atomic phase shift cancellation due to the ac Stark shift induced by the time-separated laser pulses. We present how to determine an optimum value of the common detuning of the driving fields at which the atomic phase shift cancels completely with the parameters for the practical realization of the EIT-Raman optical lattice clock with alkaline-earth-metal atoms

Transport AC losses in YBCO coated conductors

Energy Technology Data Exchange (ETDEWEB)

Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

2007-09-15

Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

Improved insecticidal toxicity by fusing Cry1Ac of Bacillus thuringiensis with Av3 of Anemonia viridis.

Science.gov (United States)

Yan, Fu; Cheng, Xing; Ding, Xuezhi; Yao, Ting; Chen, Hanna; Li, Wenping; Hu, Shengbiao; Yu, Ziquan; Sun, Yunjun; Zhang, Youming; Xia, Liqiu

2014-05-01

Av3, a neurotoxin of Anemonia viridis, is toxic to crustaceans and cockroaches but inactive in mammals. In the present study, Av3 was expressed in Escherichia coli Origami B (DE3) and purified by reversed-phase liquid chromatography. The purified Av3 was injected into the hemocoel of Helicoverpa armigera, rendering the worm paralyzed. Then, Av3 was expressed alone or fusion expressed with the Cry1Ac in acrystalliferous strain Cry(-)B of Bacillus thuringiensis. The shape of Cry1Ac was changed by fusion with Av3. The expressed fusion protein, Cry1AcAv3, formed irregular rhombus- or crescent-shaped crystalline inclusions, which is quite different from the shape of original Cry1Ac crystals. The toxicity of Cry1Ac was improved by fused expression. Compared with original Cry1Ac expressed in Cry(-)B, the oral toxicity of Cry1AcAv3 to H. armigera was elevated about 2.6-fold. No toxicity was detected when Av3 was expressed in Cry(-)B alone. The present study confirmed that marine toxins could be used in bio-control and implied that fused expression with other insecticidal proteins could be an efficient way for their application.

Green Eco-Driving Effects in Non-Congested Cities

Directory of Open Access Journals (Sweden)

Juan Francisco Coloma

2017-12-01

Full Text Available Despite technological advances in engines and fuels, the transportation sector is still one of the largest emitters of greenhouse gas (GHG. Driving patterns, including eco-driving techniques, are a complementary measure for saving GHG emissions. Most eco-driving studies so far have been conducted in large cities suffering chronic congestion problems. The aim of this research is therefore to analyse the potential of driver behaviour for reducing emissions in a small non-congested city. Driver performance parameters such as travel speeds, number of stops, revolutions per minute, and maximum acceleration-deceleration are also studied. The methodology is designed to measure the effect of both eco-driving and eco-routing under real traffic conditions. A campaign was carried out in the city of Caceres (Spain to collect data on various types of roads under different traffic conditions. This research concludes that eco-driving leads to CO2 savings on all routes and road types of 17% in gasoline engines and 21% in diesel, although travel times are increased by 7.5% on average. The shortest route is also the most ecological, regardless of the traffic volume and characteristics, implying that consumption in non-congested cities depends mainly on distance travelled rather than driving patterns in terms of number of stops, speed and acceleration.

Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum

Directory of Open Access Journals (Sweden)

Pijar Riza Anugerah

2015-10-01

Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.

Characterization of tetraaza-AC8, a surfactant with cation complexing potential

International Nuclear Information System (INIS)

Arleth, Lise

1995-01-01

Being a surfactant with cation complexing potential, the Tetraaza-AC8 can, in the long term, possibly be applied for the selection and extraction of specific cations. This can be of interest for the handling of radioactive waste or in the chemical industries for extraction of rare earth molecules as for example Rhodium. A thorough characterization of the behavior and abilities of Tetraaza-AC8 is necessary before one can even think of taking it into a larger production with sight of a specific application. This project deals with the characterization of the behavior and abilities of Tetraaza- AC8. In order to make use of the surface active properties of Tetraaza-AC8 it is necessary to dissolve it in some kind of solvent. As water is an important solvent which is, in addition, both inexpensive and non-polluting it is the natural choice. The aim of the project can then precised as follows: To study the micelle formation of dilute aqueous solutions of Tetraaza- AC8 and to determine how the micelle formation is influenced by the addition of respectively CsF, CuF_2 and RhCl_3 to the solutions The primary method of analysis is small-angle scattering. As small-angle x-ray scattering (SAXS) and small-angle neutron scattering (SANS) emphasizes different parts of the micellar structure, the combination of the methods allows a good determination of the micellar shape. In order to support the interpretation of scattering data, density measurements, surface tension measurements and UV/visible light spectroscopy are also performed. The scattering data have been analyzed according to two fundamentally different methods of analysis namely the method of indirect Fourier transform and the method of fitting molecular based models of the micelles to the scattering spectra. The first chapter contains a short introduction to the field of surfactants and complexing macrocycles. The chemical structure of Tetraaza-AC8 will be explained and motivated. A short description of the synthesis

Adjustable speed drive study, June 1985 to September 1988. Part 2: Appendices

Science.gov (United States)

Wallace, Alan

1989-08-01

Advances in speed control for motors in recent years, notably those in power electronics, have widened the range of application for several adjustable speed drive (ASD) types to include the smaller horsepower sizes. The dc motor drive, formerly in almost universal use for speed control, is being challenged by the high efficiency induction motor/pulse width modulation (PWM) drive; and for special small horsepower size applications, by the permanent magnet motor/PWM inverter drive or by the switched reluctance motor drive. The main characteristics of the several ASD types suitable for small horsepower size applications are discussed, as well as their unwanted side effects: poor power factor, harmonic distortion of the supply, acoustic noise, and electromagnetic interference. A procedure is recommended for determining which, if any, ASD to use.

ANIMASI IKLAN 3D SAFETY DRIVING

Directory of Open Access Journals (Sweden)

Yusron Aulia

2013-02-01

Full Text Available Tujuan dari penelitian ini adalah membuat sebuah aplikasi video iklan bertemakan tentang keamanan mengemudi sebagai media edukasi kepada masyarakat tentang pentingnya  keamanan  dalam  mengemudi.  Begitu  pentingnya  keamanan  mengemudi, maka  menjadi  pengemudi  aman  menjadi  keharusan  bagi setiap  anggota  masyarakat. Metode pengumpulan data yang digunakan dalam penelitian ini adalah observasi, dokumentasi dan studi pustaka. Untuk pengembangan sistem multimedia dilakukan berdasarkan tiga tahapan yaitu: Pra Produksi, Produksi, dan Pasca Produksi. Hasil dari penelitian   ini   berupa   aplikasi   video   iklan   animasi   3D   bertemakan   keamanan mengemudi. Aplikasi yang dihasilkan berekstensi .mpeg untuk CD/DVD, .mkv untuk diputar di computer, dan .mp4 yang diunggah di internet. Selain fungsi iklan animasi ini sebagai penyampaian pesan dan memotivasi masyarakat untuk lebih disiplin, tertib dan aman dalam mengemudi, dan juga sebagai penginspirasi untuk lebih mengembangkan animasi karya asli Indonesia Kata kunci : animasi, iklan, 3D, safety, driving.The purpose of this research  is to create  an  application  video on driving safety themed advertising  as a medium to educate people about the importance of safety in driving. Once the importance of driving safety, becomes a safe driver is a must for every member of the community. Data collection methods used in this study is the observation, documentation and literature.  For the development of multimedia systems is done based on three stages: Pre-Production,  Production,  and Post Production.  The results of this research  is  the  application  of 3D  animation  video ads  themed  driving  safety. The resulting application extension .Mpeg to CD / DVD .Mkv to be played on the computer, and .Mp4 uploaded on the internet. In addition to the function of these animated ads as delivering  a  message  and  motivate people to be more disciplined

Dicty_cDB: FC-AC21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

Barnwell Nuclear Fuels Plant applicability study. Volume III. Appendices

International Nuclear Information System (INIS)

1978-03-01

Volume III suppliees supporting information to assist Congress in making a decision on the optimum utilization of the Barnwell Nuclear Fuels Plant. Included are applicable fuel cycle policies; properties of reference fuels; description and evaluation of alternative operational (flue cycle) modes; description and evaluation of safeguards systems and techniques; description and evaluation of spiking technology; waste and waste solidification evaluation; and Department of Energy programs relating to nonproliferation

Ratchet Effects, Negative Mobility, and Phase Locking for Skyrmions on Periodic Substrates

Science.gov (United States)

Reichhardt, Charles; Ray, Dipanjan; Olson Reichhardt, Cynthia

We examine the dynamics of skyrmions interacting with 1D and 2D periodic substrates in the presence of dc and ac drives. We find that the Magnus term strongly affects the skyrmion dynamics and that new kinds of phenomena can occur which are absent for overdamped ac and dc driven particles interacting with similar substrates. We show that it is possible to realize a Magnus induced ratchet for skyrmions interacting with an asymmetric potential, where the application of an ac drive can produce quantized dc motion of the skyrmions even when the ac force is perpendicular to the substrate asymmetry direction. For symmetric substrates it is also possible to achieve a negative mobility effect where the net skyrmion motion runs counter to an applied dc drive. Here, as a function of increasing dc drive, the velocity-force curves show a series of locking phases that have different features from the classic Shapiro steps found in overdamped systems. In the phase locking and ratcheting states, the skyrmions undergo intricate 2D orbits induced by the Magnus term.

Visual inspection technology in the hard disc drive industry

CERN Document Server

Muneesawang, Paisarn

2015-01-01

A presentation of the use of computer vision systems to control manufacturing processes and product quality in the hard disk drive industry. Visual Inspection Technology in the Hard Disk Drive Industry is an application-oriented book borne out of collaborative research with the world's leading hard disk drive companies. It covers the latest developments and important topics in computer vision technology in hard disk drive manufacturing, as well as offering a glimpse of future technologies.

Alcohol-control public service announcements (PSAs) and drunk-driving fatal accidents in the United States, 1996-2010.

Science.gov (United States)

Niederdeppe, Jeff; Avery, Rosemary; Miller, Emily N

2017-06-01

Widespread concern regarding the detrimental effects of excessive alcohol consumption (especially by minors) and associated social problems (particularly drunk driving) continues to exist among policymakers, law enforcement officers, and the general public. Alcohol consumption is a leading contributor to death from injuries, which itself is one of the main causes of death for people under 21years of age in the United States. This study examines the relationship between the volume and timing of alcohol-control public service announcements (PSAs) and rates of drunk-driving fatal accidents in the U.S. We estimate ordinary least squares (OLS) regression models to predict rates of drunk-driving fatal accidents by state and month as a function of the volume of alcohol-control PSAs aired during the previous 8months. Models include controls for state anti-drunk-driving laws and regulations, state demographic characteristics, state taxes on alcohol, calendar year, and seasonality. Results indicate that higher volumes of anti-drunk driving PSAs airing in the preceding 2 to 3months are associated, albeit modest in magnitude, with reduced rates of drunk-driving fatal accidents. The regression coefficients are largest for adults (relative to underage drunk drivers) and when the PSAs air during prime time (relative to daytime or nighttime). We conclude that PSAs could play an important contributing role in reducing drunk-driving fatal accidents, although levels of exposure and potential effects likely remain modest due to reliance on donated air time. Well-funded anti-drunk driving campaigns could achieve higher levels of exposure and have a larger impact. Copyright © 2017 Elsevier Inc. All rights reserved.

THERMIONIC AC GENERATION

Science.gov (United States)

is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)

Simulation and Analysis of Chain Drive Systems

DEFF Research Database (Denmark)

Pedersen, Sine Leergaard

mathematical models, and compare to the prior done research. Even though the model is developed at first for the use of analysing chain drive systems in marine engines, the methods can with small changes be used in general, as for e.g. chain drives in industrial machines, car engines and motorbikes. A novel...... with a real tooth profile proves superior to other applied models. With this model it is possible to perform a dynamic simulation of large marine engine chain drives. Through the application of this method, it is shown that the interrelated dynamics of the elements in the chain drive system is captured...

21 CFR 880.6320 - AC-powered medical examination light.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...

Tribological Performance of Hydrogenated Amorphous Carbon (a-C: H DLC Coating when Lubricated with Biodegradable Vegetal Canola Oil

Directory of Open Access Journals (Sweden)

H.M. Mobarak

2014-06-01

Full Text Available Increasing environmental awareness and demands for lowering energy consumptions are strong driving forces behind the development of the vehicles of tomorrow. Without the advances of lubricant chemistry and adequate lubricant formulation, expansion of modern engines would not have been possible. Considering environmental awareness factors as compared to mineral oils, vegetal oil based biolubricants are renewable, biodegradable, non-toxic and have a least amount of greenhouse gases. Furthermore, improvement in engine performance and transmission components, which were impossible to achieve by applying only lubricants design, is now possible through diamond like carbon (DLC coatings. DLC coatings exhibit brilliant tribological properties, such as good wear resistance and low friction. In this regard, tribological performance of a-C: H DLC coating when lubricated with Canola vegetal oil has been investigated by the help of a ball-on-flat geometry. Experimental results demonstrated that the a-C: H DLC coating exhibited better performance with Canola oil in terms of friction and wear as compared to the uncoated materials. Large amount of polar components in the Canola oil significantly improved the tribological properties of the a-C:H coating. Thus, usage of a-C: H DLC coating with Canola oil in the long run may have a positive impact on engine life.

SU-E-T-611: Effective Treatment Volume of the Small Size IORT Applicators

International Nuclear Information System (INIS)

Krechetov, A.S.; Goer, D.A.

2014-01-01

Purpose Mobile electron linear accelerators are gaining more attention recently, providing a lower cost and simpler way to perform intraoperative treatment. However, the simplicity of the treatment process does not eliminate the need for proper attention to the technical aspects of the treatment. One of the potential pitfalls is incorrect selection of the appropriate applicator size to adequately cover the tumor bed to the prescription dose. When treating tumor beds in the pelvis, the largest applicator that fits into the pelvis is usually selected as there is concern about microscopic extension of the disease along the sidewalls of the pelvis. But when treating early stage breast tumors, there is a natural tendency to select an applicator as small as possible so as not to jeopardize cosmesis. Methods This investigation questions how much of the typical breast treatment volume gets adequate exposure and what is the correct strategy in selecting the proper applicator size. Actual data from isodose scans were analyzed. Results We found that typical treatment dose prescriptions can cover as much as 80% and as little as 20% of the nominal treatment volume depending on the applicator size and energy of the beam and whether the dose is prescribed to the 80 or 90% isodose level. Treatment volume is defined as a cylinder with diameter equal to applicator and height equal to the corresponding D80 or D90 depth. Conclusion If mobile linear accelerators are used, there can be significant amount of “cold volume” depending on the applicator size and this should be taken into account when selecting the applicator that is needed. Using too small of an applicator could result in significant under-dosing to the tissue at risk. Long-term clinical data demonstrates that selecting an adequate field size results in good ontological control as well as excellent cosmesis. Intraop Medical Corp was providing facilities and equipment for this research

Ac-dc converter firing error detection

International Nuclear Information System (INIS)

Gould, O.L.

1996-01-01

Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

General motors front wheel drive 2-mode hybrid transmission

Energy Technology Data Exchange (ETDEWEB)

Hendrickson, James [General Motors Corp., Pontiac, MI (United States). New Transmission Products Group.; Holmes, Alan G. [General Motors Corp., Pontiac, MI (United States). Powertrain Hybrid Architecture

2009-07-01

General Motors now expands the application of two-mode hybrid technology to front wheel drive vehicles with the development of a hybrid electric transmission packaged into essentially the same space as a conventional automatic transmission for front wheel drive. This was accomplished using a space-efficient arrangement based on two planetary gear sets and electric motor-generators with large internal diameters. A combination of damper and hydraulically-controlled clutch allow comfortable shutdown and restarting of large-displacement engines in front wheel drive vehicles. The hybrid system delivers electric low-speed urban driving, two continuously variable ranges of transmission speed ratios, four fixed transmission speed ratios, electric acceleration boosting, and regenerative braking. In the first vehicle application, the two-mode hybrid helps to reduce vehicle fuel consumption by approximately one-third. (orig.)

Extended driving impairs nocturnal driving performances.

Directory of Open Access Journals (Sweden)

Patricia Sagaspe

Full Text Available Though fatigue and sleepiness at the wheel are well-known risk factors for traffic accidents, many drivers combine extended driving and sleep deprivation. Fatigue-related accidents occur mainly at night but there is no experimental data available to determine if the duration of prior driving affects driving performance at night. Participants drove in 3 nocturnal driving sessions (3-5 am, 1-5 am and 9 pm-5 am on open highway. Fourteen young healthy men (mean age [+/-SD] = 23.4 [+/-1.7] years participated Inappropriate line crossings (ILC in the last hour of driving of each session, sleep variables, self-perceived fatigue and sleepiness were measured. Compared to the short (3-5 am driving session, the incidence rate ratio of inappropriate line crossings increased by 2.6 (95% CI, 1.1 to 6.0; P<.05 for the intermediate (1-5 am driving session and by 4.0 (CI, 1.7 to 9.4; P<.001 for the long (9 pm-5 am driving session. Compared to the reference session (9-10 pm, the incidence rate ratio of inappropriate line crossings were 6.0 (95% CI, 2.3 to 15.5; P<.001, 15.4 (CI, 4.6 to 51.5; P<.001 and 24.3 (CI, 7.4 to 79.5; P<.001, respectively, for the three different durations of driving. Self-rated fatigue and sleepiness scores were both positively correlated to driving impairment in the intermediate and long duration sessions (P<.05 and increased significantly during the nocturnal driving sessions compared to the reference session (P<.01. At night, extended driving impairs driving performances and therefore should be limited.

LLE Review: Volume 63. Quarterly report, April--June 1995

International Nuclear Information System (INIS)

Craxton, R.S.

1995-01-01

This volume of the LLE Review, covering the period of April--June 1995, includes a description of the initial performance results of the upgraded OMEGA laser system. A series of acceptance tests were completed, demonstrating that all 60 beams can irradiate targets with more energy and better beam balance than was required by the Department of Energy's acceptance criteria. Other articles in this volume include a description of a novel energy measurement system used to diagnose all 60 OMEGA beams; a theoretical calculation of the cutoff wave number of the ablative Rayleigh-Taylor instability, applicable to both direct and indirect drive; a description of a new algorithm used for designing distributed phase plates that will produce super-Gaussian focal-plane irradiance profiles: a study of the photoresponse of high-T c YBCO thin films; and a description of magnetorheological finishing, a new process for optics polishing

Full drive-by-wire dynamic control for four-wheel-steer all-wheel-drive vehicles

Science.gov (United States)

Fahimi, Farbod

2013-03-01

Most of the controllers introduced for four-wheel-steer (4WS) vehicles are derived with the assumption that the longitudinal speed of the vehicle is constant. However, in real applications, the longitudinal speed varies, and the longitudinal, lateral, and yaw dynamics are coupled. In this paper, the longitudinal dynamics of the vehicle as well as its lateral and yaw motions are controlled simultaneously. This way, the effect of driving/braking forces of the tires on the lateral and yaw motions of the vehicle are automatically included in the control laws. To address the dynamic parameter uncertainty of the vehicle, a chatter-free variable structure controller is introduced. Elimination of chatter is achieved by introducing a dynamically adaptive boundary layer thickness. It is shown via simulations that the proposed control approach performs more robustly than the controllers developed based on dynamic models, in which longitudinal speed is assumed to be constant, and only lateral speed and yaw rate are used as system states. Furthermore, this approach supports all-wheel-drive vehicles. Front-wheel-drive or rear-wheel-drive vehicles are also supported as special cases of an all-wheel-drive vehicle.

Passive wide spectrum harmonic filter for adjustable speed drives in oil and gas industry

Science.gov (United States)

Al Jaafari, Khaled Ali

Non-linear loads such as variable speed drives constitute the bulky load of oil and gas industry power systems. They are widely used in driving induction and permanent magnet motors for variable speed applications. That is because variable speed drives provide high static and dynamic performance. Moreover, they are known of their high energy efficiency and high motion quality, and high starting torque. However, these non-linear loads are main sources of current and voltage harmonics and lower the quality of electric power system. In fact, it is the six-pulse and twelve-pulse diode and thyristor rectifiers that spoil the AC power line with the dominant harmonics (5th, 7th, 11th). They provide DC voltage to the inverter of the variable speed drives. Typical problems that arise from these harmonics are Harmonic resonances', harmonic losses, interference with electronic equipment, and line voltage distortion at the Point of Common Coupling (PCC). Thus, it is necessary to find efficient, reliable, and economical harmonic filters. The passive filters have definite advantage over active filters in terms of components count, cost and reliability. Reliability and maintenance is a serious issue in drilling rigs which are located in offshore and onshore with extreme operating conditions. Passive filters are tuned to eliminate a certain frequency and therefore there is a need to equip the system with more than one passive filter to eliminate all unwanted frequencies. An alternative solution is Wide Spectrum Harmonic passive filter. The wide spectrum harmonic filters are becoming increasingly popular in these applications and found to overcome some of the limitations of conventional tuned passive filter. The most important feature of wide spectrum harmonic passive filters is that only one capacitor is required to filter a wide range of harmonics. Wide spectrum filter is essentially a low-pass filter for the harmonic at fundamental frequency. It can also be considered as a

Sensorless optimal sinusoidal brushless direct current for hard disk drives

Science.gov (United States)

Soh, C. S.; Bi, C.

2009-04-01

Initiated by the availability of digital signal processors and emergence of new applications, market demands for permanent magnet synchronous motors have been surging. As its back-emf is sinusoidal, the drive current should also be sinusoidal for reducing the torque ripple. However, in applications like hard disk drives, brushless direct current (BLDC) drive is adopted instead of sinusoidal drive for simplification. The adoption, however, comes at the expense of increased harmonics, losses, torque pulsations, and acoustics. In this paper, we propose a sensorless optimal sinusoidal BLDC drive. First and foremost, the derivation for an optimal sinusoidal drive is presented, and a power angle control scheme is proposed to achieve an optimal sinusoidal BLDC. The scheme maintains linear relationship between the motor speed and drive voltage. In an attempt to execute the sensorless drive, an innovative power angle measurement scheme is devised, which takes advantage of the freewheeling diodes and measures the power angle through the detection of diode voltage drops. The objectives as laid out will be presented and discussed in this paper, supported by derivations, simulations, and experimental results. The proposed scheme is straightforward, brings about the benefits of sensorless sinusoidal drive, negates the need for current sensors by utilizing the freewheeling diodes, and does not incur additional cost.

Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

Directory of Open Access Journals (Sweden)

Amir V. Tavakoli

2017-09-01

Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

ELECTRON CYCLOTRON CURRENT DRIVE IN DIII-D: EXPERIMENT AND THEORY

International Nuclear Information System (INIS)

PRATER, R; PETTY, CC; LUCE, TC; HARVEY, RW; CHOI, M; LAHAYE, RJ; LIN-LIU, Y-R; LOHR, J; MURAKAMI, M; WADE, MR; WONG, K-L

2003-01-01

A271 ELECTRON CYCLOTRON CURRENT DRIVE IN DIII-D: EXPERIMENT AND THEORY. Experiments on the DIII-D tokamak in which the measured off-axis electron cyclotron current drive has been compared systematically to theory over a broad range of parameters have shown that the Fokker-Planck code CQL3D provides an excellent model of the relevant current drive physics. This physics understanding has been critical in optimizing the application of ECCD to high performance discharges, supporting such applications as suppression of neoclassical tearing modes and control and sustainment of the current profile

Gas turbine drives

Energy Technology Data Exchange (ETDEWEB)

1981-01-01

Developments in gas turbine drives are reviewed, e.g., low weight per unit power and thrust-weight ratio, fast availability of the maximum speed, absolute resistance to cold and to droplet formation vibrationeless run, and low exhaust gas temperatures. Applications in aeronautic engineering (turbofan), power stations, marine propulsion systems, railways and road transportation vehicles are mentioned.

AC-600 passive containment cooling system performance research

International Nuclear Information System (INIS)

Jia Baoshan; Yu Jiyang; Shi Junying

1997-01-01

a code named PCCSAC which is able to predict both the evaporating film on the outside surface of the vessel and the condensed film on its inside is developed successfully. It is a special software tool to analyze the passive containment cooling system (PCCS) performance in the design of AC-600. The author includes the establishment of physical models, selection of numerical methods, debugging and verification of the code and application of the code in the AC-600 PCCS. In physical models, the fundamental conservation equations about various areas and heat conduction equations are established. In order to make the equations to meet the closed form of solution, a lot of structure formulae are complemented. After repeated selection and demonstration of the numerical methods, the backward difference method Gear which is generally used for stiff problem is chosen for the solution of ordinary differential equations derived from the physical models. The results of standard example calculated by the PCCSAC code and the COMMIX code which is used to analyze westinghouse AP-600 are same in the main. The reliability and validity are verified from the calculations. The PCCSAC code is applied in the calculations of two important LOCA used in the containment safety analyses. The sensitivity of main parameters in the system based on LOCA are studied. All the results are reasonable and in agreement with the theoretical analyses. It can be concluded that the PCCSAC code is able to be used for the analyses of AC-600 PCCS performance

Performance of Magnetic-Superconductor Non-Contact Harmonic Drive for Cryogenic Space Applications: Speed, Torque and Efficiency Measurements

Science.gov (United States)

Perez-Diaz, Jose Luis; Diez-Jimenez, Efren; Valiente-Blanco, Ignacio; Cristache, Cristian; Alvarez-Valenzuela, Marco-Antonio; Sanchez-Garcia-Casarrubios, Juan

2015-09-01

Harmonic Drives are widely used in space mainly because of their compactness, large reduction ratio ad zero backlash. However, their use in extreme environments like in cryogenic temperatures is still a challenge. Lubrication, lifetime and fatigue are still issues under these conditions.The MAGDRIVE project, funded by the EU Space FP7 was devoted to test a new concept of harmonic drive reducer. By using the magnetic distance force interactions of magnets and ferromagnetic materials, all the conventional mechanical elements of a Harmonic Drives (teeth, flexspline and ball bearings) are substituted by contactless mechanical components (magnetic gear and superconducting magnetic bearings). The absence of contact between any moving parts prevents wear, lubricants are no longer required and the operational life time is greatly increased. As the magnetic transmission is continuous there is no backlash in the reduction. MAG SOAR Company is already providing contactless mechanical components for space applications able to operate in a wide range of temperatures.In this paper the tests results of a -1:20 ratio MAGDRIVE prototype are reported. In these tests successful operation at 40 K and 10-3 Pa was demonstrated for more than 1.5 million input cycles. A maximum torque of 3 Nm and efficiency higher than 75% at 3000 rpm were demonstrated. The maximum tested input speed was 3000 rpm -six times the previous existing record for harmonic drives at cryogenic temperature.

Materials Research Society Symposium Proceedings Volume 635. Anisotropic Nanoparticles - Synthesis, Characterization and Applications

National Research Council Canada - National Science Library

Lyon, L

2000-01-01

This volume contains a series of papers originally presented at Symposium C, "Anisotropic Nanoparticles Synthesis, Characterization and Applications," at the 2000 MRS Fall Meeting in Boston, Massachusetts...

Raytracing and Direct-Drive Targets

Science.gov (United States)

Schmitt, Andrew J.; Bates, Jason; Fyfe, David; Eimerl, David

2013-10-01

Accurate simulation of the effects of laser imprinting and drive asymmetries in directly driven targets requires the ability to distinguish between raytrace noise and the intensity structure produced by the spatial and temporal incoherence of optical smoothing. We have developed and implemented a smoother raytrace algorithm for our mpi-parallel radiation hydrodynamics code, FAST3D. The underlying approach is to connect the rays into either sheets (in 2D) or volume-enclosing chunks (in 3D) so that the absorbed energy distribution continuously covers the propagation area illuminated by the laser. We will describe the status and show the different scalings encountered in 2D and 3D problems as the computational size, parallelization strategy, and number of rays is varied. Finally, we show results using the method in current NIKE experimental target simulations and in proposed symmetric and polar direct-drive target designs. Supported by US DoE/NNSA.

Application of DC-AC Hybrid Grid and Solar Photovoltaic Generation with Battery Storage Using Smart Grid

Directory of Open Access Journals (Sweden)

Shoaib Rauf

2017-01-01

Full Text Available Smart grid for the past few years has been the prime focus of research in power systems. The aim is to eliminate load shedding and problematic blackout conditions, further offering cheap and continuous supply of electricity for both large and small consumers. Another benefit is to integrate renewable energy resources with existing dump grid in more efficient and cost-effective manner. In past few years, growing demand for sustainable energy increases the consumption of solar PV. Since generation from solar PV is in DC and most of the appliances at home could be operated on DC, AC-DC hybrid distribution system with energy management system is proposed in this paper. EMS helps to shift or control the auxiliary load and compel the users to operate specific load at certain time slots. These techniques further help to manage the excessive load during peak and off peak hours. It demonstrates the practical implementation of DC-AC network with integration of solar PV and battery storage with existing infrastructure. The results show a remarkable improvement using hybrid AC-DC framework in terms of reliability and efficiency. All this functioning together enhances the overall efficiency; hence, a secure, economical, reliable, and intelligent system leads to a smart grid.

Large-Scale Battery System Development and User-Specific Driving Behavior Analysis for Emerging Electric-Drive Vehicles

Directory of Open Access Journals (Sweden)

Yihe Sun

2011-04-01

Full Text Available Emerging green-energy transportation, such as hybrid electric vehicles (HEVs and plug-in HEVs (PHEVs, has a great potential for reduction of fuel consumption and greenhouse emissions. The lithium-ion battery system used in these vehicles, however, is bulky, expensive and unreliable, and has been the primary roadblock for transportation electrification. Meanwhile, few studies have considered user-specific driving behavior and its significant impact on (PHEV fuel efficiency, battery system lifetime, and the environment. This paper presents a detailed investigation of battery system modeling and real-world user-specific driving behavior analysis for emerging electric-drive vehicles. The proposed model is fast to compute and accurate for analyzing battery system run-time and long-term cycle life with a focus on temperature dependent battery system capacity fading and variation. The proposed solution is validated against physical measurement using real-world user driving studies, and has been adopted to facilitate battery system design and optimization. Using the collected real-world hybrid vehicle and run-time driving data, we have also conducted detailed analytical studies of users’ specific driving patterns and their impacts on hybrid vehicle electric energy and fuel efficiency. This work provides a solid foundation for future energy control with emerging electric-drive applications.

Driving Issues in Epilepsy: Past, Present, and Future

OpenAIRE

Krumholz, Allan

2009-01-01

Driving restrictions for people with seizure disorders are intended to ensure the public's safety, but driving is of such great importance in the United States that the imposed restrictions also may unduly harm the welfare of these individuals. Because driving restrictions historically have been based more on expert opinion than sound scientific evidence, the appropriateness and application of standards for licensing drivers with seizures continue to raise questions and concerns, as does the ...

Motorcycle emissions and fuel consumption in urban and rural driving conditions.

Science.gov (United States)

Chen, K S; Wang, W C; Chen, H M; Lin, C F; Hsu, H C; Kao, J H; Hu, M T

2003-08-01

This work reports sampling of motorcycle on-road driving cycles in actual urban and rural environments and the development of representative driving cycles using the principle of least total variance in individual regions. Based on the representative driving cycles in individual regions, emission factors for carbon monoxide (CO), hydrocarbons (HC), nitrogen oxides (NO(x)=NO+NO(2)) and carbon dioxide (CO(2)), as well as fuel consumption, were determined using a chassis dynamometer. The measurement results show that the representative driving cycles are almost identical in the three largest cities in Taiwan, but they differ significantly from the rural driving cycle. Irrespective of driving conditions, emission factors differ insignificantly between the urban and rural regions at a 95% confidence level. However, the fuel consumption in urban centers is approximately 30% higher than in the rural regions, with driving conditions in the former usually poor compared to the latter. Two-stroke motorcycles generally have considerably higher HC emissions and quite lower NO(x) emissions than those of four-stroke motorcycles. Comparisons with other studies suggest that factors such as road characteristics, traffic volume, vehicle type, driving conditions and driver behavior may affect motorcycle emission levels in real traffic situations.

Motorcycle emissions and fuel consumption in urban and rural driving conditions

International Nuclear Information System (INIS)

Chen, K.S.; Wang, W.C.; Chen, H.M.; Lin, C.F.; Hsu, H.C.; Kao, J.H.; Hu, M.T.

2003-01-01

This work reports sampling of motorcycle on-road driving cycles in actual urban and rural environments and the development of representative driving cycles using the principle of least total variance in individual regions. Based on the representative driving cycles in individual regions, emission factors for carbon monoxide (CO), hydrocarbons (HC), nitrogen oxides (NO x =NO+NO 2 ) and carbon dioxide (CO 2 ), as well as fuel consumption, were determined using a chassis dynamometer. The measurement results show that the representative driving cycles are almost identical in the three largest cities in Taiwan, but they differ significantly from the rural driving cycle. Irrespective of driving conditions, emission factors differ insignificantly between the urban and rural regions at a 95% confidence level. However, the fuel consumption in urban centers is approximately 30% higher than in the rural regions, with driving conditions in the former usually poor compared to the latter. Two-stroke motorcycles generally have considerably higher HC emissions and quite lower NO x emissions than those of four-stroke motorcycles. Comparisons with other studies suggest that factors such as road characteristics, traffic volume, vehicle type, driving conditions and driver behavior may affect motorcycle emission levels in real traffic situations

ACS labelled with sup(99m)Tc and cartilage scintigraphy

International Nuclear Information System (INIS)

Dupuy, J.C.; Harmand, M.F.; Blanquet, P.

1976-01-01

ACS, chondroitine-sulphate acid, is the principal mucopolysaccharide of cartilagineous substance. We therefore thought it of interest to label this molecule with sup(99m)Tc so as to obtain a scintigraphic image of cartilagineous formations. sup(99m)Tc-pyrophosphate and the sup(99m)Tc-polyphosphates permit simultaneous imaging of hyperactive zones in bone and cartilage. The ACS-labelling technique is based on the reduction of sup(99m)Tc-pertechnetate by the tin-II-ion. Sephadex-gel chromatography at different pH-levels was used to study labelling gain, under optimum conditions it can attain 85%. The labelled product was administered intravenously and studied in rat and rabbit. An identical biological half-life of 15 minutes was found for both species. Scintigraphes from rabbits permitted clear visualization of the epiphyses of tubular bones, intervertebral cartilage, and auricular cartilage. These encouraging results point to interesting clinical applications

DEVELOPMENT OF OPERATING DRIVE SYSTEMS IN ENGINEERING EQUIPMENT

Directory of Open Access Journals (Sweden)

A. A. Kotlobai

2015-01-01

Full Text Available Engineering machines being in operational service with military units of  engineer troops are fit to their purpose and their application is relevant in modern conditions. Maintenance of operating conditions in engineering equipment which was produced earlier by the USSR enterprises is considered as a rather complicated task due to lack of spare parts because their production has been discontinued.One of the approaches used for maintenance of engineering equipment combat capabilities is modernization of operating drive systems that presupposes replacement of mechanical systems in working element drives by hydrostatic drives which are realized while using modern element base. Usage of hydraulic units in drive systems being in mass production for replacement of mechanical systems manufactured earlier in small batches makes it possible to reduce labour inputs for maintenance and repair of machines. The paper presents some possibilities for development of operating drive systems in engineering equipment. The proposed approach is given through an example of  engineering obstacle-clearing vehicle (IMR-2M and excavation machines (MDK-3 and MDK-2M.Application of a hydraulic drive in working elements of the excavation machines permits to withdraw from cardan  shafts, a gear box, a rotary gear and an overload clutch. A hydraulic motor of the cutter and thrower drive is mounted  on a working element gearbox. While executing modernization of hydraulic systems in excavation machines a pump unit has been proposed for the cutter and thrower drive which consists of a controlled pump and a system for automatic maintenance of the pump operational parameters. While developing the operating drive systems in engineering equipment in accordance with the proposed requirements it is possible to simplify drive systems of working elements and  ensure reliable machinery operation in the units of engineer troops. 

Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

DEFF Research Database (Denmark)

Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

2009-01-01

This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

Modular component kit for hybrid drive systems; Modularer Komponentenbaukasten fuer Hybride Antriebssysteme

Energy Technology Data Exchange (ETDEWEB)

Riegger, Peter; Schalk, Johannes; Schmalzing, Claus-Oliver [MTU Friedrichshafen GmbH, Friedrichshafen (Germany). Bereich Forschung Technologieentwicklung

2013-10-15

By hybrid drives, fuel consumption in off-road applications can be significantly reduced. However, the additional power train components and degrees of freedom required in the design of hybridised systems involve an increase in system variants. To keep the number of variants as low as possible whilst simultaneously ensuring that hybrid drives can serve as wide a spectrum of applications as possible, MTU has developed a modular system of components. This makes it possible to use customer requirements as a basis for creating innovative drive systems for the widest range of applications. (orig.)

Characterisation of AC1: a naturally decaffeinated coffee

Directory of Open Access Journals (Sweden)

Luciana Benjamim Benatti

2012-01-01

Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

Multibeam radiation therapy treatment application

International Nuclear Information System (INIS)

Manens, J.P.; Le Gall, G.; Chenal, C.; Ben Hassel, M.; Fresne, F.; Barillot, C.; Gibaud, B.; Lemoine, D.; Bouliou, A.; Scarabin, J.M.

1991-01-01

A software package has been developed for multibeam radiation therapy treatment application. We present in this study a computer-assisted dosimetric planning procedure which includes: i), an analytical stage for setting up the large volume via 2D and 3D displays; ii), a planning stage for issue of a treatment strategy including dosimetric simulations; and iii), a treatment stage to drive the target volume to the radiation unit isocenter. The combined use of stereotactic methods and multimodality imagery ensures spatial coherence and makes target definition and cognition of structure environment more accurate. The dosimetric planning suited to the spatial reference (the stereotactic frame) guarantees optimal distribution of the dose, computed by the original 3D volumetric algorithm. A computer-driven chair-framework cluster was designed to position the target volume at the radiation unit isocenter [fr

A multi-channel AC power supply controller

International Nuclear Information System (INIS)

Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei

2003-01-01

A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system

AC Voltage Control of DC/DC Converters Based on Modular Multilevel Converters in Multi-Terminal High-Voltage Direct Current Transmission Systems

Directory of Open Access Journals (Sweden)

Rui Li

2016-12-01

Full Text Available The AC voltage control of a DC/DC converter based on the modular multilevel converter (MMC is considered under normal operation and during a local DC fault. By actively setting the AC voltage according to the two DC voltages of the DC/DC converter, the modulation index can be near unity, and the DC voltage is effectively utilized to output higher AC voltage. This significantly decreases submodule (SM capacitance and conduction losses of the DC/DC converter, yielding reduced capital cost, volume, and higher efficiency. Additionally, the AC voltage is limited in the controllable range of both the MMCs in the DC/DC converter; thus, over-modulation and uncontrolled currents are actively avoided. The AC voltage control of the DC/DC converter during local DC faults, i.e., standby operation, is also proposed, where only the MMC connected on the faulty cable is blocked, while the other MMC remains operational with zero AC voltage output. Thus, the capacitor voltages can be regulated at the rated value and the decrease of the SM capacitor voltages after the blocking of the DC/DC converter is avoided. Moreover, the fault can still be isolated as quickly as the conventional approach, where both MMCs are blocked and the DC/DC converter is not exposed to the risk of overcurrent. The proposed AC voltage control strategy is assessed in a three-terminal high-voltage direct current (HVDC system incorporating a DC/DC converter, and the simulation results confirm its feasibility.

Bioinformatics and Astrophysics Cluster (BinAc)