Aminoethyl nitrate – the novel super nitrate?
Bauersachs, Johann
2009-01-01
Long-term use of most organic nitrates is limited by development of tolerance, induction of oxidative stress and endothelial dysfunction. In this issue of the BJP, Schuhmacher et al. characterized a novel class of organic nitrates with amino moieties (aminoalkyl nitrates). Aminoethyl nitrate was identified as a novel organic mononitrate with high potency but devoid of induction of mitochondrial oxidative stress. Cross-tolerance to nitroglycerin or the endothelium-dependent agonist acetylcholine after in vivo treatment was not observed. Like all nitrates, aminoethyl nitrate induced vasorelaxation by activation of soluble guanylate cyclase. Thus, in contrast to the prevailing view, high potency in an organic nitrate is not necessarily accompanied by induction of oxidative stress or endothelial dysfunction. This work from Daiber's group is an important step forward in the understanding of nitrate bioactivation, tolerance phenomena and towards the development of better organic nitrates for clinical use. PMID:19732062
The L7Ae protein binds to two kink-turns in the Pyrococcus furiosus RNase P RNA
Lai, Stella M.; Lai, Lien B.; Foster, Mark P.; Gopalan, Venkat
2014-01-01
The RNA-binding protein L7Ae, known for its role in translation (as part of ribosomes) and RNA modification (as part of sn/oRNPs), has also been identified as a subunit of archaeal RNase P, a ribonucleoprotein complex that employs an RNA catalyst for the Mg2+-dependent 5′ maturation of tRNAs. To better understand the assembly and catalysis of archaeal RNase P, we used a site-specific hydroxyl radical-mediated footprinting strategy to pinpoint the binding sites of Pyrococcus furiosus (Pfu) L7Ae on its cognate RNase P RNA (RPR). L7Ae derivatives with single-Cys substitutions at residues in the predicted RNA-binding interface (K42C/C71V, R46C/C71V, V95C/C71V) were modified with an iron complex of EDTA-2-aminoethyl 2-pyridyl disulfide. Upon addition of hydrogen peroxide and ascorbate, these L7Ae-tethered nucleases were expected to cleave the RPR at nucleotides proximal to the EDTA-Fe–modified residues. Indeed, footprinting experiments with an enzyme assembled with the Pfu RPR and five protein cofactors (POP5, RPP21, RPP29, RPP30 and L7Ae–EDTA-Fe) revealed specific RNA cleavages, localizing the binding sites of L7Ae to the RPR's catalytic and specificity domains. These results support the presence of two kink-turns, the structural motifs recognized by L7Ae, in distinct functional domains of the RPR and suggest testable mechanisms by which L7Ae contributes to RNase P catalysis. PMID:25361963
Logistics Reduction: Advanced Clothing System (ACS)
National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...
Figueiredo, Ana R P; Figueiredo, Andrea G P R; Silva, Nuno H C S; Barros-Timmons, Ana; Almeida, Adelaide; Silvestre, Armando J D; Freire, Carmen S R
2015-06-05
Antimicrobial bacterial cellulose/poly(2-aminoethyl methacrylate) (BC/PAEM) nanocomposites were prepared by in situ radical polymerization of 2-aminoethyl methacrylate, using variable amounts of N,N-methylenebis(acrylamide) (MBA) as cross-linker. The obtained nanocomposites were characterized in terms of their structure, morphology, thermal stability, mechanical properties and antibacterial activity. The ensuing composite membranes were significantly more transparent than those of pure BC and showed improved thermal and mechanical properties. The antibacterial activity of the obtained nanocomposites was assessed towards a recombinant bioluminescent Escherichia coli and only the non-crosslinked nanocomposite (BC/PAEM) proved to have antibacterial activity. Copyright © 2015 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Kazarian, Artaches A.; Smith, Jason A.; Hilder, Emily F.; Breadmore, Michael C.; Quirino, Joselito P.; Suttil, James
2010-01-01
This study describes the development of a novel fluorescent tag, O-2-[aminoethyl]fluorescein, for the separation of sugars by capillary electrophoresis with fluorescence detection using an argon ion laser. The tag was synthesised using three consecutive steps namely: esterification, alkylation and hydrolysis, specifically designed to offer a flexible way in which to make an assortment of fluorescent tags from cheap and readily available starting reagents (typically less than $1 per g of fluorescent tag). Via this flexible synthetic pathway, O-2-[aminoethyl]fluorescein was designed and synthesised with a spacer group to lower steric effects between the fluorescein backbone and the reducing end of the carbohydrate which were anticipated to improve the reactivity of the tag. The newly synthesised tag, O-2-[aminoethyl]fluorescein was evaluated against structurally similar commercial fluorescent motifs namely fluorescent 5-aminomethylfluorescein and non-fluorescent 5-aminofluorescein. Kinetic studies indicated that O-2-[aminoethyl]fluorescein showed similar labeling efficiencies as 5-aminomethylfluorescein, but were achieved in only 30 min, supporting the notion of improved reactivity of the spacer group. The sensitivity of O-2-[aminoethyl]fluorescein was evaluated using maltoheptaose with a detection limit of 1 nM obtained, which was slightly higher than that of 0.3 nM obtained with 5-aminomethylfluorescein, and was due to its lower quantum yield (0.24) when conjugated to the sugar. The separation performance of the tag was also benchmarked with the two commercial reagents using a range of corn syrup oligosaccharides, from 4 to 10 glucose units, typically found in rice starch. Separations were performed using an electrolyte containing 100 mM boric acid, tris at pH 8.65 as background electrolyte, 30 kV applied voltage, 50 μm I.D. x 40 cm (30 cm effective length) capillary. The novel tag showed better resolution of small oligosaccharides, G3 and G4, than the other two
Energy Technology Data Exchange (ETDEWEB)
Rafii, Hamid; Chalon, Sylvie; Ombetta, Jean-Edouard; Frangin, Yves; Garreau, Lucette; Dognon, Anne-Marie; Lena, Isabelle; Bodard, Sylvie; Vilar, Marie-Paule; Besnard, Jean-Claude; Guilloteau, Denis
1995-07-01
We described the radiosynthesis of an analog of Ro 16-6491, [{sup 125}I]N-(2-aminoethyl)-4-iodobenzamide, for SPECT exploration of the monoamine oxidase B (MAO-B) in human brain. The radiolabelling was carried out by nucleophilic exchange of the brominated precursor at solid-state phase in presence of ammonium sulphate. The radiochemical purity of radioiodinated product was higher than 95%. In comparison with Ro 16-6491, the in vitro studies showed a good selectivity of stable N-(2-aminoethyl)-4-iodobenzamide for MAO-B but a slightly lower affinity. Biodistribution studies in the rat showed a high and selective uptake of this compound in the pineal gland 1 h after i.v. injection. The cerebral uptake was low, but the coupling of [{sup 125}I]N-(2-aminoethyl)-4-iodobenzamide with a lipophilic radical to enhance the passage through the blood-brain barrier can be envisaged.
Optimization of DIII-D discharges to avoid AE destabilization
Varela, Jacobo; Spong, Donald; Garcia, Luis; Huang, Juan; Murakami, Masanori
2017-10-01
The aim of the study is to analyze the stability of Alfven Eigenmodes (AE) perturbed by energetic particles (EP) during DIII-D operation. We identify the optimal NBI operational regimes that avoid or minimize the negative effects of AE on the device performance. We use the reduced MHD equations to describe the linear evolution of the poloidal flux and the toroidal component of the vorticity in a full 3D system, coupled with equations of density and parallel velocity moments for the energetic particles, including the effect of the acoustic modes. We add the Landau damping and resonant destabilization effects using a closure relation. We perform parametric studies of the MHD and AE stability, taking into account the experimental profiles of the thermal plasma and EP, also using a range of values of the energetic particles β, density and velocity as well the effect of the toroidal couplings. We reproduce the AE activity observed in high poloidal β discharge at the pedestal and reverse shear discharges. This material based on work is supported both by the U.S. Department of Energy, Office of Science, under Contract DE-AC05-00OR22725 with UT-Battelle, LLC. Research sponsored in part by the Ministerio de Economia y Competitividad of Spain under the project.
Khazaie, Yahya; Novo, Luis; van Gaal, Ethlinn; Fassihi, Afshin; Mirahmadi-Zareh, Seyedeh Zohreh; Esfahani, Mohammad Hossein Nasr; van Nostrum, Cornelus F.; Hennink, Wim E.; Dorkoosh, Farid
2014-01-01
Purpose. The aim of this study was to investigate the in vitro gene delivery efficiency of poly[N-(2-aminoethyl)ethylene-imine](PAEEI), a polymer with a linear Polyethyleneimine (LPEI) backbone and with aminoethyl side groups that has two protonatable nitrogen atoms per monomer unit instead of one
2004-01-01
AE 941 [Arthrovas, Neoretna, Psovascar] is shark cartilage extract that inhibits angiogenesis. AE 941 acts by blocking the two main pathways that contribute to the process of angiogenesis, matrix metalloproteases and the vascular endothelial growth factor signalling pathway. When initial development of AE 941 was being conducted, AEterna assigned the various indications different trademarks. Neovastat was used for oncology, Psovascar was used for dermatology, Neoretna was used for ophthalmology and Arthrovas was used for rheumatology. However, it is unclear if these trademarks will be used in the future and AEterna appears to only be using the Neovastat trademark in its current publications regardless of the indication. AEterna Laboratories signed commercialisation agreements with Grupo Ferrer Internacional SA of Spain and Medac GmbH of Germany in February 2001. Under the terms of the agreement, AEterna has granted exclusive commercialisation and distribution rights to AE 941 in oncology to Grupo Ferrer Internacional for the Southern European countries of France, Belgium, Spain, Greece, Portugal and Italy. It also has rights in Central and South America. Medac GmbH will have marketing rights in Germany, the UK, Scandinavia, Switzerland, Austria, Ireland, the Netherlands and Eastern Europe. In October 2002, AEterna Laboratories announced that it had signed an agreement with Australian healthcare products and services company Mayne Group for marketing AE 941 (as Neovastat) in Australia, New Zealand, Canada and Mexico. In March 2003, AEterna Laboratories announced it has signed an agreement with Korean based LG Life Sciences Ltd for marketing AE 941 (as Neovastat) in South Korea. The agreement provides AEterna with upfront and milestone payments, as well as a return on manufacturing and sales of AE 941. AEterna Laboratories had granted Alcon Laboratories an exclusive worldwide licence for AE 941 for ophthalmic products. However, this licence has been terminated. In
International Nuclear Information System (INIS)
Beer, H.-F.; Haeberli, M.; Ametamey, S.; Schubiger, P.A.
1995-01-01
The compound Ro 19-6327, N-(2-aminoethyl)-5-chloropyridine-2-carboxamide, is known to inhibit reversibly and site specifically the enzyme monoamine oxidase B (MAO-B). The 123 I-labelled iodo-analogue N-(2-aminoethyl)-5-iodopyridine-2-carboxamide (Ro 43-0463) was investigated successfully in human volunteers by means of SPET (Single Photon Emission Tomography). We developed therefore the synthesis and radiolabelling of the corresponding fluoro-analogue N-(2-aminoethyl)-5-fluoropyridine-2-carboxamide with 18 F in order to carry out PET (Positron Emission Tomography) investigations of MAO-B related neuropsychiatric diseases. For this purpose two synthetic approaches leading to the electrophilic and the nucleophilic methods of 18 F radiolabelling were undertaken. The nucleophilic approach appeared to be superior when factors such as precursor synthesis, beam time, specific activity and radiochemical purity of the product are considered. (author)
Directory of Open Access Journals (Sweden)
István Molnár
Full Text Available This study evaluates the potential of flow cytometry for chromosome sorting in two wild diploid wheats Aegilops umbellulata and Ae. comosa and their natural allotetraploid hybrids Ae. biuncialis and Ae. geniculata. Flow karyotypes obtained after the analysis of DAPI-stained chromosomes were characterized and content of chromosome peaks was determined. Peaks of chromosome 1U could be discriminated in flow karyotypes of Ae. umbellulata and Ae. biuncialis and the chromosome could be sorted with purities exceeding 95%. The remaining chromosomes formed composite peaks and could be sorted in groups of two to four. Twenty four wheat SSR markers were tested for their position on chromosomes of Ae. umbellulata and Ae. comosa using PCR on DNA amplified from flow-sorted chromosomes and genomic DNA of wheat-Ae. geniculata addition lines, respectively. Six SSR markers were located on particular Aegilops chromosomes using sorted chromosomes, thus confirming the usefulness of this approach for physical mapping. The SSR markers are suitable for marker assisted selection of wheat-Aegilops introgression lines. The results obtained in this work provide new opportunities for dissecting genomes of wild relatives of wheat with the aim to assist in alien gene transfer and discovery of novel genes for wheat improvement.
Perculiarities of the toxicity and radioprotective activity of aminopropyl aminoethyl thiophosphate
International Nuclear Information System (INIS)
Terekhov, A.V.; Besedina, L.N.; Zherebchenko, P.G.; Znamenskij, V.V.; Suslikov, V.I.; Titov, B.A.
1976-01-01
Toxicity and radioprotective activity of aminopropyl aminoethyl thiophosphate (APAETP) has been compared to those of cystaphos. APAETP has been shown to exceed cystaphos slightly by the value of the radioprotective effect but it is inferior to the latter in the duration of the action after intraperitoneal administration. APAETP, used in toxic doses, does not cause spastic reactions in animals. The range of radioprotective effect of APAETP is almost twice as high as that of cystaphos. Both APAETP and cystaphos have a pronounced radioprotective action not only at high (355 R/min) but also at comparatively low (10.7 R/min) dose-rates of γ-radiation
CSIR Research Space (South Africa)
Wellington, Kevin W
2009-01-01
Full Text Available . Results and Discussion The ligands 1a-c (Scheme 1) were prepared by treating benzoic acid with carbonyl diimidazole (CDI)13 in dimethylformamide (DMF), followed by the respective primary amines, histamine, 2- (2-aminoethyl)benzimidazole and 2...-(2-aminoethyl)pyridine. [Histamine had to be released from its dihydrochloride salt by treatment with sodium methoxide, while 2-(2- aminoethyl)benzimidazole was prepared from 1,2-diaminobenzene and β-alanine.16] The synthesis of the biphenyl-derived ligand 2...
Aragonite coating solutions (ACS) based on artificial seawater
Tas, A. Cuneyt
2015-03-01
Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.
International Nuclear Information System (INIS)
Le Van Hong; Tran Chi Thanh; Hoang Minh Giang; Le Dai Dien; Nguyen Nhi Dien; Nguyen Minh Tuan
2015-01-01
On November 25, 2009, in Hanoi, the National Assembly had been approved the resolution about policy for investment of nuclear power project in Ninh Thuan province which include two sites, each site has two units with power around 1000 MWe. For the nuclear power project at Ninh Thuan 1, Vietnam Government signed the Joint-Governmental Agreement with Russian Government for building the nuclear power plant with reactor type VVER. At present time, the Russian Consultant proposed four reactor technologies can be used for Ninh Thuan 1 project, namely: AES-91, AES-92, AES-2006/V491 and AES-2006/V392M. This report presents the main reactor engineering systems of nuclear power plants with VVER-1000/1200. The results from analysis, comparison and assessment between the designs of AES-91, AES-92 and AES-2006 are also presented. The obtained results show that the type AES-2006 is appropriate selection for Vietnam. (author)
Toepassing ICP-AES op het RIKILT
Ruig, de W.G.
1980-01-01
Rapportage over de toepassing van ICP-AES op het RIKILT. Bij ICP-AES worden twee manieren van lichtemissie detectie toegepast nl. simultaan en sequentieel. De voor- en nadelen van ICP-AES t.o.v. AAS worden op een rij gezet.
A Novel Recommendation To AES Limitation
Directory of Open Access Journals (Sweden)
Falguni Patel
2017-07-01
Full Text Available Among all available conventional encryption algorithms the AES Advanced Encryption Standard is the most secured and highly used algorithm. AES algorithm is widely used by variety of applications like Archive and Compression tools File Encryption Encryption File System Disk Partition Encryption Networking Signal Protocol among others. This paper highlights the Brute Force attack and Cryptanalysis attack on AES Algorithm. This paper also discusses about a novel recommendation of a combination model of AES Algorithm and Random-X Cipher.
Zhang, Yubei; Dang, Qifeng; Liu, Chengsheng; Yan, Jingquan; Cha, Dongsu; Liang, Shengnan; Li, Xiaoli; Fan, Bing
2017-09-01
This study aims to develop new antibacterial hydrogel wound dressings composed of poly(aminoethyl) modified chitosan (PAEMCS). FTIR, 1 H NMR, and elemental analysis demonstrated that PAEMCS was successfully synthesized via grafting poly(aminoethyl) groups onto hydroxyl groups on chitin first, and removing acetyl groups from the grafted polymer afterward. XRD and TGA implied its well-defined crystallinity and thermostability. Furthermore, a series of hydrogels were fabricated under the participation of dipotassium hydrogen phosphate (DHP). The gelation tests suggested that the higher concentration of PAEMCS or DHP was beneficial to the formation of hydrogels. The pH values of hydrogels at 37°C were all in the range of 7.12-7.50. The rheological tests indicated that PAEMCS-based hydrogels were of lower DHP addition and higher elasticity than CS-based hydrogels to achieve the same gelation temperature under the same polymer's concentration. Additionally, the swelling, anti-bacteria, and cytotoxicity experiments showed that PAEMCS-based hydrogels possessed excellent hygroscopicity, high antibacterial activity against E. coli, S. aureus, or S. epidermidis, and good cytocompatibility toward L929 cells or HUVECs, respectively. All the results implied that PAEMCS-based hydrogels not only maintained inherent multiple properties of chitosan but also possessed excellent antibacterial activity, and might be promising antibacterial hydrogel dressings used in wound therapy. Copyright © 2017 Elsevier B.V. All rights reserved.
Biclique cryptanalysis of the full AES
DEFF Research Database (Denmark)
Bogdanov, Andrey; Khovratovich, Dmitry; Rechberger, Christian
2011-01-01
Since Rijndael was chosen as the Advanced Encryption Standard (AES), improving upon 7-round attacks on the 128-bit key variant (out of 10 rounds) or upon 8-round attacks on the 192/256-bit key variants (out of 12/14 rounds) has been one of the most difficult challenges in the cryptanalysis of block...... ciphers for more than a decade. In this paper, we present the novel technique of block cipher cryptanalysis with bicliques, which leads to the following results: The first key recovery method for the full AES-128 with computational complexity 2126.1. The first key recovery method for the full AES-192...... with computational complexity 2189.7. The first key recovery method for the full AES-256 with computational complexity 2254.4. Key recovery methods with lower complexity for the reduced-round versions of AES not considered before, including cryptanalysis of 8-round AES-128 with complexity 2124.9. Preimage search...
AE Test of Calcareous Sands with Particle Rushing
Directory of Open Access Journals (Sweden)
Tan Fengyi
2017-08-01
Full Text Available The particle of calcareous sands was forced to crush, then the energy from the crushing was released by the form of sound waves. Therefore the AE technique was used to detect the calcareous sands AE signal when it crushed. by to study the AE characteristics, the mechanics of calcareous sands was studied. Study showed that: (1 there was the AE activities on the low confining pressure condition at the beginnig of test, (2 there was more and more AE activities with the continuing of test until to the end, (3 the calcareous sands’ AE activities was on the whole testing, (4 the calcareous sands’ particle crushing and mutual friction played different roles for its AE activities. Then the AE model based on the calcarous sands’ particle crushing was discussed.
Aragonite coating solutions (ACS) based on artificial seawater
International Nuclear Information System (INIS)
Tas, A. Cuneyt
2015-01-01
Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO 3 , calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca 10 (PO 4 ) 6 (OH) 2 ), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry
Aragonite coating solutions (ACS) based on artificial seawater
Energy Technology Data Exchange (ETDEWEB)
Tas, A. Cuneyt, E-mail: c_tas@hotmail.com
2015-03-01
Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.
AES in deficit on Georgian trade
International Nuclear Information System (INIS)
TREND
2003-01-01
According to Vedomosti journal Russian state energy company RAO JES Rossii paid for Georgian assets acquisition to American company AES only 23 million USD, what is less than a tenth of sum which AES had originally paid for it. Thus total transaction value including debts reached 80 millions USD. But internal documents of American AES confirm that Americans paid 260 millions USD for Georgian assets and they took besides over 60 millions USD of obligations. Russians bought Georgian AES assets through Finnish filial Nordic Oy. Thus they obtained 75 per cent share in Telasi company which operates distributive network in Tbilisi, two blocks of plant in Tbilisi and half share in AES-Transenergy company which exports electric energy from Georgia to Turkey. RAO JES besides got managerial laws on Hramesi company which owns two water plants. Russian company controls one fifth of production and 35 per cent of electric energy sale in Georgia by these assets
15 CFR 758.2 - Automated Export System (AES).
2010-01-01
... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Automated Export System (AES). 758.2... CLEARANCE REQUIREMENTS § 758.2 Automated Export System (AES). The Census Bureau's Foreign Trade Statistics...) electronically using the Automated Export System (AES). In order to use AES, you must apply directly to the...
Effect of ECAP processing on corrosion resistance of AE21 and AE42 magnesium alloys
Minárik, P.; Král, R.; Janeček, M.
2013-09-01
Corrosion properties of AE21 and AE42 magnesium alloys were investigated in the extruded state and after subsequent 8 passes of Equal Channel Angular Pressing (ECAP) via route Bc, by Electrochemical Impedance Spectroscopy (EIS) in 0.1 M NaCl solution. The resulting microstructure was observed by the Transmission Electron Microscope (TEM) and the Scanning Electron Microscope (SEM). Corrosion layer created after 7 days of immersion was observed by (SEM) in order to explain different evolution of the corrosion resistance after ECAP processing in both alloys. It was found that Al-rich Al11RE3 dispersed particles (present in both alloys) strongly influence the corrosion process and enhance the corrosion resistance. Ultra-fine grained structure was found to reduce the corrosion resistance in AE21. On the other hand, the microstructure of AE42 after ECAP and particularly the better distribution of the alloying elements in the matrix enhance the corrosion resistance when compared to the extruded material.
Effect of ECAP processing on corrosion resistance of AE21 and AE42 magnesium alloys
Energy Technology Data Exchange (ETDEWEB)
Minárik, P., E-mail: peter.minarik@mff.cuni.cz [Charles University, Department of Physics of Materials, Prague (Czech Republic); Král, R.; Janeček, M. [Charles University, Department of Physics of Materials, Prague (Czech Republic)
2013-09-15
Corrosion properties of AE21 and AE42 magnesium alloys were investigated in the extruded state and after subsequent 8 passes of Equal Channel Angular Pressing (ECAP) via route Bc, by Electrochemical Impedance Spectroscopy (EIS) in 0.1 M NaCl solution. The resulting microstructure was observed by the Transmission Electron Microscope (TEM) and the Scanning Electron Microscope (SEM). Corrosion layer created after 7 days of immersion was observed by (SEM) in order to explain different evolution of the corrosion resistance after ECAP processing in both alloys. It was found that Al-rich Al11RE3 dispersed particles (present in both alloys) strongly influence the corrosion process and enhance the corrosion resistance. Ultra-fine grained structure was found to reduce the corrosion resistance in AE21. On the other hand, the microstructure of AE42 after ECAP and particularly the better distribution of the alloying elements in the matrix enhance the corrosion resistance when compared to the extruded material.
Effect of ECAP processing on corrosion resistance of AE21 and AE42 magnesium alloys
International Nuclear Information System (INIS)
Minárik, P.; Král, R.; Janeček, M.
2013-01-01
Corrosion properties of AE21 and AE42 magnesium alloys were investigated in the extruded state and after subsequent 8 passes of Equal Channel Angular Pressing (ECAP) via route Bc, by Electrochemical Impedance Spectroscopy (EIS) in 0.1 M NaCl solution. The resulting microstructure was observed by the Transmission Electron Microscope (TEM) and the Scanning Electron Microscope (SEM). Corrosion layer created after 7 days of immersion was observed by (SEM) in order to explain different evolution of the corrosion resistance after ECAP processing in both alloys. It was found that Al-rich Al11RE3 dispersed particles (present in both alloys) strongly influence the corrosion process and enhance the corrosion resistance. Ultra-fine grained structure was found to reduce the corrosion resistance in AE21. On the other hand, the microstructure of AE42 after ECAP and particularly the better distribution of the alloying elements in the matrix enhance the corrosion resistance when compared to the extruded material.
Attacks and countermeasures on AES and ECC
DEFF Research Database (Denmark)
Tange, Henrik; Andersen, Birger
2013-01-01
AES (Advanced Encryption Standard) is widely used in LTE and Wi-Fi communication systems. AES has recently been exposed to new attacks which have questioned the overall security of AES. The newest attack is a so called biclique attack, which is using the fact that the content of the state array...
Canright, David; Osvik, Dag Arne
2009-01-01
We explore ways to reduce the number of bit operations required to implement AES. One way involves optimizing the composite field approach for entire rounds of AES. Another way is integrating the Galois multiplications of MixColumns with the linear transformations of the S-box. Combined with careful optimizations, these reduce the number of bit operations to encrypt one block by 9.0%, compared to earlier work that used the composite field only in the S-box. For decryption, ...
The pH behavior of a 2-aminoethyl dihydrogen phosphate zwitterion studied with NMR-titrations
Myller, A. T.; Karhe, J. J.; Haukka, M.; Pakkanen, T. T.
2013-02-01
In this study a bifunctional 2-aminoethyl dihydrogen phosphate (AEPH2) was 1H and 31P NMR characterized in a pH range of 1-12 in order to determine the zwitterion properties in different pH regions in H2O and D2O solutions. NMR was also used to determine the pH range where AEPH2 exists as a zwitterion. The phosphate group has two deprotonation points, around pH 1 and 6, while the amino group deprotonates at pH 11. The zwitterion form of AEPH2 (NH3+sbnd CHsbnd CHsbnd OPOH) exists as the main ion between pH 1 and 6 in water solutions and also in the solid state.
AE/flaw characterization for nuclear pressure vessels
International Nuclear Information System (INIS)
Hutton, P.H.; Kurtz, R.J.; Pappas, R.A.
1984-01-01
This chapter discusses the use of acoustic emission (AE) detected during continuous monitoring to identify and evaluate growing flaws in pressure vessels. Off-reactor testing and on-reactor testing are considered. Relationships for identifying acoustic emission (AE) from crack growth and using the AE data to estimate flaw severity have been developed experimentally by laboratory testing. The purpose of the off-reactor vessel test is to evaluate AE monitoring/interpretation methodology on a heavy section steel vessel under simulated reactor operating conditions. The purpose of on-reactor testing is to evaluate the capability of a monitor system to function in the reactor environment, calibrate the ability to detect AE signals, and to demonstrate that a meaningful criteria can be established to prevent false alarms. An expanded data base is needed from application testing and methodology standardization
International Nuclear Information System (INIS)
Strong, S.
1999-01-01
Solar Design Associates, Inc. (SDA), of Harvard, Massachusetts, and Solarex Corporation, of Frederick, Maryland, teamed with Advanced Energy Systems (AES) of Wilton, New Hampshire, to pursue a multi-level program under a Photovoltaic Manufacturing Technology (PVMaT) solicitation. This program was targeted at design innovation, standardization, and modularity, with the goal to deliver low-cost AC PV systems to the utility-interactive market. One significant result of this program is that Solarex filed a U.S. patent application on the new module frame and mounting system that was developed with support from PVMaT. Solarex has already started to manufacture this new combination framing and array mounting system, and a number of residential-scale installations are already in place in the field. The major AES accomplishment under this program was the development of a reliable, FCC-compliant AC module inverter fully listed by Underwriters Laboratories (UL). The inverter passed various environmental tests, including those required by UL (the same temperature and humidity cycling tests that PV modules require), and is now in commercial production
Development of AE monitoring system for journal bearing
International Nuclear Information System (INIS)
Yoon, Dong Jin; Kwon, Oh Yang; Chung, Min Hwa
1994-01-01
For the purpose of monitoring of the bearing conditions in rotating machinery, a system for journal bearing diagnosis by AE was developed. Acoustic emission technique is used to detect abnormal conditions in the bearing system. And various data such as AE events, rms voltage level of AE signals, and AE parameters were acquired during experiments with the simulated journal bearing system. Based on the above results and practical application for power plant, algorithms and judgement criteria for diagnosis system was accomplished. Bearing diagnosis system is composed of four parts as follows : sensing part for AE sensor and preamplifier, signal processing part for rms-to-dc converting to measure AE rms voltage, interface part for connecting rms signal to PC using A/D converter, graphic display and software part for display of bearing condition and for managing of diagnosis program.
Dibenedetto, Angela; Roth, Cristina E; Aresta, Michele; Pápai, Imre
2017-01-10
Fe 0 (bpy)(pyea) (2; bpy=2,2'-bipyridine, pyea=2-aminoethyl-pyridine), a 16-electron species, was synthesized by reduction of FeCl 2 (bpy)(pyea) (1) using Na-strips. It is a diamagnetic low-melting solid (m.p. 295 K) stable under N 2 and easily decomposed by radiations even at low temperature. It was fully characterized by elemental analyses and multinuclear NMR. Complex 2 acts as an active hydrogenation catalyst, but has a very short lifetime. In fact, it reacts with H 2 (0.1-1 MPa) at room temperature in toluene and affords in a few minutes a new Fe 0 complex characterized as Fe 0 (bpy)(η 6 -picoline) (3), inactive to hydrogenation. Picoline is derived from the sp 3 -sp 3 C-C bond cleavage of the aminoethyl arm of the pyea ligand. The rapid evolution of the putative intermediate FeH 2 (bpy)(pyea) (4) has not allowed the isolation such Fe-hydrido species. The interaction of H 2 with 2 has been studied by DFT, which has allowed to demonstrate that 3 is lower in energy than 2+H 2 , justifying the fact that the intermediate dihydride was not isolated. Interestingly, 3 was also obtained by reaction of 1 with NaBH 4 or with glycerol-KOH. Complex 2 is one of the rare examples of Fe 0 complex stabilized by a set of only N-donor atoms. The reaction with glycerol confirms the potential role of Fe in catalytic hydrogenation reactions using bio-glycerol as a H-source. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Multiple Lookup Table-Based AES Encryption Algorithm Implementation
Gong, Jin; Liu, Wenyi; Zhang, Huixin
Anew AES (Advanced Encryption Standard) encryption algorithm implementation was proposed in this paper. It is based on five lookup tables, which are generated from S-box(the substitution table in AES). The obvious advantages are reducing the code-size, improving the implementation efficiency, and helping new learners to understand the AES encryption algorithm and GF(28) multiplication which are necessary to correctly implement AES[1]. This method can be applied on processors with word length 32 or above, FPGA and others. And correspondingly we can implement it by VHDL, Verilog, VB and other languages.
Characterization of Aes nuclear foci in colorectal cancer cells
Itatani, Yoshiro; Sonoshita, Masahiro; Kakizaki, Fumihiko; Okawa, Katsuya; Stifani, Stefano; Itoh, Hideaki; Sakai, Yoshiharu; Taketo, M. Mark
2016-01-01
Amino-terminal enhancer of split (Aes) is a member of Groucho/Transducin-like enhancer (TLE) family. Aes is a recently found metastasis suppressor of colorectal cancer (CRC) that inhibits Notch signalling, and forms nuclear foci together with TLE1. Although some Notch-associated proteins are known to form subnuclear bodies, little is known regarding the dynamics or functions of these structures. Here, we show that Aes nuclear foci in CRC observed under an electron microscope are in a rather amorphous structure, lacking surrounding membrane. Investigation of their behaviour during the cell cycle by time-lapse cinematography showed that Aes nuclear foci dissolve during mitosis and reassemble after completion of cytokinesis. We have also found that heat shock cognate 70 (HSC70) is an essential component of Aes foci. Pharmacological inhibition of the HSC70 ATPase activity with VER155008 reduces Aes focus formation. These results provide insight into the understanding of Aes-mediated inhibition of Notch signalling. PMID:26229111
Erwin; Etriwati; Gunanti; Handharyani, Ekowati; Noviana, Deni
2017-06-01
A good skin graft histopathology is followed by formation of hair follicle, sweat gland, sebaceous gland, blood vessel, lightly dense connective tissue, epidermis, and dermis layer. This research aimed to observe histopathology feature and cytokeratin AE1/AE3 expression on cat skin post skin grafting within a different period of time. Nine male Indonesian local cats aged 1-2 years old weighing 3-4 kg were separated into three groups. First surgery created defect wound of 2 cm × 2 cm in size to whole groups. The wounds were left alone for several days, differing in interval between each group, respectively: Group I (for 2 days), Group II (for 4 days), and Group III (for 6 days). The second surgery was done to each group which harvested skin of thoracic area and applied it on recipient wound bed. On day 24 th post skin graft was an examination of histopathology and cytokeratin AE1/AE3 immunohistochemistry. Group I donor skin's epidermis layer had not formed completely whereas epidermis of donor skin of Groups II and III had completely formed. In all group hair follicle, sweat gland, sebaceous gland, and neovascularization were found. The density of connective tissue in Group I was very solid than other groups. Cytokeratin AE1/AE3 expression was found on donor skin's epithelial cell in epidermis and dermis layer with very brown intensity for Group II, brown intensity for Group II, and lightly brown for Group I. Histopathological structure and cytokeratin AE1/AE3 expression post skin graft are better in Groups II and III compared to Group I.
Energy Technology Data Exchange (ETDEWEB)
Bouras, S. [Laboratory of Studies Surfaces and Interfaces of Solids Materials, Department of Physics, Faculty of Science, University of Setif 1, 19000 (Algeria); Ghebouli, B., E-mail: bghebouli@yahoo.fr [Laboratory of Studies Surfaces and Interfaces of Solids Materials, Department of Physics, Faculty of Science, University of Setif 1, 19000 (Algeria); Benkerri, M. [Laboratory of Studies Surfaces and Interfaces of Solids Materials, Department of Physics, Faculty of Science, University of Setif 1, 19000 (Algeria); Ghebouli, M.A., E-mail: med.amineghebouli@yahoo.fr [Microelectronic Laboratory (LMSE), University of Bachir Ibrahimi, Bordj-Bou-Arreridj 34000 (Algeria); Research Unit on Emerging Materials (RUEM), University of Setif 1, 19000 (Algeria); Choutri, H. [Microelectronic Laboratory (LMSE), University of Bachir Ibrahimi, Bordj-Bou-Arreridj 34000 (Algeria); Louail, L.; Chihi, T.; Fatmi, M. [Research Unit on Emerging Materials (RUEM), University of Setif 1, 19000 (Algeria); Bouhemadou, A. [Laboratory for Developing New Materials and Their Characterization, Department of Physics, Faculty of Science, University of Setif 1, 19000 (Algeria); Department of Physics and Astronomy, College of Science, King Saud University, P.O. Box 2455, Riyadh 11451 (Saudi Arabia); Khenata, R.; Khachai, H. [Laboratoire de Physique Quantique et de Modélisation Mathématique, Université de Mascara, 29000 (Algeria)
2015-01-15
The quaternary iridium based hydrides NaAeIrH{sub 6} (Ae = Ca, Ba and Sr) are promising candidates as hydrogen storage materials. We have studied the structural, elastic, electronic, optical and thermodynamic properties of NaAeIrH{sub 6} (Ae = Ca, Ba and Sr) within the generalized gradient approximation, the local density approximation (LDA) and mBj in the frame of density functional perturbation theory. These alloys have a large indirect Γ–X band gap. The thermodynamic functions were computed using the phonon density of states. The origin of the possible transitions from valence band to conduction band was illustrated. By using the complex dielectric function, the optical properties such as absorption, reflectivity, loss function, refractive index and optical conductivity have been obtained. - Graphical abstract: Real and imaginary parts of the dielectric function, the absorption spectrum α(ω), reflectivity R(ω) and energy-loss spectrum L(ω). - Highlights: • NaAeIrH{sub 6} (Ae = Ca, Ba and Sr) alloys have been investigated. • The elastic moduli, energy gaps are predicted. • The optical and thermal properties were studied.
Dynamic AES – Extending the Lifetime?
DEFF Research Database (Denmark)
Tange, Henrik; Andersen, Birger
2014-01-01
proven that AES is vulnerable to side-channelattacks, related sub-key attacks and biclicque attacks. This paper introducesa new dynamic version of AES where the main flow is depending on theTNAF (τ -adic Non-Adjacent Form) value. This new approach can preventside-channel attacks, related sub-key attacks...... and biclique attacks....
AE Recorder Characteristics and Development.
Energy Technology Data Exchange (ETDEWEB)
Partridge, Michael E. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Curtis, Shane Keawe [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); McGrogan, David Paul [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2016-11-01
The Anomalous Environment Recorder (AE Recorder) provides a robust data recording capability for multiple high-shock applications including earth penetrators. The AE Recorder, packaged as a 2.4" di ameter cylinder 3" tall, acquires 12 accelerometer, 2 auxiliary, and 6 discrete signal channels at 250k samples / second. Recording depth is 213 seconds plus 75ms of pre-trigger data. The mechanical, electrical, and firmware are described as well as support electro nics designed for the first use of the recorder.
Radioiodinated N-(2-aminoethyl)-2-chloro-4-iodobenzamide
International Nuclear Information System (INIS)
Ohmomo, Yoshiro; Murakami, Katsuhiko; Tanaka, Chiaki; Hirata, Masahiko; Magata, Yasuhiro; Yokoyama, Akira.
1994-01-01
In developing monoamine oxidase (MAO)-B specific radioligands, N-(2-aminoethyl)-2-chloro-4-[ 125 I]iodobenzamide ([ 125 I]FIBA) was conveniently synthesized from its tributylstannyl precursor by an iododestannylation reaction using sodium [ 125 I]iodide and hydrogen peroxide with high radiochemical yield. The method should be applicable for labeling with 123 I, a suitable radioisotope for in vivo imaging with single photon emission computed tomography (SPECT). In vitro binding studies using mouse brain mitochondrial preparations showed that the specific binding of [ 125 I]FIBA was saturable and of high affinity. Calculated values for K D and B max were 201 nM and 9.5 pmol/mg protein, respectively. The [ 125 I]FIBA binding was effectively prevented by MAO-B specific inhibitors (l-deprenyl, Ro 16-6491, FIBA) or substrate (β-phenethylamine). However, MAO-A specific inhibitor (clorgyline) and substrate (serotonin) had no significant effect. After an intravenous injection into mice, [ 125 I]FIBA showed high brain uptake (1.64% dose/g at 15-30 min post injection) and long retention (1.11% dose/g at 120 min post injection) in the brain. Good brain-to-blood radioactivity ratios of 2.19 and 2.41 at 60 and 120 min after injection, respectively, were obtained. The in vitro binding data and in vivo characteristics suggested that [ 125 I]FIBA is potentially useful as a probe for biological studies including specific labeling of MAO-B in vivo as well as in vitro. Moreover, the 123 I-labeled counterpart, [ 123 I]FIBA, might be valuable for non-invasive imaging and mapping of MAO-B in the living brain with SPECT. (author)
Test and Verification of AES Used for Image Encryption
Zhang, Yong
2018-03-01
In this paper, an image encryption program based on AES in cipher block chaining mode was designed with C language. The encryption/decryption speed and security performance of AES based image cryptosystem were tested and used to compare the proposed cryptosystem with some existing image cryptosystems based on chaos. Simulation results show that AES can apply to image encryption, which refutes the widely accepted point of view that AES is not suitable for image encryption. This paper also suggests taking the speed of AES based image encryption as the speed benchmark of image encryption algorithms. And those image encryption algorithms whose speeds are lower than the benchmark should be discarded in practical communications.
Canright, David; Osvik, Dag Arne
We explore ways to reduce the number of bit operations required to implement AES. One way involves optimizing the composite field approach for entire rounds of AES. Another way is integrating the Galois multiplications of MixColumns with the linear transformations of the S-box. Combined with careful optimizations, these reduce the number of bit operations to encrypt one block by 9.0%, compared to earlier work that used the composite field only in the S-box. For decryption, the improvement is 13.5%. This work may be useful both as a starting point for a bit-sliced software implementation, where reducing operations increases speed, and also for hardware with limited resources.
National Aeronautics and Space Administration — The AES Modular Power Systems (AMPS) project will demonstrate and infuse modular power electronics, batteries, fuel cells, and autonomous control for exploration...
Crack classification in concrete beams using AE parameters
Bahari, N. A. A. S.; Shahidan, S.; Abdullah, S. R.; Ali, N.; Zuki, S. S. Mohd; Ibrahim, M. H. W.; Rahim, M. A.
2017-11-01
The acoustic emission (AE) technique is an effective tool for the evaluation of crack growth. The aim of this study is to evaluate crack classification in reinforced concrete beams using statistical analysis. AE has been applied for the early monitoring of reinforced concrete structures using AE parameters such as average frequency, rise time, amplitude counts and duration. This experimental study focuses on the utilisation of this method in evaluating reinforced concrete beams. Beam specimens measuring 150 mm × 250 mm × 1200 mm were tested using a three-point load flexural test using Universal Testing Machines (UTM) together with an AE monitoring system. The results indicated that RA value can be used to determine the relationship between tensile crack and shear movement in reinforced concrete beams.
Energy efficiency analysis and implementation of AES on an FPGA
Kenney, David
The Advanced Encryption Standard (AES) was developed by Joan Daemen and Vincent Rjimen and endorsed by the National Institute of Standards and Technology in 2001. It was designed to replace the aging Data Encryption Standard (DES) and be useful for a wide range of applications with varying throughput, area, power dissipation and energy consumption requirements. Field Programmable Gate Arrays (FPGAs) are flexible and reconfigurable integrated circuits that are useful for many different applications including the implementation of AES. Though they are highly flexible, FPGAs are often less efficient than Application Specific Integrated Circuits (ASICs); they tend to operate slower, take up more space and dissipate more power. There have been many FPGA AES implementations that focus on obtaining high throughput or low area usage, but very little research done in the area of low power or energy efficient FPGA based AES; in fact, it is rare for estimates on power dissipation to be made at all. This thesis presents a methodology to evaluate the energy efficiency of FPGA based AES designs and proposes a novel FPGA AES implementation which is highly flexible and energy efficient. The proposed methodology is implemented as part of a novel scripting tool, the AES Energy Analyzer, which is able to fully characterize the power dissipation and energy efficiency of FPGA based AES designs. Additionally, this thesis introduces a new FPGA power reduction technique called Opportunistic Combinational Operand Gating (OCOG) which is used in the proposed energy efficient implementation. The AES Energy Analyzer was able to estimate the power dissipation and energy efficiency of the proposed AES design during its most commonly performed operations. It was found that the proposed implementation consumes less energy per operation than any previous FPGA based AES implementations that included power estimations. Finally, the use of Opportunistic Combinational Operand Gating on an AES cipher
22 CFR 120.30 - The Automated Export System (AES).
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false The Automated Export System (AES). 120.30... DEFINITIONS § 120.30 The Automated Export System (AES). The Automated Export System (AES) is the Department of... system for collection of export data for the Department of State. In accordance with this subchapter U.S...
National Aeronautics and Space Administration — This page is the repository for the publications resulting from the AePW. This includes the special sessions at conferences: AIAA ASM 2012, Grapevine TX; AIAA SDM...
Power Consumption and Calculation Requirement Analysis of AES for WSN IoT.
Hung, Chung-Wen; Hsu, Wen-Ting
2018-05-23
Because of the ubiquity of Internet of Things (IoT) devices, the power consumption and security of IoT systems have become very important issues. Advanced Encryption Standard (AES) is a block cipher algorithm is commonly used in IoT devices. In this paper, the power consumption and cryptographic calculation requirement for different payload lengths and AES encryption types are analyzed. These types include software-based AES-CB, hardware-based AES-ECB (Electronic Codebook Mode), and hardware-based AES-CCM (Counter with CBC-MAC Mode). The calculation requirement and power consumption for these AES encryption types are measured on the Texas Instruments LAUNCHXL-CC1310 platform. The experimental results show that the hardware-based AES performs better than the software-based AES in terms of power consumption and calculation cycle requirements. In addition, in terms of AES mode selection, the AES-CCM-MIC64 mode may be a better choice if the IoT device is considering security, encryption calculation requirement, and low power consumption at the same time. However, if the IoT device is pursuing lower power and the payload length is generally less than 16 bytes, then AES-ECB could be considered.
Clinical epidemiology of human AE in Europe.
Vuitton, D A; Demonmerot, F; Knapp, J; Richou, C; Grenouillet, F; Chauchet, A; Vuitton, L; Bresson-Hadni, S; Millon, L
2015-10-30
This review gives a critical update of the situation regarding alveolar echinococcosis (AE) in Europe in humans, based on existing publications and on findings of national and European surveillance systems. All sources point to an increase in human cases of AE in the "historic endemic areas" of Europe, namely Germany, Switzerland, Austria and France and to the emergence of human cases in countries where the disease had never been recognised until the end of the 20th century, especially in central-eastern and Baltic countries. Both increase and emergence could be only due to methodological biases; this point is discussed in the review. One explanation may be given by changes in the animal reservoir of the parasite, Echinococcus multilocularis (increase in the global population of foxes in Europe and its urbanisation, as well as a possible increased involvement of pet animals as definitive infectious hosts). The review also focuses onto 2 more original approaches: (1) how changes in therapeutic attitudes toward malignant and chronic inflammatory diseases may affect the epidemiology of AE in the future in Europe, since a recent survey of such cases in France showed the emergence of AE in patients with immune suppression since the beginning of the 21st century; (2) how setting a network of referral centres in Europe based on common studies on the care management of patients might contribute to a better knowledge of AE epidemiology in the future. Copyright © 2015. Published by Elsevier B.V.
AE characteristic for monitoring of fatigue crack in steel bridge members
Yoon, Dong-Jin; Jung, Juong-Chae; Park, Philip; Lee, Seung-Seok
2000-06-01
Acoustic emission technique was employed for the monitoring of crack activity in both steel bridge members and laboratory specimen. Laboratory experiment was carried out to identify AE characteristics of fatigue cracks for compact tension specimen. The relationship between a stress intensity factor and AE signals activity as well as conventional AE parameter analysis was discussed. A field test was also conducted on a railway bridge, which contain several fatigue cracks. Crack activities were investigated while in service with strain measurement. From the results, in the laboratory tests, the features of three parameters such as the length of crack growth, the AE energy, and the cumulative AE events, showed the almost same trend in their increase as the number of fatigue cycle increased. From the comparisons of peak amplitude and AE energy with stress intensity factor, it was verified that the higher stress intensity factors generated AE signals with higher peak amplitude and a large number of AE counts. In the field test, real crack propagation signals were captured and the crack activity was verified in two cases.
Neuteboom, Leon W; Matsumoto, Kristie O; Christopher, David A
2009-10-01
Phytocystatins are potent inhibitors of cysteine proteases and have been shown to participate in senescence, seed and organ biogenesis, and plant defense. However, phytocystatins are generally poor inhibitors of the cysteine protease, bromelain, of pineapple (Ananas comosus). Here, we demonstrated that pineapple cystatin, AcCYS1, inhibited (>95%) stem and fruit bromelain. AcCYS1 is a unique cystatin in that it contains an extended N-terminal trunk (NTT) of 63 residues rich in alanine and glutamate. A signal peptide preceding the NTT is processed in vitro by microsomal membranes giving rise to a 27-kD species. AcCYS1 mRNA was present in roots and leaves but was most abundant in fruit. Using immunofluorescence and immunoelectron microscopy with an AcCYS1-specific antiserum, AcCYS1 was found in the apoplasm. Immunoblot analysis identified a 27-kD protein in fruit, roots, and leaves and a 15-kD species in mature ripe fruit. Ripe fruit extracts proteolytically removed the NTT of 27-kD AcCYS1 in vitro to produce the 15-kD species. Mass spectrometry analysis was used to map the primary cleavage site immediately after a conserved critical glycine-94. The AE-rich NTT was required to inhibit fruit and stem bromelain (>95%), whereas its removal decreased inhibition to 20% (fruit) and 80% (stem) and increased the dissociation equilibrium constant by 1.8-fold as determined by surface plasmon resonance assays. We propose that proteolytic removal of the NTT results in the decrease of the inhibitory potency of AcCYS1 against fruit bromelain during fruit ripening to increase tissue proteolysis, softening, and degradation.
Atomic-AES: A compact implementation of the AES encryption/decryption core
DEFF Research Database (Denmark)
Banik, Subhadeep; Bogdanov, Andrey; Regazzoni, Francesco
2016-01-01
The implementation of the AES encryption core by Moradi et al. at Eurocrypt 2011 is one of the smallest in terms of gate area. The circuit takes around 2400 gates and operates on an 8 bit datapath. However this is an encryption only core and unable to cater to block cipher modes like CBC and ELm...
Reconfigurable Secure Video Codec Based on DWT and AES Processor
Directory of Open Access Journals (Sweden)
Rached Tourki
2010-01-01
Full Text Available In this paper, we proposed a secure video codec based on the discrete wavelet transformation (DWT and the Advanced Encryption Standard (AES processor. Either, use of video coding with DWT or encryption using AES is well known. However, linking these two designs to achieve secure video coding is leading. The contributions of our work are as follows. First, a new method for image and video compression is proposed. This codec is a synthesis of JPEG and JPEG2000,which is implemented using Huffman coding to the JPEG and DWT to the JPEG2000. Furthermore, an improved motion estimation algorithm is proposed. Second, the encryptiondecryption effects are achieved by the AES processor. AES is aim to encrypt group of LL bands. The prominent feature of this method is an encryption of LL bands by AES-128 (128-bit keys, or AES-192 (192-bit keys, or AES-256 (256-bit keys.Third, we focus on a method that implements partial encryption of LL bands. Our approach provides considerable levels of security (key size, partial encryption, mode encryption, and has very limited adverse impact on the compression efficiency. The proposed codec can provide up to 9 cipher schemes within a reasonable software cost. Latency, correlation, PSNR and compression rate results are analyzed and shown.
Unbelievable security : Matching AES using public key systems
Lenstra, A.K.; Boyd, C.
2001-01-01
The Advanced Encryption Standard (AES) provides three levels of security: 128, 192, and 256 bits. Given a desired level of security for the AES, this paper discusses matching public key sizes for RSA and the ElGamal family of protocols. For the latter both traditional multiplicative groups of finite
Karaağaç, Dursun; Kürkçüoğlu, Güneş Süheyla; Şenyel, Mustafa; Şahin, Onur
2017-05-01
In this study, three new complexes (4aepyH)2[Ni(CN)4] (1), (4aepyH)2[Pd(CN)4] (2) and (4aepyH)2[Pt(CN)4] (3) [4aepy = 4-(2-aminoethyl)pyridine] have been synthesized and characterized by elemental, thermal, vibrational (FT-IR and Raman) and single-crystal X-ray diffraction techniques. The crystallographic analyses reveal that the complexes crystallize in the monoclinic system, space group C2/c. The asymmetric units of the complexes contain one M(II) ion, two cyanide ligands and one non-coordinated the 4aepy ligand. Each M(II) ion is four coordinated with four cyanide-carbon atoms in a square planar geometry and the [M(CN)4]2- anions act as a counter ion. The 4aepyH cations in the complexes compose of the protonation of the 4aepy. The vibrational spectral data also supported to the crystal structures of the complexes. Thermal stabilities and decomposition products of the complexes were investigated in the temperature range 40-700 °C in the static air atmosphere.
The global compendium of Aedes aegypti and Ae. albopictus occurrence
Kraemer, Moritz U. G.; Sinka, Marianne E.; Duda, Kirsten A.; Mylne, Adrian; Shearer, Freya M.; Brady, Oliver J.; Messina, Jane P.; Barker, Christopher M.; Moore, Chester G.; Carvalho, Roberta G.; Coelho, Giovanini E.; van Bortel, Wim; Hendrickx, Guy; Schaffner, Francis; Wint, G. R. William; Elyazar, Iqbal R. F.; Teng, Hwa-Jen; Hay, Simon I.
2015-07-01
Aedes aegypti and Ae. albopictus are the main vectors transmitting dengue and chikungunya viruses. Despite being pathogens of global public health importance, knowledge of their vectors’ global distribution remains patchy and sparse. A global geographic database of known occurrences of Ae. aegypti and Ae. albopictus between 1960 and 2014 was compiled. Herein we present the database, which comprises occurrence data linked to point or polygon locations, derived from peer-reviewed literature and unpublished studies including national entomological surveys and expert networks. We describe all data collection processes, as well as geo-positioning methods, database management and quality-control procedures. This is the first comprehensive global database of Ae. aegypti and Ae. albopictus occurrence, consisting of 19,930 and 22,137 geo-positioned occurrence records respectively. Both datasets can be used for a variety of mapping and spatial analyses of the vectors and, by inference, the diseases they transmit.
AES ALGORITHM IMPLEMENTATION IN PROGRAMMING LANGUAGES
Directory of Open Access Journals (Sweden)
Luminiţa DEFTA
2010-12-01
Full Text Available Information encryption represents the usage of an algorithm to convert an unknown message into an encrypted one. It is used to protect the data against unauthorized access. Protected data can be stored on a media device or can be transmitted through the network. In this paper we describe a concrete implementation of the AES algorithm in the Java programming language (available from Java Development Kit 6 libraries and C (using the OpenSSL library. AES (Advanced Encryption Standard is an asymmetric key encryption algorithm formally adopted by the U.S. government and was elected after a long process of standardization.
15 CFR Appendix D to Part 30 - AES Filing Citation, Exemption and Exclusion Legends
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false AES Filing Citation, Exemption and... Appendix D to Part 30—AES Filing Citation, Exemption and Exclusion Legends I. USML Proof of Filing Citation AES ITN Example: AES X20060101987654. II. AES Proof of Filing Citation subpart A § 30.7 AES ITN...
Czech Academy of Sciences Publication Activity Database
Molnár, I.; Vrána, Jan; Farkas, A.; Kubaláková, Marie; Cseh, A.; Molnár-Láng, M.; Doležel, Jaroslav
2015-01-01
Roč. 116, č. 2 (2015), s. 189-200 ISSN 0305-7364 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Aegilops markgrafii * Ae. triuncialis * Ae. cylindrica Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.982, year: 2015
AE Characteristics affecting the Notch Effect of the Cold Steel SKD11
Energy Technology Data Exchange (ETDEWEB)
Han, Eung Kyo; Kim, Ki Choong; Kwon, Dong Ho; Kim, Jae Yeor [Hanyang University, Seoul (Korea, Republic of)
1986-11-15
Acoustic Emission is not only expected as a non-destructive evaluation technique in practice but also noted as a new powerful means of evaluation of materials. AE occurs with plastic deformation and propagation of crack, and this patterns of occurrence of AE vary with materials. AE which comes from propagation of crack depends oil the shapes and properties of materials. Like this AE has characteristic of material. The present work is an attempt to evaluate characteristics of carbon steel (SM55C) and Die steel(SKD11) by means of dynamic response of AE method
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
AE/VCE Unconfirmed Vernal Pools
Vermont Center for Geographic Information — This dataset is derived from a project by the Vermont Center for Ecostudies(VCE) and Arrowwood Environmental(AE) to map vernal pools throughout the state of Vermont....
Vermont Center for Geographic Information — This dataset is derived from a project by the Vermont Center for Ecostudies(VCE) and Arrowwood Environmental(AE) to map vernal pools throughout the state of Vermont....
Directory of Open Access Journals (Sweden)
Oswaldo Paulo Forattini
2000-10-01
Full Text Available OBJETIVO: Observar e comparar o comportamento das espécies de Aedes albopictus e de Ae. scapularis, na localidade de Pedrinhas, litoral sul do Estado de São Paulo, Brasil. MÉTODOS: As observações foram feitas de outubro de 1996 a janeiro de 2000. Foram realizadas coletas sistemáticas de formas adultas mediante a utilização de isca humana, aspirações ambientais e armadilha tipo Shannon. A domiciliação foi estimada pelo índice de Nuorteva e pela razão de sinantropia. RESULTADOS: Foram feitas 87 coletas diurnas, com a obtenção de 872 adultos fêmeas. As médias de Williams', multiplicadas por 100, foram de 118 e 21 para Ae. albopictus nos horários de 7h às 18h e de 18h às 20h, respectivamente. Quanto a Ae. scapularis, foram de 100 e 106 nos mesmos períodos. Esse último revelou pico de atividade crepuscular vespertina. Na aspiração de abrigos, obteve-se o total de 1.124 espécimens, dos quais 226 Ae. albopictus e 898 Ae. scapularis. O período de janeiro a maio correspondeu ao de maior rendimento para ambos os mosquitos. Quanto à armadilha de Shannon, as coletas realizadas na mata revelaram a ausência de Ae. albopictus. No que concerne à domiciliação, esse último mostrou os maiores valores de índices, enquanto Ae. scapularis revelou comportamento de tipo ubiquista. CONCLUSÕES: Os resultados confirmam outras observações, permitindo levantar hipóteses. Em relação a Ae. scapularis, sugere-se que possa existir fenômeno de diapausa das fêmeas no período verão-outono, a qual cessaria no inverno-primavera quando então a atividade seria retomada. Quanto a Ae. albopictus, os dados sugerem que se trata de população em processo adaptativo ao novo ambiente.OBJECTIVE: Aedes albopictus and Ae. scapularis were found living together in the Pedrinhas Village, Southeastern of São Paulo State, Brazil. This finding was a good opportunity to make observations about the mosquitoes' behavior. METHODS: From October 1996 to
Functionalization of Fe3O4/SiO2 with N-(2-Aminoethyl-3-aminopropyl for Sorption of [AuCl4]-
Directory of Open Access Journals (Sweden)
Nuryono Nuryono
2016-08-01
Full Text Available Synthesis of Fe3O4/SiO2 modified with N-(2-aminoethyl-3-aminopropyl group (Fe3O4/SiO2/ED via coating method and its application for adsorption-desorption of anionic gold in aqueous solution have been conducted. The synthesized product was characterized with an X-ray diffractometer (XRD, a Fourier transform infrared (FT-IR spectrophotometer and a transmission electron microscopy (TEM. Adsorption of Au(III was conducted in a batch system and the variables included pH, contact time, and initial concentration were investigated. Results showed that magnetite/silica has been successfully functionalized with N-(2-aminoethyl-3-aminopropyl in a homogeneous system. Kinetics study showed that adsorption of Au(III followed the pseudo-second order model with rate constant of 0.710 g mmol L-1min-1. Furthermore, the experimental data fitted well with the Langmuir isotherm model with the maximum adsorption capacity for Au(III of 142.9 mg g-1 and the energy of 25.0 kJ mol-1. Gold loaded on the Fe3O4/SiO2/ED could be easily desorbed with 0.2 mol L-1 HCl containing 2 wt.% of thiourea with recovery of 99.8%. Fe3O4/SiO2/ED was reusable and stable in 5 cycles of adsorption-desorption with recovery more than 90%. Fe3O4/SiO2/ED showed high selectivity towards Au(III in the multimetal system Au(III/Cu(II/Cr(VI with the coefficient selectivity for αAu-Cu of 227.5and for αAu-Cr of 12.3.
International Nuclear Information System (INIS)
He, Hua; Tyson, Chauntae; Saito, Maia; Bobev, Svilen
2012-01-01
Ten new ternary phosphides and arsenides with empirical formulae AE 3 Al 2 Pn 4 and AE 3 Ga 2 Pn 4 (AE=Ca, Sr, Ba, Eu; Pn=P, As) have been synthesized using molten Ga, Al, and Pb fluxes. They have been structurally characterized by single-crystal and powder X-ray diffraction to form with two different structures—Ca 3 Al 2 P 4 , Sr 3 Al 2 As 4 , Eu 3 Al 2 P 4 , Eu 3 Al 2 As 4 , Ca 3 Ga 2 P 4 , Sr 3 Ga 2 P 4 , Sr 3 Ga 2 As 4 , and Eu 3 Ga 2 As 4 crystallize with the Ca 3 Al 2 As 4 structure type (space group C2/c, Z=4); Ba 3 Al 2 P 4 and Ba 3 Al 2 As 4 adopt the Na 3 Fe 2 S 4 structure type (space group Pnma, Z=4). The polyanions in both structures are made up of TrPn 4 tetrahedra, which share common corners and edges to form 2 ∞ [TrPn 2 ] 3– layers in the phases with the Ca 3 Al 2 As 4 structure, and 1 ∞ [TrPn 2 ] 3– chains in Ba 3 Al 2 P 4 and Ba 3 Al 2 As 4 with the Na 3 Fe 2 S 4 structure type. The valence electron count for all of these compounds follows the Zintl–Klemm rules. Electronic band structure calculations confirm them to be semiconductors. - Graphical abstract: AE 3 Al 2 Pn 4 and AE 3 Ga 2 Pn 4 (AE=Ca, Sr, Ba, Eu; Pn=P, As) crystallize in two different structures—Ca 3 Al 2 P 4 , Sr 3 Al 2 As 4 , Eu 3 Al 2 P 4 , Eu 3 Al 2 As 4 , Ca 3 Ga 2 P 4 , Sr 3 Ga 2 P 4 , Sr 3 Ga 2 As 4 , and Eu 3 Ga 2 As 4 , are isotypic with the previously reported Ca 3 Al 2 As 4 (space group C2/c (No. 15)), while Ba 3 Al 2 P 4 and Ba 3 Al 2 As 4 adopt a different structure known for Na 3 Fe 2 S 4 (space group Pnma (No. 62). The polyanions in both structures are made up of TrPn 4 tetrahedra, which by sharing common corners and edges, form 2 ∞ [TrPn 2 ] 3– layers in the former and 1 ∞ [TrPn 2 ] 3– chains in Ba 3 Al 2 P 4 and Ba 3 Al 2 As 4 . Highlights: ► AE 3 Ga 2 Pn 4 (AE=Ca, Sr, Ba, Eu; Pn=P, As) are new ternary pnictides. ► Ba 3 Al 2 P 4 and Ba 3 Al 2 As 4 adopt the Na 3 Fe 2 S 4 structure type. ► The Sr- and Ca-compounds crystallize with the Ca 3
Genome-Wide Identification and Expression Analysis of the UGlcAE Gene Family in Tomato
Directory of Open Access Journals (Sweden)
Xing Ding
2018-05-01
Full Text Available The UGlcAE has the capability of interconverting UDP-d-galacturonic acid and UDP-d-glucuronic acid, and UDP-d-galacturonic acid is an activated precursor for the synthesis of pectins in plants. In this study, we identified nine UGlcAE protein-encoding genes in tomato. The nine UGlcAE genes that were distributed on eight chromosomes in tomato, and the corresponding proteins contained one or two trans-membrane domains. The phylogenetic analysis showed that SlUGlcAE genes could be divided into seven groups, designated UGlcAE1 to UGlcAE6, of which the UGlcAE2 were classified into two groups. Expression profile analysis revealed that the SlUGlcAE genes display diverse expression patterns in various tomato tissues. Selective pressure analysis indicated that all of the amino acid sites of SlUGlcAE proteins are undergoing purifying selection. Fifteen stress-, hormone-, and development-related elements were identified in the upstream regions (0.5 kb of these SlUGlcAE genes. Furthermore, we investigated the expression patterns of SlUGlcAE genes in response to three hormones (indole-3-acetic acid (IAA, gibberellin (GA, and salicylic acid (SA. We detected firmness, pectin contents, and expression levels of UGlcAE family genes during the development of tomato fruit. Here, we systematically summarize the general characteristics of the SlUGlcAE genes in tomato, which could provide a basis for further function studies of tomato UGlcAE genes.
Accomplishments: AE characterization program for remote flaw evaluation
International Nuclear Information System (INIS)
Hutton, P.H.; Schwenk, E.B.; Kurtz, R.J.
1978-01-01
The purpose of the program is to develop an experimental/analytical evaluation of the feasibility of detecting and analyzing flaw growth in reactor pressure boundaries by means of continuously monitoring acoustic emission (AE). The investigation is devoted exclusively to ASTM Type A533, Grade B, Class 1 material. The basic approach to interpretive model development is through laboratory testing of 1 to 1 1 / 2 inch (25.4 to 38 mm) thick fracture mechanics specimens in both fatigue and fracture at both room temperature and 550 0 F (288 0 C). Seven parameters are measured for each AE signal and related to fracture mechanics functions. AE data from fracture testing of 6 inch (152 mm) wall pressure vessels are also incorporated in analysis
Energy Technology Data Exchange (ETDEWEB)
Majewski, Peter, E-mail: peter.majewski@unisa.edu.au [School of Advanced Manufacturing and Mechanical Engineering, Mawson Institute, University of South Australia, Adelaide (Australia); Keegan, Alexandra [Microbiology Research, Australian Water Quality Centre, South Australian Water Corporation, Adelaide (Australia)
2012-01-15
This study's focus was on the water-based, one-pot preparation and characterisation of silica particles coated with 3-(2-aminoethyl)aminopropyltrimethoxysilane (Diamo) and the efficiency of the material in removing the pathogens Escherichia coli, Pseudomonas aeruginosa, Mycobacterium immunogenum, Vibrio cholerae, poliovirus, and Cryptosporidium parvum. The water-based processing resulted in Diamo coated silica particles with significantly increased positive surface charge as determined by zeta potential measurements. In addition, X-ray photoelectron spectrometry of pure and Diamo coated silica confirmed the presence of Diamo on the surface of the particles. Thermogravimetric measurements and chemical analysis of the silica indicated a surface concentration of amine groups of about 1 mmol/g{sub silica}. Water treatment tests with the pathogens showed that a dose of about 10 g appeared to be sufficient to remove pathogens from pure water samples which were spiked with pathogen concentrations between about 10{sup 2} and 10{sup 4} cfu/mL.
International Nuclear Information System (INIS)
Majewski, Peter; Keegan, Alexandra
2012-01-01
This study's focus was on the water-based, one-pot preparation and characterisation of silica particles coated with 3-(2-aminoethyl)aminopropyltrimethoxysilane (Diamo) and the efficiency of the material in removing the pathogens Escherichia coli, Pseudomonas aeruginosa, Mycobacterium immunogenum, Vibrio cholerae, poliovirus, and Cryptosporidium parvum. The water-based processing resulted in Diamo coated silica particles with significantly increased positive surface charge as determined by zeta potential measurements. In addition, X-ray photoelectron spectrometry of pure and Diamo coated silica confirmed the presence of Diamo on the surface of the particles. Thermogravimetric measurements and chemical analysis of the silica indicated a surface concentration of amine groups of about 1 mmol/g silica . Water treatment tests with the pathogens showed that a dose of about 10 g appeared to be sufficient to remove pathogens from pure water samples which were spiked with pathogen concentrations between about 10 2 and 10 4 cfu/mL.
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
Neuteboom, Leon W.; Matsumoto, Kristie O.; Christopher, David A.
2009-01-01
Phytocystatins are potent inhibitors of cysteine proteases and have been shown to participate in senescence, seed and organ biogenesis, and plant defense. However, phytocystatins are generally poor inhibitors of the cysteine protease, bromelain, of pineapple (Ananas comosus). Here, we demonstrated that pineapple cystatin, AcCYS1, inhibited (>95%) stem and fruit bromelain. AcCYS1 is a unique cystatin in that it contains an extended N-terminal trunk (NTT) of 63 residues rich in alanine and glutamate. A signal peptide preceding the NTT is processed in vitro by microsomal membranes giving rise to a 27-kD species. AcCYS1 mRNA was present in roots and leaves but was most abundant in fruit. Using immunofluorescence and immunoelectron microscopy with an AcCYS1-specific antiserum, AcCYS1 was found in the apoplasm. Immunoblot analysis identified a 27-kD protein in fruit, roots, and leaves and a 15-kD species in mature ripe fruit. Ripe fruit extracts proteolytically removed the NTT of 27-kD AcCYS1 in vitro to produce the 15-kD species. Mass spectrometry analysis was used to map the primary cleavage site immediately after a conserved critical glycine-94. The AE-rich NTT was required to inhibit fruit and stem bromelain (>95%), whereas its removal decreased inhibition to 20% (fruit) and 80% (stem) and increased the dissociation equilibrium constant by 1.8-fold as determined by surface plasmon resonance assays. We propose that proteolytic removal of the NTT results in the decrease of the inhibitory potency of AcCYS1 against fruit bromelain during fruit ripening to increase tissue proteolysis, softening, and degradation. PMID:19648229
Improving the throughput of the AES algorithm with multicore processors
Barnes, A.; Fernando, R.; Mettananda, K.; Ragel, R. G.
2014-01-01
AES, Advanced Encryption Standard, can be considered the most widely used modern symmetric key encryption standard. To encrypt/decrypt a file using the AES algorithm, the file must undergo a set of complex computational steps. Therefore a software implementation of AES algorithm would be slow and consume large amount of time to complete. The immense increase of both stored and transferred data in the recent years had made this problem even more daunting when the need to encrypt/decrypt such d...
International Nuclear Information System (INIS)
Lazarin, Angelica Machi; Sernaglia, Rosana Lazara
1999-01-01
Silica gel was functionalized with [3-(2-aminoethyl) aminopropyl] trimethoxysilane group (SF-AEATS) and the characterization by chemical analysis (N) and infrared spectroscopy confirmed the functionalization. The capacity of the modified silica to adsorb the complex Ru (III) EDTA from ethanolic solution was studied. The selectivity coefficients of the complex formed on the support obtained was τn), 2,07 x 10 4 L/mol and the average number of ligand bonded by one metal ion on the support (n) was ∼1. (author)
Validation and empirical correction of MODIS AOT and AE over ocean
Directory of Open Access Journals (Sweden)
N. A. J. Schutgens
2013-09-01
Full Text Available We present a validation study of Collection 5 MODIS level 2 Aqua and Terra AOT (aerosol optical thickness and AE (Ångström exponent over ocean by comparison to coastal and island AERONET (AErosol RObotic NETwork sites for the years 2003–2009. We show that MODIS (MODerate-resolution Imaging Spectroradiometer AOT exhibits significant biases due to wind speed and cloudiness of the observed scene, while MODIS AE, although overall unbiased, exhibits less spatial contrast on global scales than the AERONET observations. The same behaviour can be seen when MODIS AOT is compared against Maritime Aerosol Network (MAN data, suggesting that the spatial coverage of our datasets does not preclude global conclusions. Thus, we develop empirical correction formulae for MODIS AOT and AE that significantly improve agreement of MODIS and AERONET observations. We show these correction formulae to be robust. Finally, we study random errors in the corrected MODIS AOT and AE and show that they mainly depend on AOT itself, although small contributions are present due to wind speed and cloud fraction in AOT random errors and due to AE and cloud fraction in AE random errors. Our analysis yields significantly higher random AOT errors than the official MODIS error estimate (0.03 + 0.05 τ, while random AE errors are smaller than might be expected. This new dataset of bias-corrected MODIS AOT and AE over ocean is intended for aerosol model validation and assimilation studies, but also has consequences as a stand-alone observational product. For instance, the corrected dataset suggests that much less fine mode aerosol is transported across the Pacific and Atlantic oceans.
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
Lifescience Database Archive (English)
Full Text Available |Q0VJ74_9BILA Calreticulin OS=Heligmosomoides polygyrus... 36 1.3 tr|A8WXR3|A8WXR3_CAEBR Putative uncharacte...+ +++A AE KK +R+ Sbjct: 248 QAAIDSLQRKRARRSAALAEQRKKLQQRQ 276 >tr|Q0VJ74|Q0VJ74_9BILA Calreticulin OS=Heligmos
Lifescience Database Archive (English)
Full Text Available 5 1e-48 tr|Q01EK1|Q01EK1_OSTTA Cao undefined product (IC) OS=Ostreococcu... 130 7...FVKWKDGAPEEWIDAENVADDLI 584 EY V+WKDG WI AE +A D++ Sbjct: 97 EYLVEWKDGHEPSWIPAEAIAADVV 121 >tr|Q01EK1|Q01EK1_OSTTA Cao undefined
Environmental application of XRF, ICP-AES and INAA on biological matrix
International Nuclear Information System (INIS)
Zararsiz, A.; Dogangun, A.; Tuncel, S.
2004-01-01
Full text: It is very important to determine trace quantities of metals in different matrices with high accuracy since the metals are used as markers for different sources in air pollution studies. In this study, the analytical capabilities of XRF, ICP-AES and INM techniques on a biological matrix namely lichens, which are widely used as bio monitoring organisms for the pollutants mapping in the atmosphere, were tested. Lichen samples were collected in Aegean Region of Turkey where pollution is an important issue. 9 elements were determined by XRF, 14 elements by ICP-AES and 13 elements by INM. Quality assurance was achieved using lichen SRM (IAEA-336) and Orchard leaves SRM (NIST- 1571). Produced data are subjected to statistical tests, like t-test, Q-test in order to determine the accuracy and precision of each technique. A recommendation list of the proper analytical technique is obtained for determination of each specific element considering analytical capabilities of ICP-AES, XRF and INM. As a result we can recommend that the first choice for Cd, Cu, Mg is ICP-AES, for In, K, Rb is INAA, for Br is XRF, if the concentrations are not close to the detection limit of XRF. For V, Cr, AI, Na, Fe ICP-AES and INM are both well, for Pb ICP-AES and XRF are both well, if the concentrations are not close to the detection limit of XRF, for Mn and Ca INM, XRF and ICP-AES are all give similar results for this type of biological matrix
Phylodynamic analysis of the dissemination of HIV-1 CRF01_AE in Vietnam.
Liao, Huanan; Tee, Kok Keng; Hase, Saiki; Uenishi, Rie; Li, Xiao-Jie; Kusagawa, Shigeru; Thang, Pham Hong; Hien, Nguyen Tran; Pybus, Oliver G; Takebe, Yutaka
2009-08-15
To estimate the epidemic history of HIV-1 CRF01_AE in Vietnam and adjacent Guangxi, China, we determined near full-length nucleotide sequences of CRF01_AE from a total of 33 specimens collected in 1997-1998 from different geographic regions and risk populations in Vietnam. Phylogenetic and Bayesian molecular clock analyses were performed to estimate the date of origin of CRF01_AE lineages. Our study reconstructs the timescale of CRF01_AE expansion in Vietnam and neighboring regions and suggests that the series of CRF01_AE epidemics in Vietnam arose by the sequential introduction of founder strains into new locations and risk groups. CRF01_AE appears to have been present among heterosexuals in South-Vietnam for more than a decade prior to its epidemic spread in the early 1990s. In the late 1980s, the virus spread to IDUs in Southern Vietnam and subsequently in the mid-1990s to IDUs further north. Our results indicate the northward dissemination of CRF01_AE during this time.
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
On the polarization of Herbig Ae/Be star radiation
Energy Technology Data Exchange (ETDEWEB)
Petrova, N I; Shevchenko, V S
1987-08-01
Results of multicolor UBVRI polarimetry of 14 Herbig Ae/Be stars including 7 stars for which observations of polarization have been made for the first time are presented. 6 bright Herbig Ae/Be stars (As 441, AS 442, LK H..cap alpha..134, LK H..cap alpha..135, Lk H..cap alpha..169 and V517 Cyg) which belong to star formation region connected with IC 5070 show the polarization from 1 to 4.5. per cent with similar theta (approx. 180 deg) (basically of interstellar nature). The polarimetrical variability of BD+46 deg 3471, BD+65 deg 1637, HD 200775 and Lk H..cap alpha..234 is confirmed. Mechanismes of polarization in Herbig Ae/Be stars in circumstellar formations are discussed.
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
Global Dispersal Pattern of HIV Type 1 Subtype CRF01_AE
Poljak, Mario; Angelis, Konstantinos; Albert, Jan; Mamais, Ioannis; Magiorkinis, Gkikas; Hatzakis, Angelos; Hamouda, Osamah; Stuck, Daniel; Vercauteren, Jurgen; Wensing, Annemarie; Alexiev, Ivailo
2016-01-01
Background. Human immunodeficiency virus type 1 (HIV-1) subtype CRF01_AE originated in Africa and then passed to Thailand, where it established a major epidemic. Despite the global presence of CRF01_AE, little is known about its subsequent dispersal pattern. Methods. We assembled a global data set of 2736 CRF01_AE sequences by pooling sequences from public databases and patient-cohort studies. We estimated viral dispersal patterns, using statistical phylogeographic analysis run over bootstrap...
Implementasi Algoritma Kriptografi Aes Pada Mikrokontroler Atmega32
Seniman
2011-01-01
The purpose of this study is to develop a microcomputer or microcontroller system which has a feature to encrypt data with AES algorithm. The input comes from keystrokes of keyboard and the result of the encryption process is stored in the microcontroller's EEPROM. The system is developed using the C programming languange with WinAVR interface. The research method being used to develop the system are data library collection such as the hardware datasheet, the specification of AES algorithm an...
Lifescience Database Archive (English)
Full Text Available vegicus GN=Muc4 PE=1 SV=2 40 0.010 sp|Q4PEW9|TIM50_USTMA Mitochondrial import inner membrane transl... 34 0.42 sp|Q9Y2K...SLFDIDTSATP 101 Query: 358 TEFKCFTAEGVAKPKQQG 411 + AE A G Sbjct: 102 LASQLIEAEEAASRSDAG 119 >sp|Q9Y2K1|ZBTB
Institute of Scientific and Technical Information of China (English)
Di You-Ying; Kong Yu-Xia; Yang Wei-Wei; Tan Zhi-Cheng
2008-01-01
This paper reports that low-temperature heat capacities of 4-(2-aminoethyl)-phenol(C8H11NO)are measured by a precision automated adiabatic calorimeter over the temperature range from 78 to 400 K.A polynomial equation of heat capacities as a function of the temperature was fitted by the least square method.Based on the fitted polynomial,the smoothed heat capacities and thermodynamic functions of the compound relative to the standard reference temperature 298.15 K were calculated and tabulated at the interval of 5 K.The energy equivalent,gcalor,of the oxygen-bomb The constant-volume energy of combustion of the compound at T=298.15 K was measured by a precision oxygen-bomb combustion and other thermodynamic principles.Finally,the standard molar enthalpy of formation of the compound
Power efficient and high performance VLSI architecture for AES algorithm
Directory of Open Access Journals (Sweden)
K. Kalaiselvi
2015-09-01
Full Text Available Advanced encryption standard (AES algorithm has been widely deployed in cryptographic applications. This work proposes a low power and high throughput implementation of AES algorithm using key expansion approach. We minimize the power consumption and critical path delay using the proposed high performance architecture. It supports both encryption and decryption using 256-bit keys with a throughput of 0.06 Gbps. The VHDL language is utilized for simulating the design and an FPGA chip has been used for the hardware implementations. Experimental results reveal that the proposed AES architectures offer superior performance than the existing VLSI architectures in terms of power, throughput and critical path delay.
Low-area hardware implementations of CLOC, SILC and AES-OTR
DEFF Research Database (Denmark)
Banik, Subhadeep; Bogdanov, Andrey; Minematsu, Kazuhiko
2016-01-01
The most compact implementation of the AES-128 algorithm was the 8-bit serial circuit proposed in the work of Moradi et. al. (Eurocrypt 2011). The circuit has an 8-bit datapath and occupies area equivalent to around 2400 GE. Since many authenticated encryption modes use the AES-128 algorithm...
AE8/AP8 Implementations in AE9/AP9, IRBEM, and SPENVIS
2014-02-18
period applies to orbit generation only; AE8/AP8 utilizes geomagnetic field models from other epochs as specified in the table below.) SHIELDOSE2 model...finite and semi- infinite slab data tables for Bremsstrahlung have been reversed [Heynderickx, private communication, May 2013]. This correction is...Cain, J. C., S. J. Hendricks, R. A. Langel, and W. V. Hudson (1967), A proposed model for the international geomagnetic reference field, 1965, J
Molecular epidemiological study of HIV-1 CRF01_AE transmission in Hong Kong.
Chen, J H K; Wong, K H; Li, P; Chan, K C; Lee, M P; Lam, H Y; Cheng, V C C; Yuen, K Y; Yam, W C
2009-08-15
The objective of this study was to investigate the transmission history of the HIV-1 CRF01_AE epidemics in Hong Kong between 1994 and 2007. A total of 465 HIV-1 CRF01_AE pol sequences were derived from an in-house or a commercial HIV-1 genotyping system. Phylogenies of CRF01_AE sequences were analyzed by the Bayesian coalescent method. CRF01_AE patient population included 363 males (78.1%) and 102 females (21.9%), whereas 65% (314 of 465) were local Chinese. Major transmission routes were heterosexual contact (63%), followed by intravenous drug use (IDU) (19%) and men having sex with men (MSM) (17%). From phylogenetic analysis, local CRF01_AE strains were from multiple origins with 3 separate transmission clusters identified. Cluster 1 consisted mainly of Chinese male IDUs and heterosexuals. Clusters 2 and 3 included mainly local Chinese MSM and non-Chinese Asian IDUs, respectively. Chinese reference isolates available from China (Fujian, Guangxi, or Liaoning) were clonally related to our transmission clusters, demonstrating the epidemiological linkage of CRF01_AE infections between Hong Kong and China. The 3 individual local transmission clusters were estimated to have initiated since late 1980s and late 1990s, causing subsequent epidemics in the early 2000s. This is the first comprehensive molecular epidemiological study of HIV-1 CRF01_AE in Hong Kong. It revealed that MSM contact is becoming a major route of local CRF01_AE transmission in Hong Kong. Epidemiological linkage of CRF01_AE between Hong Kong and China observed in this study indicates the importance of regular molecular epidemiological surveillance for the HIV-1 epidemic in our region.
"Storms of crustal stress" and AE earthquake precursors
Directory of Open Access Journals (Sweden)
G. P. Gregori
2010-02-01
Full Text Available Acoustic emission (AE displays violent paroxysms preceding strong earthquakes, observed within some large area (several hundred kilometres wide around the epicentre. We call them "storms of crustal stress" or, briefly "crustal storms". A few case histories are discussed, all dealing with the Italian peninsula, and with the different behaviour shown by the AE records in the Cephalonia island (Greece, which is characterized by a different tectonic setting.
AE is an effective tool for diagnosing the state of some wide slab of the Earth's crust, and for monitoring its evolution, by means of AE of different frequencies. The same effect ought to be detected being time-delayed, when referring to progressively lower frequencies. This results to be an effective check for validating the physical interpretation.
Unlike a seismic event, which involves a much limited focal volume and therefore affects a restricted area on the Earth's surface, a "crustal storm" typically involves some large slab of lithosphere and crust. In general, it cannot be easily reckoned to any specific seismic event. An earthquake responds to strictly local rheological features of the crust, which are eventually activated, and become crucial, on the occasion of a "crustal storm". A "crustal storm" lasts typically few years, eventually involving several destructive earthquakes that hit at different times, at different sites, within that given lithospheric slab.
Concerning the case histories that are here discussed, the lithospheric slab is identified with the Italian peninsula. During 1996–1997 a "crustal storm" was on, maybe elapsing until 2002 (we lack information for the period 1998–2001. Then, a quiet period occurred from 2002 until 26 May 2008, when a new "crustal storm" started, and by the end of 2009 it is still on. During the 1996–1997 "storm" two strong earthquakes occurred (Potenza and
AES Water Architecture Study Interim Results
Sarguisingh, Miriam J.
2012-01-01
The mission of the Advanced Exploration System (AES) Water Recovery Project (WRP) is to develop advanced water recovery systems in order to enable NASA human exploration missions beyond low earth orbit (LEO). The primary objective of the AES WRP is to develop water recovery technologies critical to near term missions beyond LEO. The secondary objective is to continue to advance mid-readiness level technologies to support future NASA missions. An effort is being undertaken to establish the architecture for the AES Water Recovery System (WRS) that meets both near and long term objectives. The resultant architecture will be used to guide future technical planning, establish a baseline development roadmap for technology infusion, and establish baseline assumptions for integrated ground and on-orbit environmental control and life support systems (ECLSS) definition. This study is being performed in three phases. Phase I of this study established the scope of the study through definition of the mission requirements and constraints, as well as indentifying all possible WRS configurations that meet the mission requirements. Phase II of this study focused on the near term space exploration objectives by establishing an ISS-derived reference schematic for long-duration (>180 day) in-space habitation. Phase III will focus on the long term space exploration objectives, trading the viable WRS configurations identified in Phase I to identify the ideal exploration WRS. The results of Phases I and II are discussed in this paper.
Fast Oblivious AES A Dedicated application of the MiniMac protocol
DEFF Research Database (Denmark)
Zakarias, Rasmus Winther; Damgård, Ivan Bjerre
2015-01-01
We present an actively secure multi-partycomputation of the Advanced Encryption Standard (AES). To the best of our knowledge it is the fastest of its kind to date. We start from an efficient actively secure evaluation of general binary circuits that was implemented by the authors of [DLT14......]. They presented an optimized implementation of the so-called MiniMac protocol [DZ13] that runs in the pre-processing model, and applied this to a binary AES circuit. In this paper we de- scribe how to dedicate the pre-processing to the structure of AES, which improves significantly the throughput and latency...... of previous actively secure implementations. We get a latency of about 6 ms and amortised time about 0.4 ms per AES block, which seems completely adequate for practical applications such as verification of 1-time passwords....
Application of AE to evaluate deterioration of prt and harbor structures
International Nuclear Information System (INIS)
Matsuyama, Kimitoshi; Ishibashi, Akichika; Fujiwara, Tetsuro; Kanemoto, Yasuhiro; Hamada, Shigenori; Ohtsu, Masayasu
1997-01-01
The degree of concrete deterioration is normally evaluated by uniaxial compression tests of core samples taken from existing concrete structures. The uniaxial compression test can give details on concrete strength, elastic modulus and so forth. By using AE(acoustic emission) technique with uniaxial compression tests, we can get more useful information on interior failures of the core sample. The observation of AE activity was conducted during uniaxial compression tests of concrete specimens and samples. The specimens were cast with 5, 10, 15 and 20% air content. The samples were taken from 2 harbor sites in Japan. Generating behavior of AE was studied quantitatively on the basis of rate process theory. Distribution of pores in the concrete could be measured by the porosimeter. The relation between AE activity in the uniaxial compression test of core samples and concrete property is clarified.
Applying transpose matrix on advanced encryption standard (AES) for database content
Manurung, E. B. P.; Sitompul, O. S.; Suherman
2018-03-01
Advanced Encryption Standard (AES) is a specification for the encryption of electronic data established by the U.S. National Institute of Standards and Technology (NIST) and has been adopted by the U.S. government and is now used worldwide. This paper reports the impact of transpose matrix integration to AES. Transpose matrix implementation on AES is aimed at first stage of chypertext modifications for text based database security so that the confidentiality improves. The matrix is also able to increase the avalanche effect of the cryptography algorithm 4% in average.
Magnetic fields of Herbig Ae/Be stars
Directory of Open Access Journals (Sweden)
Hubrig S.
2014-01-01
Full Text Available We report on the status of our spectropolarimetric studies of Herbig Ae/Be stars carried out during the last years. The magnetic field geometries of these stars, investigated with spectropolarimetric time series, can likely be described by centred dipoles with polar magnetic field strengths of several hundred Gauss. A number of Herbig Ae/Be stars with detected magnetic fields have recently been observed with X-shooter in the visible and the near-IR, as well as with the high-resolution near-IR spectrograph CRIRES. These observations are of great importance to understand the relation between the magnetic field topology and the physics of the accretion flow and the accretion disk gas emission.
Damgård, Ivan; Keller, Marcel
We propose several variants of a secure multiparty computation protocol for AES encryption. The best variant requires 2200 + {{400}over{255}} expected elementary operations in expected 70 + {{20}over{255}} rounds to encrypt one 128-bit block with a 128-bit key. We implemented the variants using VIFF, a software framework for implementing secure multiparty computation (MPC). Tests with three players (passive security against at most one corrupted player) in a local network showed that one block can be encrypted in 2 seconds. We also argue that this result could be improved by an optimized implementation.
A high performance hardware implementation image encryption with AES algorithm
Farmani, Ali; Jafari, Mohamad; Miremadi, Seyed Sohrab
2011-06-01
This paper describes implementation of a high-speed encryption algorithm with high throughput for encrypting the image. Therefore, we select a highly secured symmetric key encryption algorithm AES(Advanced Encryption Standard), in order to increase the speed and throughput using pipeline technique in four stages, control unit based on logic gates, optimal design of multiplier blocks in mixcolumn phase and simultaneous production keys and rounds. Such procedure makes AES suitable for fast image encryption. Implementation of a 128-bit AES on FPGA of Altra company has been done and the results are as follow: throughput, 6 Gbps in 471MHz. The time of encrypting in tested image with 32*32 size is 1.15ms.
International Nuclear Information System (INIS)
Bhuiya, Mohammad Wadud; Suryadi, Jimmy; Zhou, Zholi; Brown, Bernard Andrew II
2013-01-01
The crystal structure of A. pernix L7Ae is reported, providing insight into the extreme thermostability of this protein. Archaeal ribosomal protein L7Ae is a multifunctional RNA-binding protein that directs post-transcriptional modification of archaeal RNAs. The L7Ae protein from Aeropyrum pernix (Ap L7Ae), a member of the Crenarchaea, was found to have an extremely high melting temperature (>383 K). The crystal structure of Ap L7Ae has been determined to a resolution of 1.56 Å. The structure of Ap L7Ae was compared with the structures of two homologs: hyperthermophilic Methanocaldococcus jannaschii L7Ae and the mesophilic counterpart mammalian 15.5 kD protein. The primary stabilizing feature in the Ap L7Ae protein appears to be the large number of ion pairs and extensive ion-pair network that connects secondary-structural elements. To our knowledge, Ap L7Ae is among the most thermostable single-domain monomeric proteins presently observed
International Nuclear Information System (INIS)
Aoki, Kenji; Mito, Yoshitada; Minami, Masayuki; Matsui, Hiroya; Niunoya, Sumio
2007-09-01
To understand the size and state of EDZ accurately is one of the key issues in the technological development for geological disposal of High-Level Radioactive Waste. As one of these evaluation technologies, AE which is measured directly and evaluates EDZ is paid to attention inside and outside the country, and the utility is reported for the crystalline rock. However, there are few cases to apply AE in sedimentary soft rocks to EDZ evaluation because of the difficulty to measure a few AE waves with small energy. In this study, the authors made a series of laboratory tests including tri-axial test using the stiff and servo-controlled testing machine in order to clarify the possibility to measure AE waves in Neogene siliceous rocks in Horonobe, Hokkaido, Japan (2005). The authors conducted the high stiffness tri-axial compression tests with AE measurements. And, the authors extracted an effective AE parameter to the evaluation of EDZ in the neogene (2005). The authors evaluated the mechanism of EDZ, which assumed from the result in occurrence of crack in the rock by measurement system and DEM analysis, by using the effective parameter (2006). In the EDZ examination which is planned since the second stage, the authors constructed a concept of the necessary measurement and evaluation system (2007). (author)
Continuous AE monitoring of nuclear plants to detect flaws - status and future
International Nuclear Information System (INIS)
Hutton, P.H.
1986-01-01
This paper gives a brief commentary on the evolution of acoustic emission (AE) technology for continuous monitoring of nuclear reactors and the current status. The technical work described to support the status description has the objective of developing and validating the use of AE to detect, locate, and evaluate growing flaws in reactor pressure boundaries. The future of AE for continuous monitoring is discussed in terms of envisioned applications and further accomplishments required to achieve them. 12 refs.
IUE observations of W UMa systems AE Phoenicis and TY Mensae
International Nuclear Information System (INIS)
Rucinski, S.M.
1984-01-01
SWP spectra of AE Phe and TY Men are presented and discussed. The spectrum of AE Phe is typical in showing strong emission lines which originate in the chromosphere and transition region. On the basis of the strenght of the He II emission line we predict that AE Phe should be a moderately strong X-ray source. The spectrum of TY Men is too weakly exposed for a full discussion. It is pointed out that this star is one of the most important for understanding the activity in W UMa systems. 18 refs., 3 figs., 1 tab. (author)
Analyzing Permutations for AES-like Ciphers: Understanding ShiftRows
DEFF Research Database (Denmark)
Beierle, Christof; Jovanovic, Philipp; Lauridsen, Martin Mehl
2015-01-01
Designing block ciphers and hash functions in a manner that resemble the AES in many aspects has been very popular since Rijndael was adopted as the Advanced Encryption Standard. However, in sharp contrast to the MixColumns operation, the security implications of the way the state is permuted...... by the operation resembling ShiftRows has never been studied in depth. Here, we provide the first structured study of the influence of ShiftRows-like operations, or more generally, word-wise permutations, in AES-like ciphers with respect to diffusion properties and resistance towards differential- and linear...... normal form. Using a mixed-integer linear programming approach, we obtain optimal parameters for a wide range of AES-like ciphers, and show improvements on parameters for Rijndael-192, Rijndael-256, PRIMATEs-80 and Prøst-128. As a separate result, we show for specific cases of the state geometry...
Correlation between Earthquakes and AE Monitoring of Historical Buildings in Seismic Areas
Directory of Open Access Journals (Sweden)
Giuseppe Lacidogna
2015-12-01
Full Text Available In this contribution a new method for evaluating seismic risk in regional areas based on the acoustic emission (AE technique is proposed. Most earthquakes have precursors, i.e., phenomena of changes in the Earth’s physical-chemical properties that take place prior to an earthquake. Acoustic emissions in materials and earthquakes in the Earth’s crust, despite the fact that they take place on very different scales, are very similar phenomena; both are caused by a release of elastic energy from a source located in a medium. For the AE monitoring, two important constructions of Italian cultural heritage are considered: the chapel of the “Sacred Mountain of Varallo” and the “Asinelli Tower” of Bologna. They were monitored during earthquake sequences in their relative areas. By using the Grassberger-Procaccia algorithm, a statistical method of analysis was developed that detects AEs as earthquake precursors or aftershocks. Under certain conditions it was observed that AEs precede earthquakes. These considerations reinforce the idea that the AE monitoring can be considered an effective tool for earthquake risk evaluation.
An Improved Recovery Algorithm for Decayed AES Key Schedule Images
Tsow, Alex
A practical algorithm that recovers AES key schedules from decayed memory images is presented. Halderman et al. [1] established this recovery capability, dubbed the cold-boot attack, as a serious vulnerability for several widespread software-based encryption packages. Our algorithm recovers AES-128 key schedules tens of millions of times faster than the original proof-of-concept release. In practice, it enables reliable recovery of key schedules at 70% decay, well over twice the decay capacity of previous methods. The algorithm is generalized to AES-256 and is empirically shown to recover 256-bit key schedules that have suffered 65% decay. When solutions are unique, the algorithm efficiently validates this property and outputs the solution for memory images decayed up to 60%.
Liu, Zhuanzhuan; Zhou, Tengfei; Lai, Zetian; Zhang, Zhenhong; Jia, Zhirong; Zhou, Guofa; Williams, Tricia; Xu, Jiabao; Gu, Jinbao; Zhou, Xiaohong; Lin, Lifeng; Yan, Guiyun
2017-01-01
In China, the prevention and control of Zika virus disease has been a public health threat since the first imported case was reported in February 2016. To determine the vector competence of potential vector mosquito species, we experimentally infected Aedes aegypti, Ae. albopictus, and Culex quinquefasciatus mosquitoes and determined infection rates, dissemination rates, and transmission rates. We found the highest vector competence for the imported Zika virus in Ae. aegypti mosquitoes, some susceptibility of Ae. albopictus mosquitoes, but no transmission ability for Cx. quinquefasciatus mosquitoes. Considering that, in China, Ae. albopictus mosquitoes are widely distributed but Ae. aegypti mosquito distribution is limited, Ae. albopictus mosquitoes are a potential primary vector for Zika virus and should be targeted in vector control strategies. PMID:28430562
Liu, Zhuanzhuan; Zhou, Tengfei; Lai, Zetian; Zhang, Zhenhong; Jia, Zhirong; Zhou, Guofa; Williams, Tricia; Xu, Jiabao; Gu, Jinbao; Zhou, Xiaohong; Lin, Lifeng; Yan, Guiyun; Chen, Xiao-Guang
2017-07-01
In China, the prevention and control of Zika virus disease has been a public health threat since the first imported case was reported in February 2016. To determine the vector competence of potential vector mosquito species, we experimentally infected Aedes aegypti, Ae. albopictus, and Culex quinquefasciatus mosquitoes and determined infection rates, dissemination rates, and transmission rates. We found the highest vector competence for the imported Zika virus in Ae. aegypti mosquitoes, some susceptibility of Ae. albopictus mosquitoes, but no transmission ability for Cx. quinquefasciatus mosquitoes. Considering that, in China, Ae. albopictus mosquitoes are widely distributed but Ae. aegypti mosquito distribution is limited, Ae. albopictus mosquitoes are a potential primary vector for Zika virus and should be targeted in vector control strategies.
Performance analysis of AES-Blowfish hybrid algorithm for security of patient medical record data
Mahmud H, Amir; Angga W, Bayu; Tommy; Marwan E, Andi; Siregar, Rosyidah
2018-04-01
A file security is one method to protect data confidentiality, integrity and information security. Cryptography is one of techniques used to secure and guarantee data confidentiality by doing conversion to the plaintext (original message) to cipher text (hidden message) with two important processes, they are encrypt and decrypt. Some researchers proposed a hybrid method to improve data security. In this research we proposed hybrid method of AES-blowfish (BF) to secure the patient’s medical report data into the form PDF file that sources from database. Generation method of private and public key uses two ways of approach, those are RSA method f RSA and ECC. We will analyze impact of these two ways of approach for hybrid method at AES-blowfish based on time and Throughput. Based on testing results, BF method is faster than AES and AES-BF hybrid, however AES-BF hybrid is better for throughput compared with AES and BF is higher.
Obsidian provenance studies in archaeology: A comparison between PIXE, ICP-AES and ICP-MS
International Nuclear Information System (INIS)
Bellot-Gurlet, Ludovic; Poupeau, Gerard; Salomon, Joseph; Calligaro, Thomas; Moignard, Brice; Dran, Jean-Claude; Barrat, Jean-Alix; Pichon, Laurent
2005-01-01
Elemental composition fingerprinting by PIXE technique is very attractive for obsidian provenance studies as it may proceed in a non-destructive mode, even if a more complete elemental characterization can be obtained by ICP-MS and/or ICP-AES. Only few studies have compared results obtained by both methods for solid rock samples. In this work, elemental compositions were determined by ICP-MS/-AES for international geochemical standards and by ICP-MS/-AES and PIXE for inter-laboratory reference obsidians. In addition 49 obsidian source samples and artefacts were analysed by both ICP-MS/-AES and PIXE. Instrumental work and measurement quality control performed for obsidian chemical characterization, underline that PIXE and ICP-MS/-AES provide reproducible, accurate and comparable measurements. In some volcanic districts the limited number of elements dosed by PIXE is sufficient for the discrimination of the potential raw sources of obsidians. Therefore, PIXE can be an advantageous substitute to ICP-MS/-AES techniques for provenance studies
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
Jha, Omkant; Yadav, T K; Yadav, R A
2018-01-15
Structural and vibrational studies for the most stable conformer of dopamine {4-(2-Aminoethyl) benzene-1, 2-diol} have been carried out at the DFT/B3LYP/6-311++G** level using the Gaussian 09 software. The IR and Raman spectra have been recorded and analyzed in light of the computed vibrational parameters using the DFT and the PEDs computed with the help of the GAR2PED software. Some of the fundamentals have considerably changed frequencies in going from benzene to dopamine. Except the rocking and wagging modes of the NH 2 group the other four modes are pure group modes. The rocking and wagging modes of the NH 2 group show mixing with the other modes. The two OH stretching vibrations are highly localized modes. The Kekule phenyl ring stretching mode is found to remain almost unchanged. The HOMO-LUMO study suggests the existence of charge transfer within the molecule and the energy gap supports the pharmacological active property of the dopamine molecule. The NBO analysis has been carried out to understand the proper and improper hydrogen bonding. Copyright © 2017. Published by Elsevier B.V.
Genome-Wide Identification and Expression Analysis of the UGlcAE Gene Family in Tomato
Xing Ding; Jinhua Li; Yu Pan; Yue Zhang; Lei Ni; Yaling Wang; Xingguo Zhang
2018-01-01
The UGlcAE has the capability of interconverting UDP-d-galacturonic acid and UDP-d-glucuronic acid, and UDP-d-galacturonic acid is an activated precursor for the synthesis of pectins in plants. In this study, we identified nine UGlcAE protein-encoding genes in tomato. The nine UGlcAE genes that were distributed on eight chromosomes in tomato, and the corresponding proteins contained one or two trans-membrane domains. The phylogenetic analysis showed that SlUGlcAE genes could be divided into s...
Shaft Crack Identification Based on Vibration and AE Signals
Directory of Open Access Journals (Sweden)
Wenxiu Lu
2011-01-01
Full Text Available The shaft crack is one of the main serious malfunctions that often occur in rotating machinery. However, it is difficult to locate the crack and determine the depth of the crack. In this paper, the acoustic emission (AE signal and vibration response are used to diagnose the crack. The wavelet transform is applied to AE signal to decompose into a series of time-domain signals, each of which covers a specific octave frequency band. Then an improved union method based on threshold and cross-correlation method is applied to detect the location of the shaft crack. The finite element method is used to build the model of the cracked rotor, and the crack depth is identified by comparing the vibration response of experiment and simulation. The experimental results show that the AE signal is effective and convenient to locate the shaft crack, and the vibration signal is feasible to determine the depth of shaft crack.
Choosing the governing solutions for FA of AES-2006
International Nuclear Information System (INIS)
Vasilchenko, I.; Dragunov, Y.; Ryzhov, S.; Kobelev, S.; Vyalitsyn, V.; Troyanov, V.
2008-01-01
According to the program approved by the Government of Russia the AES-2006 design intended as a base one for the beginning of realization of the plans on development of the nuclear power engineering of Russia in the near future has been under way now. The most crucial components of the reactor plant are certainly the core and its basic component - FA. In the FA design such factors are concentrated that mainly define safety, profitability, adaptability to manufacture and operation of the fuel and NPP as a whole. As the nearest prototype for AES-2006 the TVS-2M design used at the Balakovo NPP is taken. The report shows on the basis of qualitative and quantitative evaluation that design of TVS-2 and its modifications TVS-2M are in the best compliance with the requirements of the project of the new RP AES-2006. This compliance is confirmed by the operational experience of the basic variant of the design
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
International Nuclear Information System (INIS)
Hutton, P.H.; Kurtz, R.J.; Friesel, M.A.; Pappas, R.A.; Skorpik, J.R.; Dawson, J.F.
1984-10-01
The objective of the program is to develop acoustic emission (AE) methods for continuous monitoring of reactor pressure boundaries to detect and evaluate crack growth. The approach involves three phases: develop relationships to identify crack growth AE signals and to use identified crack growth AE data to estimate flaw severity; evaluate and refine AE/flaw relationships through fatigue testing a heavy section vessel under simulated reactor conditions; and demonstrate continuous AE monitoring on a nuclear power reactor system
Preliminary study of acoustic emission (ae) noise signal identification for crude oil storage tank
International Nuclear Information System (INIS)
Nurul Ain Ahmad Latif; Shukri Mohd
2008-08-01
This preliminary work was carried out to simulate the Acoustic Emission (AE) signal contributed by pitting corrosion, and noise signal from environment during crude oil storage tanks monitoring. The purpose of this study is to prove that acoustic emission (AE) could be used to detect the formation of pitting corrosion in the crude oil storage tank and differentiated it from other sources of noise signal. In this study, the pitting corrosion was simulated by inducing low voltage and low amperage current onto the crude oil storage tank material (ASTM 516 G 70). Water drop, air blow and surface rubbing were applied onto the specimen surface. To simulate the noise signal produce by rain fall, wind blow and other sources of noise during AE crude oil storage tanks monitoring. AE sensor was attached onto the other surface of specimen to acquire all of these AE signals which then has send to AE DiSP 24 data acquisition system for signal conditioning. AE win software has been used to analyse this entire signal. It is found that, simulated pitting corrosion could be detected by AE system and differentiated from other sources of noise by using amplitude analysis. From the amplitude analysis is shown that 20-30 dB is the range amplitude for the blow test, 50-60 dB for surface rubbing test and over than 60 dB for water drop test. (Author)
XPS, AES and laser raman spectroscopy: A fingerprint for a materials surface characterisation
International Nuclear Information System (INIS)
Zaidi Embong
2011-01-01
This review briefly describes some of the techniques available for analysing surfaces and illustrates their usefulness with a few examples such as a metal and alloy. In particular, Auger electron spectroscopy (AES), X-ray photoelectron spectroscopy (XPS) and laser Raman spectroscopy are all described as advanced surface analytical techniques. In analysing a surface, AES and XPS would normally be considered first, with AES being applied where high spatial resolution is required and XPS where chemical state information is needed. Laser Raman spectroscopy is useful for determining molecular bonding. A combination of XPS, AES and Laser Raman spectroscopy can give quantitative analysis from the top few atomic layers with a lateral spatial resolution of < 10 nm. (author)
Directory of Open Access Journals (Sweden)
Ma Yufeng
2017-12-01
Full Text Available Eucalyptus fibers were modified with N-β(aminoethyl-γ-aminopropyl trimethoxy silane to research the fiber surface’s changes and the influence of the treatment on the mechanical properties, flame resistance, thermal conductivity and microstructure of eucalyptus fiber composite phenolic foams (EFCPFs. The results showed that the partial of hemicelluloses, waxes, lignin and impurities from the fiber surface were dissolved and removed. Compared with untreated EFCPFs, the mechanical properties of treated EFCPFs were increased dramatically; The size of cells was smaller and the distribution was more uniform; The thermal conductivities were basically reduced; Especially the ratio of mass loss decreased obviously. However limited oxygen indexs (LOIs reduced. And the mechanical properties and LOIs of EFCPFs were basically decreased with the increase of eucalyptus fibers. By comprehensive analysis, the results showed that the interfacial compatibility has been significantly improved between eucalyptus fibers and phenolic resin. And the suitable dosage of eucalyptus fibers was about 5%.
Seniya, Chandrabhan; Yadav, Ajay; Uchadia, Kuldeep; Kumar, Sanjay; Sagar, Nitin; Shrivastava, Priyanka; Shrivastava, Shilpi; Wadhwa, Gulshan
2012-01-01
The study of Human immunodeficiency virus (HIV) in humans and animal models in last 31 years suggested that it is a causative agent of AIDS. This causes serious pandemic public health concern globally. It was reported that the HIV-1 reverse transcriptase (RT) played a critical role in the life cycle of HIV. Therefore, inhibition of HIV-1RT enzyme is one of the major and potential targets in the treatment of AIDS. The enzyme (HIV-1RT) was successfully targeted by non nucleotide reverse transcriptase inhibitors (NNRTIs). But frequent application of NNRTIs led drug resistance mutation on HIV infections. Therefore, there is a need to search new NNRTIs with appropriate pharmacophores. For the purpose, a virtually screened 3D model of unliganded HIV-1RT (1DLO) was explored. The unliganded HIV-1RT (1DLO) was docked with 4-thiazolidinone and its derivatives (ChemBank Database) by using AutoDock4. The best seven docking solutions complex were selected and analyzed by Ligplot. The analysis showed that derivative (5E)-3-(2- aminoethyl)-5-(2- thienylmethylene)-1, 3-thiazolidine-2, 4-dione (CID 3087795) has maximum potential against unliganded HIV-1RT (1DLO). The analysis was done on the basis of scoring and binding ability. The derivative (5E)-3-(2- aminoethyl)-5-(2- thienylmethylene)-1, 3-thiazolidine-2, 4-dione (CID 3087795) indicated minimum energy score and highest number of interactions with active site residue and could be a promising inhibitor for HIV-1 RT as Drug target.
Enhanced ATM Security using Biometric Authentication and Wavelet Based AES
Directory of Open Access Journals (Sweden)
Sreedharan Ajish
2016-01-01
Full Text Available The traditional ATM terminal customer recognition systems rely only on bank cards, passwords and such identity verification methods are not perfect and functions are too single. Biometrics-based authentication offers several advantages over other authentication methods, there has been a significant surge in the use of biometrics for user authentication in recent years. This paper presents a highly secured ATM banking system using biometric authentication and wavelet based Advanced Encryption Standard (AES algorithm. Two levels of security are provided in this proposed design. Firstly we consider the security level at the client side by providing biometric authentication scheme along with a password of 4-digit long. Biometric authentication is achieved by considering the fingerprint image of the client. Secondly we ensure a secured communication link between the client machine to the bank server using an optimized energy efficient and wavelet based AES processor. The fingerprint image is the data for encryption process and 4-digit long password is the symmetric key for the encryption process. The performance of ATM machine depends on ultra-high-speed encryption, very low power consumption, and algorithmic integrity. To get a low power consuming and ultra-high speed encryption at the ATM machine, an optimized and wavelet based AES algorithm is proposed. In this system biometric and cryptography techniques are used together for personal identity authentication to improve the security level. The design of the wavelet based AES processor is simulated and the design of the energy efficient AES processor is simulated in Quartus-II software. Simulation results ensure its proper functionality. A comparison among other research works proves its superiority.
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
International Nuclear Information System (INIS)
Gonzalez, A.; Gurbindo, J.
1987-01-01
During the last few years, the methods used by EMPRESARIOS AGRUPADOS and INITEC to perform Architect-Engineering work in Spain for nuclear projects has undergone a process of significant change in project management and engineering approaches. Specific practical examples of management techniques and design practices which represent a good record of results will be discussed. They are identified as areas of special interest in developing A/E capabilities for nuclear projects . Command of these areas should produce major payoffs in local participation and contribute to achieving real nuclear engineering capabities in the country. (author)
Bis[2-(2-aminoethyl-1H-benzimidazole-κ2N2,N3](nitrato-κ2O,O′cobalt(II chloride trihydrate
Directory of Open Access Journals (Sweden)
Jing Zhao
2012-06-01
Full Text Available In the title compound, [Co(NO3(C9H11N32]Cl·3H2O, the CoII atom is coordinated by four N atoms from two chelating 2-(2-aminoethyl-1H-benzimidazole ligands and two O atoms from one nitrate anion in a distorted octahedral coordination environment. In the crystal, N—H...Cl, N—H...O, O—H...Cl and O—H...O hydrogen bonds link the complex cations, chloride anions and solvent water molecules into a three-dimensional network. π–π interactions between the imidazole and benzene rings and between the benzene rings are observed [centroid–centroid distances = 3.903 (3, 3.720 (3, 3.774 (3 and 3.926 (3 Å].
AE/flaw characterization for nuclear pressure vessels
International Nuclear Information System (INIS)
Hutton, P.H.; Kurtz, R.J.; Pappas, R.A.
1983-10-01
Significant progress has been shown toward resolving major problems in continuous AE monitoring to detect cracking in reactor pressure boundries. Application is considered an attainable goal. Major needs are an expanded data base from application testiong and methodology standardization
Reduction of FR900525 using an S-(2-aminoethyl) l-cysteine-resistant mutant.
Shimizu, Shiho; Futase, Ayako; Yokoyama, Tatsuya; Ueda, Satoshi; Honda, Hiroyuki
2017-06-01
FK506 (tacrolimus), a macrolide compound with immunosuppressant activity, has been proven to have clinical importance and has been manufactured industrially since 1993 by using mutants with high FK506-production ability; these mutants have been developed from the wild strain Streptomyces tsukubaensis No. 9993. FR900525 is one of the by-products of FK506 production. However, there was no effective industrial method to separate FR900525 from FK506 due to the structural similarity between the two compounds. Therefore, reducing the level of FR900525 was a serious problem in the industrial strain A. In this study, we aimed to reduce the FR900525 production. We first determined that pipecolic acid level was a critical parameter for controlling FR900525 production in strain A. S-(2-Aminoethyl) l-cysteine (AEC)-resistant mutants has been reported to increase lysine productivity successfully in a variety of lysine-producing microorganisms. Therefore, next, we applied a selection of AEC-resistant mutants to enhance pipecolic acid biosynthesis. Finally, four AEC-resistant mutants were obtained from strain A using ultraviolet irradiation, and three of them showed less FR900525 productivity compared to the parental strain A. Our findings indicated that AEC resistance was effective phenotype marker for increasing pipecolic acid productivity and for reducing FR900525 production in S. tsukubaensis. Thus, our study provides an efficient method for reducing FR90025 level during FK506 biosynthesis. Copyright © 2017 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
The excess infrared emission of Herbig Ae/Be stars - Disks or envelopes?
Hartmann, Lee; Kenyon, Scott J.; Calvet, Nuria
1993-01-01
It is suggested that the near-IR emission in many Herbig Ae/Be stars arises in surrounding dusty envelopes, rather than circumstellar disks. It is shown that disks around Ae/Be stars are likely to remain optically thick at the required accretion rates. It is proposed that the IR excesses of many Ae/Be stars originate in surrounding dust nebulae instead of circumstellar disks. It is suggested that the near-IR emission of the envelope is enhanced by the same processes that produce anomalous strong continuum emission at temperatures of about 1000 K in reflection nebulae surrounding hot stars. This near-IR emission could be due to small grains transiently heated by UV photons. The dust envelopes could be associated with the primary star or a nearby companion star. Some Ae/Be stars show evidence for the 3.3-6.3-micron emission features seen in reflection nebulae around hot stars, which lends further support to this suggestion.
Security of the AES with a Secret S-Box
DEFF Research Database (Denmark)
Tiessen, Tyge; Knudsen, Lars Ramkilde; Kölbl, Stefan
2015-01-01
How does the security of the AES change when the S-box is replaced by a secret S-box, about which the adversary has no knowledge? Would it be safe to reduce the number of encryption rounds? In this paper, we demonstrate attacks based on integral cryptanalysis which allow to recover both the secret...... key and the secret S-box for respectively four, five, and six rounds of the AES. Despite the significantly larger amount of secret information which an adversary needs to recover, the attacks are very efficient with time/data complexities of 217/216, 238/240 and 290/264, respectively. Another...
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
A Study on AE Signal Analysis of Composite Materials Using Matrix Piezo Electric Sensor
International Nuclear Information System (INIS)
Yu, Yeun Ho; Choi, Jin Ho; Kweon, Jin Hwe
2007-01-01
As fiber reinforced composite materials are widely used in aircraft, space structures and robot arms, the study on non-destructive testing methods has become an important research area for improving their reliability and safety. AE (acoustic emission) can evaluate the defects by detecting the emitting strain energy when elastic waves are generated by the initiation and growth of crack, plastic deformation, fiber breakage, matrix cleavage, or delamination. In the paper, AE signals generated under uniaxial tension were measured and analyzed using the 8x8 matrix piezo electric sensor. The electronic circuit to control the transmitting distance of AE signals was designed and constructed. The optical data storage system was also designed to store the AE signal of 64 channels using LED (light emitting diode) elements. From the tests, it was shown that the source location and propagation path of AE signals in composite materials could be detected effectively by the 8x8 matrix piezo electric sensor
Reconfigurable Secure Video Codec Based on DWT and AES Processor
Rached Tourki; M. Machhout; B. Bouallegue; M. Atri; M. Zeghid; D. Dia
2010-01-01
In this paper, we proposed a secure video codec based on the discrete wavelet transformation (DWT) and the Advanced Encryption Standard (AES) processor. Either, use of video coding with DWT or encryption using AES is well known. However, linking these two designs to achieve secure video coding is leading. The contributions of our work are as follows. First, a new method for image and video compression is proposed. This codec is a synthesis of JPEG and JPEG2000,which is implemented using Huffm...
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
A statistical spectropolarimetric study of Herbig Ae/Be stars
Ababakr, K. M.; Oudmaijer, R. D.; Vink, J. S.
2017-11-01
We present H α linear spectropolarimetry of a large sample of Herbig Ae/Be stars. Together with newly obtained data for 17 objects, the sample contains 56 objects, the largest such sample to date. A change in linear polarization across the H α line is detected in 42 (75 per cent) objects, which confirms the previous finding that the circumstellar environment around these stars on small spatial scales has an asymmetric structure, which is typically identified with a disc. A second outcome of this research is that we confirm that Herbig Ae stars are similar to T Tauri stars in displaying a line polarization effect, while depolarization is more common among Herbig Be stars. This finding had been suggested previously to indicate that Herbig Ae stars form in the same manner than T Tauri stars through magnetospheric accretion. It appears that the transition between these two differing polarization line effects occurs around the B7-B8 spectral type. This would in turn not only suggest that Herbig Ae stars accrete in a similar fashion as lower mass stars, but also that this accretion mechanism switches to a different type of accretion for Herbig Be stars. We report that the magnitude of the line effect caused by electron scattering close to the stars does not exceed 2 per cent. Only a very weak correlation is found between the magnitude of the line effect and the spectral type or the strength of the H α line. This indicates that the detection of a line effect only relies on the geometry of the line-forming region and the geometry of the scattering electrons.
Continuous A.E. monitoring of nuclear systems: some feasibility studies now in-progress in France
International Nuclear Information System (INIS)
Roget, J.; Germain, J.L.
1986-01-01
Continuous A.E. monitoring of Nuclear systems can give some unique information about abnormal behaviour (leak appearance...) or crack initiation or propagation. Some feasibility studies have been undertaken in France in this field and this paper presents the results we have got in two cases. The study showed that an A.E. surveillance of pressurized safety valves indicates the appearance or the presence of a leak. Functioning noise is not a problem in this case. Secondly a large study have been undertaken to test the resistance of the pipe inner sleeve to thermal fatigue. An A.E. monitoring showed that it is possible to separate A.E. due to Crack extension from other signals by a location method in spite of high noise level. A.E. seems applicable for continuous monitoring. So, complementary tests are in progress to confirm and improve these results
Royer, A; Beguin, S; Sochor, H; Communal, P Y
2000-11-01
An analytical method for the determination of glufosinate ammonium and its principal metabolites, AE F064619 and AE F061517, in water of two different hardnesses (5 and 30 DH, French hardness) has been developed and validated. Samples were spiked at different levels (0. 05 and 0.5 microgram/L) and were purified by column chromatography on ion-exchange resins. After derivatization with glacial acetic acid and trimethylarthoacetate mixture, the derivatives were quantified by using capillary gas chromatography with an ion-trap tandem mass spectrometric detector. Analytical conditions for MS/MS detection were optimized, and the quantification was carried out on the areas of the most representative ions. The limit of quantification was validated at 0.05 microgram/L for each compound. The mean recovery value and the relative standard deviation (n = 20) were 92.0% and 17. 8% for glufosinate ammonium, 90.2% and 15.8% for AE F064619, and 89. 7% and 12.7% for AE F061517.
Directory of Open Access Journals (Sweden)
Lawrence J Tartaglia
2016-02-01
Full Text Available Simian-human immunodeficiency virus (SHIV challenge stocks are critical for preclinical testing of vaccines, antibodies, and other interventions aimed to prevent HIV-1. A major unmet need for the field has been the lack of a SHIV challenge stock expressing circulating recombinant form 01_AE (CRF01_AE env sequences. We therefore sought to develop mucosally transmissible SHIV challenge stocks containing HIV-1 CRF01_AE env derived from acutely HIV-1 infected individuals from Thailand. SHIV-AE6, SHIV-AE6RM, and SHIV-AE16 contained env sequences that were >99% identical to the original HIV-1 isolate and did not require in vivo passaging. These viruses exhibited CCR5 tropism and displayed a tier 2 neutralization phenotype. These challenge stocks efficiently infected rhesus monkeys by the intrarectal route, replicated to high levels during acute infection, and established chronic viremia in a subset of animals. SHIV-AE16 was titrated for use in single, high dose as well as repetitive, low dose intrarectal challenge studies. These SHIV challenge stocks should facilitate the preclinical evaluation of vaccines, monoclonal antibodies, and other interventions targeted at preventing HIV-1 CRF01_AE infection.
Dosimetry of 64Cu-DOTA-AE105, a PET tracer for uPAR imaging
DEFF Research Database (Denmark)
Persson, Morten; El Ali, Henrik H.; Binderup, Tina
2014-01-01
64Cu-DOTA-AE105 is a novel positron emission tomography (PET) tracer specific to the human urokinase-type plasminogen activator receptor (uPAR). In preparation of using this tracer in humans, as a new promising method to distinguish between indolent and aggressive cancers, we have performed PET...... studies in mice to evaluate the in vivo biodistribution and estimate human dosimetry of 64Cu-DOTA-AE105. MethodsFive mice received iv tail injection of 64Cu-DOTA-AE105 and were PET/CT scanned 1, 4.5 and 22h post injection. Volume-of-interest (VOI) were manually drawn on the following organs: heart, lung......Favorable dosimetry estimates together with previously reported uPAR PET data fully support human testing of 64Cu-DOTA-AE105....
Energy Technology Data Exchange (ETDEWEB)
Nagano, K; Yamashita, T [Muroran Institute of Technology, Hokkaido (Japan)
1997-05-27
In order to evaluate dynamic behavior of underground cracks, analysis and detection were attempted on multiple acoustic emission (AE) events. The multiple AE is a phenomenon in which multiple AE signals generated by underground cracks developed in an extremely short time interval are superimposed, and observed as one AE event. The multiple AE signal consists of two AE signals, whereas the second P-wave is supposed to have been inputted before the first S-wave is inputted. The first P-wave is inputted first, where linear three-dimensional particle movements are observed, but the movements are made random due to scattering and sensor characteristics. When the second P-wave is inputted, the linear particle movements are observed again, but are superimposed with the existing input signals and become multiple AE, which creates poor S/N ratio. The multiple AE detection determines it a multiple AE event when three conditions are met, i. e. a condition of equivalent time interval of a maximum value in a scalogram analysis, a condition of P-wave vibrating direction, and a condition of the linear particle movement. Seventy AE signals observed in the Kakkonda geothermal field were analyzed and AE signals that satisfy the multiple AE were detected. However, further development is required on an analysis method with high resolution for the time. 4 refs., 4 figs.
Forensic discrimination of aluminum foil by SR-XRF and ICP-AES
International Nuclear Information System (INIS)
Kasamatsu, Masaaki; Suzuki, Yasuhiro; Suzuki, Shinichi; Miyamoto, Naoki; Watanabe, Seiya; Shimoda, Osamu; Takatsu, Masahisa; Nakanishi, Toshio
2010-01-01
The application of synchrotron radiation X-ray fluorescence spectrometry (SR-XRF) was investigated for the forensic discrimination of aluminum foil by comparisons of the elemental components. Small fragments (1 x 1 mm) were taken from 4 kinds of aluminum foils produced by different manufactures and used for measurements of the XRF spectrum at BL37XU of SPring-8. A comparison of the XRF spectra was effective for the discrimination of aluminum foils from different sources, because significant differences were observed in the X-ray peak intensities of Fe, Cu, Zn, Ga, Zr and Sn. These elements, except for Zr and Sn in the aluminum foils and NIST SRM1258 (Aluminium Alloy 6011), were also determined by inductively coupled plasma atomic emission spectrometry (ICP-AES). The observed values of Fe, Cu, Zn and Ga in NIST standard samples by ICP-AES showed satisfactorily good agreements with the certified or information values with relative standard deviations from 1.1% for Zn to 6.7% for Ga. The observed values for the aluminum foils by ICP-AES were compared with those by SR-XRF. Correlation coefficients from 0.997 for Cu/Fe to 0.999 for Zn/Fe and Ga/Fe were obtained between the ratio of the elemental concentration by ICP-AES and normalized the X-ray intensity by SR-XRF. This result demonstrates that a comparison of the normalized X-ray intensity is nearly as effective for the discrimination of aluminum foils as quantitative analysis by ICP-AES. Comparisons of the analytical results by SR-XRF allow the discrimination of all aluminum foils using only a 1 mm 2 fragment with no destruction of the samples. (author)
Measuring the BNF of Soybean Using 15N-Labelled Urea with Different Atom Excess (A.E. Content
Directory of Open Access Journals (Sweden)
A. Citraresmini
2012-12-01
Full Text Available The soybean is a legume which has an ability to supply its major nitrogen need by the biological nitrogen fixation (BNF process. This process is made possible by nodules formed in their roots, colonized by Rhizobium sp.bacteria. An accurate estimation of N gained by BNF is necessary to predict the increase or decrease of chemical fertilizer-N requirements to increase soybean production. Among several methods, the 15N method was used to estimate the ability of legumes to perform BNF. The study involved soybean var. Willis (W and a completely non-BNF soybean var. CV, which is termed as a standard crop. The standard crop is non-nodulated soybean, but it has the same main physiological traits with var. Willis. The aim of this study was to determine whether15N-labelled fertilizer with different %a.e. given to nodulated and non-nodulated soybean would not be of significant consequences for the calculation of N-BNF of W. The treatments applied were different rates of urea (20 kg N/ha and 100 kg N/ha combined with different atom excess percentages (%a.e.15N (2% and 10%. Thus, the combination of treatments were as follows:(1 W-ll (20 kg N; 2% a.e; (2 CV-hl (100 kg N; 2% a.e; (3 W-lh (20 kg N; 10% a.e; (4 CV-hh (100 kg N; 10% a.e; (5 CV-ll (20 kg N; 2% a.e; (6 W-hl (100 kg N; 2% a.e; (7 CV-lh (20 kg N; 10% a.e; (8 W-hh (100 kg N; 10% a.e. The result of the experiment showed that a high %a.e. with a low rate of 15N and a low %a.e. with a high rate of N should be used to study the %N-BNF of nodulated plants.
Faster and timing-attack resistant AES-GCM
Käsper, E.; Schwabe, P.; Clavier, C.; Gaj, K.
2009-01-01
We present a bitsliced implementation of AES encryption in counter mode for 64-bit Intel processors. Running at 7.59 cycles/byte on a Core 2, it is up to 25% faster than previous implementations, while simultaneously offering protection against timing attacks. In particular, it is the only
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
Dib, Ikram; Tits, Monique; Angenot, Luc; Wauters, Jean Noel; Assaidi, Asmae; Mekhfi, Hassane; Aziz, Mohammed; Bnouham, Mohammed; Legssyer, Abdelkhaleq; Frederich, Michel; Ziyyat, Abderrahim
2017-07-12
Artemisia campestris L. (Asteraceae) has many traditional uses, among which treatment of diabetes and hypertension. This study was conducted in order to confirm the antihypertensive and hypotensive effects of A. campestris L. aqueous extract (AcAE) and to explore the underlying mechanism of action of its vasorelaxant effect, besides the acute toxicity. Also, the chemical composition of AcAE was investigated. the chemical content of AcAE was determined by using HPLC and NMR techniques. The antihypertensive effect was assessed indirectly by tail-cuff method on L-NAME induced hypertensive rats, while the hypotensive action was monitored intravenously by invasive method on normotensive rats. The vasorelaxant effect and vascular mechanism of action were studied in the presence of antagonists and blockers on aorta isolated from normotensive rats. On the other side, the acute toxicity was studied by oral feeding of extract to the mice. The global phytochemical profile of AcAE reveals the presence of several polyphenols as main components. A. campestris L. infusion was characterized by mono- and di-cinnamoyl compounds, with 3,5-dicaffeoylquinic (isochlorogenic A) acid being the main compound, followed by 5-caffeoylquinic (chlorogenic) acid. Vicenin-2 (apigenin 6,8-di-C-glucoside) appeared to be the most abundant compound among flavonoids. The daily treatment with AcAE at 150mg/kg/day prevented the installation of hypertension on L-NAME hypertensive rats, and reduced SBP from 172mmHg up to 144mmHg. At the dose 40mg/kg, AcAE provoked reduction of systolic (SBP), diastolic (DBP) and mean arterial pressure (MAP), without affecting the heart rate. Also, AcAE (10 -2 -2mg/ml) relaxed the precontracted aorta by 95.8±1.3%. The denudation and preincubation of aorta with atropine, calmidazolium, L-NAME, hydroxycobalamin, ODQ, 8-RP-Br-PET-cGMP, thapsigargin and verapamil attenuated the vasorelaxant response, while the pre-treatment with 4-AP, TEA, glibenclamide and BaCl 2 did not
Directory of Open Access Journals (Sweden)
Palakkod G Vathsala
Full Text Available Earlier studies in this laboratory have shown the potential of artemisinin-curcumin combination therapy in experimental malaria. In a parasite recrudescence model in mice infected with Plasmodium berghei (ANKA, a single dose of alpha,beta-arteether (ART with three oral doses of curcumin prevented recrudescence, providing almost 95% protection. The parasites were completely cleared in blood with ART-alone (AE or ART+curcumin (AC treatments in the short-term, although the clearance was faster in the latter case involving increased ROS generation. But, parasites in liver and spleen were not cleared in AE or AC treatments, perhaps, serving as a reservoir for recrudescence. Parasitemia in blood reached up to 60% in AE-treated mice during the recrudescence phase, leading to death of animals. A transient increase of up to 2-3% parasitemia was observed in AC-treatment, leading to protection and reversal of splenomegaly. A striking increase in spleen mRNA levels for TLR2, IL-10 and IgG-subclass antibodies but a decrease in those for INFγ and IL-12 was observed in AC-treatment. There was a striking increase in IL-10 and IgG subclass antibody levels but a decrease in INFγ levels in sera leading to protection against recrudescence. AC-treatment failed to protect against recrudescence in TLR2(-/- and IL-10(-/- animals. IL-10 injection to AE-treated wild type mice and AC-treated TLR2(-/- mice was able to prolong survival. Blood from the recrudescence phase in AE-treatment, but not from AC-treatment, was able to reinfect and kill naïve animals. Sera from the recrudescence phase of AC-treated animals reacted with several parasite proteins compared to that from AE-treated animals. It is proposed that activation of TLR2-mediated innate immune response leading to enhanced IL-10 production and generation of anti-parasite antibodies contribute to protective immunity in AC-treated mice. These results indicate a potential for curcumin-based combination therapy to
PIXE analysis of human stones: comparison with data from ICP-AES
International Nuclear Information System (INIS)
Pougnet, M.A.B.; Peisach, M.; Pineda, C.A.; Rodgers, A.L.
1987-01-01
25 human stone samples previously analyzed by inductively coupled plasma atomic emission spectroscopy (ICP-AES) and the IAEA Animal Bone Standard Reference Material were used to evaluate trace element analysis by PIXE. Bombardment with 4 MeV protons was used for the determination of Mn, Fe, Cu, Pb, Br, Rb, Sr and Ca. PIXE and ICP-AES data gave correlation factors better than 0.97 for the elements Ca, Fe, Zn, Sr and Pb. (author) 9 refs.; 5 figs
Some aspects of ICP-AES analysis of high purity rare earths
International Nuclear Information System (INIS)
Murty, P.S.; Biswas, S.S.
1991-01-01
Inductively coupled plasma atomic emission spectrometry (ICP-AES) is a technique capable of giving high sensitivity in trace elemental analysis. While the technique possesses high sensitivity, it lacks high selectivity. Selectivity is important where substances emitting complex spectra are to be analysed for trace elements. Rare earths emit highly complex spectra in a plasma source and the determination of adjacent rare earths in a high purity rare earth matrix, with high sensitivity, is not possible due to the inadequate selectivity of ICP-AES. One approach that has yielded reasonably good spectral selectivity in the high purity rare earth analysis by ICP-AES is by employing a combination of wavelength modulation techniques and high resolution echelle grating. However, it was found that by using a high resolution monochromator senstitivities either comparable to or better than those reported by the wavelength modulation technique could be obtained. (author). 2 refs., 2 figs., 2 tabs
Indian Academy of Sciences (India)
5, AeKVR-4, (TC)6, 389, TCCGATGAGGAACTAGATGGAT, CCCAGTTGGACCTTGAGAGA, 55. 6, AeKVR-5, (TA)10, 396, GGAAAGCGAAGAAATCACAGTT, AACGTAAACTAGGAAACGGACG, 51. 7, AeKVR-6, (AT)14, 311, ACGACACGTATATGCCTACTTGAG, ACGTCCTAAACGAACGTCCTTA, 49. 8, AeKVR-7, (AC)7, 202 ...
Detection of AE signals from a HTS tape during quenching in a solid cryogen-cooling system
International Nuclear Information System (INIS)
Kim, K.J.; Song, J.B.; Kim, J.H.; Lee, J.H.; Kim, H.M.; Kim, W.S.; Na, J.B.; Ko, T.K.; Lee, H.G.
2010-01-01
The acoustic emission (AE) technique is suitable for detecting the presence of thermal and mechanical stress in superconductors, which have adverse effects on the stability of their application systems. However, the detection of AE signals from a HTS tape in a bath of liquid cryogen (such as liquid nitrogen, LN 2 ) has not been reported because of its low signal to noise ratio due to the noise from the boiling liquid cryogen. In order to obtain the AE signals from the HTS tapes during quenching, this study carried out repetitive quench tests for YBCO coated conductor (CC) tapes in a cooling system using solid nitrogen (SN 2 ). This paper examined the performance of the AE sensor in terms of the amplitudes of the AE signals in the SN 2 cooling system.
Nakaya, Makoto; Shojo, Aiko; Hirai, Hiroaki; Matsumoto, Kenji; Kitamura, Shinichi
2013-01-01
waxy/amylose-extender (wx/ae) double-mutant japonica rice (Oryza sativa L.) produces resistant starch (RS) and a large amount of γ-oryzanol. Our previous study has shown the hypolipidemic effect of wx/ae brown rice on mice. To identify the functional constituents of the hypolipidemic activity in wx/ae rice, we prepared pure wx/ae starch and γ-oryzanol from wx/ae rice and investigated their effect on the lipid metabolism in BALB/c.KOR/Stm Slc-Apoe(shl) mice. The mice were fed for 3 weeks a diet containing non-mutant rice starch, non-mutant rice starch plus γ-oryzanol, wx/ae starch, or wx/ae starch plus γ-oryzanol. γ-Oryzanol by itself had no effect on the lipid metabolism, and wx/ae starch prevented an accumulation of triacylglycerol (TAG) in the liver. Interestingly, the combination of wx/ae starch plus γ-oryzanol not only prevented a TAG accumulation in the liver, but also partially suppressed the rise in plasma TAG concentration, indicating that wx/ae starch and γ-oryzanol could have a synergistic effect on the lipid metabolism.
Multielemental analysis of Korean geological reference samples by INAA, ICP-AES and ICP-MS
International Nuclear Information System (INIS)
Naoki Shirai; Hiroki Takahashi; Yuta Yokozuka; Mitsuru Ebihara; Meiramkhan Toktaganov; Shun Sekimoto
2015-01-01
Six Korean geological reference samples (KB-1, KGB-1, KT-1, KD-1, KG-1 and KG-2) prepared by Korea Institutes of Geoscience and Mineral Resources were analyzed by using INAA, ICP-AES and ICP-MS. Some elements could be determined by both INAA and non-INAA methods (ICP-AES and ICP-MS), and these data are consistent with each other. This study confirms that a combination of ICP-AES and ICP-MS is comparable to INAA in determining a wide range of major, minor and trace elements in geological materials. (author)
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
Optical spectrophotometry of oscillations and flickering in AE Aquarii
Welsh, William F.; Horne, Keith; Oke, J. B.
1993-01-01
We observed rapid variations in the nova-like cataclysmic variable AE Aquarii for 1.7 hr with 4.3 s time resolution using the 30-channel (3227-10494 A) spectrophotometer on the Hale 5 m telescope. The 16.5 and 33.0 s oscillations show a featureless blue spectrum that can be represented by a blackbody with temperature and area much smaller than the accretion disk. Models consisting of the sum of a K star spectrum and a hydrogen slab in LTE at T = 6000-10,000 K can fit the spectrum of AE Aquarii reasonably well. The spectrum of a flare indicates optically thin gas with T = 8000-12,000 K. The energy released by the flare is large compared to typical stellar flares.
Accelerating Solution Proposal of AES Using a Graphic Processor
Directory of Open Access Journals (Sweden)
STRATULAT, M.
2011-11-01
Full Text Available The main goal of this work is to analyze the possibility of using a graphic processing unit in non graphical calculations. Graphic Processing Units are being used nowadays not only for game engines and movie encoding/decoding, but also for a vast area of applications, like Cryptography. We used the graphic processing unit as a cryptographic coprocessor in order accelerate AES algorithm. Our implementation of AES is on a GPU using CUDA architecture. The performances obtained show that the CUDA implementation can offer speedups of 11.95Gbps. The tests are conducted in two directions: running the tests on small data sizes that are located in memory and large data that are stored in files on hard drives.
Mineral distribution in rice: Measurement by Microwave Plasma Atomic Emission Spectroscopy (MP-AES)
International Nuclear Information System (INIS)
Ramos, Nerissa C.; Ramos, R.G.A.; Quirit, L.L.; Arcilla, C.A.
2015-01-01
Microwave Plasma Atomic Emission Spectroscopy (MP-AES) is a new technology with comparable performance and sensitivity to Inductively Coupled Plasma Optical Emission Spectroscopy (ICP-OES). Both instrument use plasma as the energy source that produces atomic and ionic emission lines. However, MP-AES uses nitrogen as the plasma gas instead of argon which is an additional expense for ICP-OES. Thus, MP-AES is more economical. This study quantified six essential minerals (Se, Zn, Fe, Cu, Mn and K) in rice using MP-AES. Hot plate digestion was used for sample extraction and the detection limit for each instrument was compared with respect to the requirement for routine analysis in rice. Black, red and non-pigmented rice samples were polished in various intervals to determine the concentration loss of minerals. The polishing time corresponds to the structure of the rice grains such as outer bran layer (0 to 15), inner bran layer (15 to 30), outer endosperm layer (30 to 45), and middle endosperm layer (45 to 60). Results of MP-AES analysis showed that black rice had all essential materials (except K) in high concentration at the outer bran layer. The red and non-pigmented rice samples on the other hand, contained high levels of Se, Zn, Fe, and Mn in the whole bran portion. After 25 seconds, the mineral concentrations remained constant. The concentration of Cu however, gave consistent value in all polishing intervals, hence Cu might be located in the inner endosperm layer. Results also showed that K was uniformly distributed in all samples where 5% loss was consistently observed for every polishing interval. Therefore, the concentration of K was also affected by polishing time. Thus, the new MP-AES technology with comparable performance to ICP-OES is a promising tool for routine analysis in rice. (author)
KOMBINASI ALGORITMA AES, RC4 DAN ELGAMAL DALAM SKEMA HYBRID UNTUK KEAMANAN DATA
Directory of Open Access Journals (Sweden)
Adi Widarma
2016-01-01
Full Text Available Abstrak — Pengiriman atau pertukaran data adalah hal yang sering terjadi dalam dunia teknologi informasi. Data yang dikirim kadang sering berisi data informasi yang penting bahkan sangat rahasia dan harus dijaga keamanannya. Untuk menjaga keamanan data, dapat dilakukan dengan menggunakan teknik kriptografi. Algoritma AES dan RC4 adalah salah satu dari algoritma simetri. Kelemahan dari algoritma simetri adalah proses enkripsi dan dekripsi menggunakan kunci yang sama. Untuk mengatasi tersebut dilakukan dengan menggunakan algoritma Elgamal. Algoritma Elgamal adalah termasuk algoritma asimetri. Algoritma Elgamal digunakan untuk mengamankan kunci dari algoritma AES dan RC4. Peningkatan keamanan pesan dan kunci dilakukan dengan algoritma hybrid. Algoritma hybrid dengan mengkombinasikan beberapa algoritma baik algoritma simetri maupun algortima asimetri akan menambah keamanan sehingga menjadi lebih aman dan powerful (Jain & Agrawal 2014. Penelitian ini akan dilakukan metode hybrid yaitu mengkombinasikan beberapa algoritma kriptografi dengan menggunakan algoritma Advanced Encryption Standard (AES dan RC4 untuk kerahasiaan data serta algoritma Elgamal digunakan untuk enkripsi dan dekripsi kunci. Kata Kunci : kriptograpi, algoritma AES, RC4, Elgamal, hybrid
Evaluation of the use of envelope analysis and DWT on AE signals generated from degrading shafts
International Nuclear Information System (INIS)
Gu, Dongsik; Kim, Jaegu; Kelimu, Tulugan; Huh, Sun-Chul; Choi, Byeong-Keun
2012-01-01
Vibration analysis is widely used in machinery diagnosis. Wavelet transforms and envelope analysis, which have been implemented in many applications in the condition monitoring of machinery, are applied in the development of a condition monitoring system for early detection of faults generated in several key components of machinery. Early fault detection is a very important factor in condition monitoring and a basic component for the application of condition-based maintenance (CBM) and predictive maintenance (PM). In addition, acoustic emission (AE) sensors have specific characteristics that are highly sensitive to high-frequency and low-energy signals. Therefore, the AE technique has been applied recently in studies on the early detection of failure. In this paper, AE signals caused by crack growth on a rotating shaft were captured through an AE sensor. The AE signatures were pre-processed using the proposed signal processing method, after which power spectrums were generated from the FFT results. In the power spectrum, some peaks from fault frequencies were presented. According to the results, crack growth in rotating machinery can be considered and detected using an AE sensor and the signal processing method.
Evaluation of fracturing process of soft rocks at great depth by AE measurement and DEM simulation
International Nuclear Information System (INIS)
Aoki, Kenji; Mito, Yoshitada; Kurokawa, Susumu; Matsui, Hiroya; Niunoya, Sumio; Minami, Masayuki
2007-01-01
The authors developed the stress-based evaluation system of EDZ by AE monitoring and Distinct Element Method (DEM) simulation. In order to apply this system to the soft rock site, the authors try to grasp the relationship between AE parameters, stress change and rock fracturing process by performing the high stiffness tri-axial compression tests including AE measurements on the soft rock samples, and its simulations by DEM using bonded particle model. As the result, it is found that change in predominant AE frequency is effective to evaluate fracturing process in sedimentary soft rocks, and the relationship between stress change and fracturing process is also clarified. (author)
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
Vicuña, Cristián Molina; Höweler, Christoph
2017-12-01
The use of AE in machine failure diagnosis has increased over the last years. Most AE-based failure diagnosis strategies use digital signal processing and thus require the sampling of AE signals. High sampling rates are required for this purpose (e.g. 2 MHz or higher), leading to streams of large amounts of data. This situation is aggravated if fine resolution and/or multiple sensors are required. These facts combine to produce bulky data, typically in the range of GBytes, for which sufficient storage space and efficient signal processing algorithms are required. This situation probably explains why, in practice, AE-based methods consist mostly in the calculation of scalar quantities such as RMS and Kurtosis, and the analysis of their evolution in time. While the scalar-based approach offers the advantage of maximum data reduction; it has the disadvantage that most part of the information contained in the raw AE signal is lost unrecoverably. This work presents a method offering large data reduction, while keeping the most important information conveyed by the raw AE signal, useful for failure detection and diagnosis. The proposed method consist in the construction of a synthetic, unevenly sampled signal which envelopes the AE bursts present on the raw AE signal in a triangular shape. The constructed signal - which we call TriSignal - also permits the estimation of most scalar quantities typically used for failure detection. But more importantly, it contains the information of the time of occurrence of the bursts, which is key for failure diagnosis. Lomb-Scargle normalized periodogram is used to construct the TriSignal spectrum, which reveals the frequency content of the TriSignal and provides the same information as the classic AE envelope. The paper includes application examples in planetary gearbox and low-speed rolling element bearing.
Clinical and molecular genetic features of Hb H and AE Bart's diseases in central Thai children.
Traivaree, Chanchai; Boonyawat, Boonchai; Monsereenusorn, Chalinee; Rujkijyanont, Piya; Photia, Apichat
2018-01-01
α-Thalassemia, one of the major thalassemia types in Thailand, is caused by either deletion or non-deletional mutation of one or both α-globin genes. Inactivation of three α-globin genes causes hemoglobin H (Hb H) disease, and the combination of Hb H disease with heterozygous hemoglobin E (Hb E) results in AE Bart's disease. This study aimed to characterize the clinical and hematological manifestations of 76 pediatric patients with Hb H and AE Bart's diseases treated at Phramongkutklao Hospital, a tertiary care center for thalassemia patients in central Thailand. Seventy-six unrelated pediatric patients, 58 patients with Hb H disease and 18 patients with AE Bart's disease, were enrolled in this study. Their clinical presentations, transfusion requirement, laboratory findings, and mutation analysis were retrospectively reviewed and analyzed. A total of 76 pediatric patients with Hb H and AE Bart's diseases who mainly lived in central Thailand were included in this study. The clinical severities of patients with non-deletional mutations were more severe than those with deletional mutations. Eighty-six percent of patients with non-deletional AE Bart's disease required more blood transfusion compared to 12.5% of patients with deletional AE Bart's disease. Non-deletional AE Bart's disease also had a history of urgent blood transfusion with the average of 6±0.9 times compared to 1±0.3 times in patients with deletional Hb H disease. The difference was statistically significant. This study revealed the differences in clinical spectrum between patients with Hb H disease and those with AE Bart's disease in central Thailand. The differentiation of α-thalassemia is essential for appropriate management of patients. The molecular diagnosis is useful for diagnostic confirmation and genotype-phenotype correlation.
Correlation consistent basis sets for actinides. II. The atoms Ac and Np-Lr.
Feng, Rulin; Peterson, Kirk A
2017-08-28
New correlation consistent basis sets optimized using the all-electron third-order Douglas-Kroll-Hess (DKH3) scalar relativistic Hamiltonian are reported for the actinide elements Ac and Np through Lr. These complete the series of sets reported previously for Th-U [K. A. Peterson, J. Chem. Phys. 142, 074105 (2015); M. Vasiliu et al., J. Phys. Chem. A 119, 11422 (2015)]. The new sets range in size from double- to quadruple-zeta and encompass both those optimized for valence (6s6p5f7s6d) and outer-core electron correlations (valence + 5s5p5d). The final sets have been contracted for both the DKH3 and eXact 2-component (X2C) Hamiltonians, yielding cc-pVnZ-DK3/cc-pVnZ-X2C sets for valence correlation and cc-pwCVnZ-DK3/cc-pwCVnZ-X2C sets for outer-core correlation (n = D, T, Q in each case). In order to test the effectiveness of the new basis sets, both atomic and molecular benchmark calculations have been carried out. In the first case, the first three atomic ionization potentials (IPs) of all the actinide elements Ac-Lr have been calculated using the Feller-Peterson-Dixon (FPD) composite approach, primarily with the multireference configuration interaction (MRCI) method. Excellent convergence towards the respective complete basis set (CBS) limits is achieved with the new sets, leading to good agreement with experiment, where these exist, after accurately accounting for spin-orbit effects using the 4-component Dirac-Hartree-Fock method. For a molecular test, the IP and atomization energy (AE) of PuO 2 have been calculated also using the FPD method but using a coupled cluster approach with spin-orbit coupling accounted for using the 4-component MRCI. The present calculations yield an IP 0 for PuO 2 of 159.8 kcal/mol, which is in excellent agreement with the experimental electron transfer bracketing value of 162 ± 3 kcal/mol. Likewise, the calculated 0 K AE of 305.6 kcal/mol is in very good agreement with the currently accepted experimental value of 303.1 ± 5 kcal
Evolution of microstructure and hardness of AE42 alloy after heat treatments
DEFF Research Database (Denmark)
Huang, Y.D.; Dieringa, H.; Hort, N.
2008-01-01
properties even further. It is shown that the microstructure of the squeeze-cast AE42 alloy is stable at high temperature 450 degrees C. The subsequent solution and ageing treatments have a limited effect on the hardness. The weak age-hardening is attributed to the precipitation of small amount Of Mg17Al12......The AE42 magnesium alloy was developed for high pressure die casting (HPDC) from low-aluminum magnesium alloys. In this alloy the rare earth (RE) elements were shown to increase creep resistance by forming AlxREy intermetallics along the grain boundaries. The present work investigates...... the microstructure of squeeze cast AE42 magnesium alloy and evaluates its hardness before and after heat treatments. The change in hardness is discussed based on the microstructural observations. Some suggestions are given concerning future design of alloy compositions in order to improve high temperature creep...
Directory of Open Access Journals (Sweden)
Sudhir
2018-01-01
Full Text Available BACKGROUND Acute encephalitis syndrome is a group of clinical neurologic manifestation caused by wide range of viruses, bacteria, fungus, parasites, spirochetes, chemicals and toxins. According to AES guidelines- Acute encephalitis syndrome due to unknown agent is defined as a suspected case in which no diagnostic testing is performed or in which testing was performed, but no aetiological agent was identified or in which the test results were indeterminate. Acute encephalitis syndrome in children is due to interaction of several factors in combination. The aim of the study is to evaluate the sociocultural and environmental factors, which plays a major role in AES. MATERIALS AND METHODS The study design was non-interventional, hospital-based, prospective study. The study was conducted at Paediatric Department of S.K.M.C.H., Muzaffarpur, Bihar, over a period of January 1, 2015, to July 31, 2017. Infants/children admitted in S.K.M.C.H., Muzaffarpur, were included in study. All defined cases according to AES guidelines were included and 92 infants/children were selected. Percentage, proportion and Chi-square test were performed for statistical analysis. RESULTS Among 92 selected infants/children, AES was highest in rural area, 80 (86.95%. The seasonal incidence of AES was March to July in which highest incidence was found in June, 63 (68.47%. Highest incidence of AES was seen between 1-5 years of age. There was significant statistical association among age of children and AES. AES was more common in male than female. AES was highest in dwellers of kachcha (mud house. AES was highest, 90 (97.82% among children of labour/farmer. AES was highest, 90 (97.82% in which mother was illiterate. Incidence of AES was highest in Hindu religion. All AES, 92 (100% was seen in malnourished/undernourished children. CONCLUSION Sociocultural and environmental factors were the major determinant risk factors for AES. Among these, malnutrition/under nutrition was the
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
International Nuclear Information System (INIS)
Kim, Sung Jin; Kwon, Oh Yang; Jang, Yong Joon
2007-01-01
The fatigue crack growth behavior of a cracked and patch-repaired Ah2024-T3 panel has been monitored by acoustic emission(AE). The overall crack growth rate was reduced The crack propagation into the adjacent hole was also retarded by introducing the patch repair. AE signals due to crack growth after the patch repair and those due to debonding of the plate-patch interface were discriminated by using the principal component analysis. The former showed high center frequency and low amplitude, whereas the latter showed long rise tine, low frequency and high amplitude. This type of AE signal recognition method could be effective for the prediction of fatigue crack growth behavior in the patch-repaired structures with the aid of AE source location
The effect of CFRP on retrofitting of damaged HSRC beams using AE technique
Soffian Noor, M. S.; Noorsuhada, M. N.
2017-12-01
This paper presents the effect of carbon fibre reinforced polymer (CFRP) on retrofitted high strength reinforced concrete (HSRC) beams using acoustic emission (AE) technique. Two RC beam parameters were prepared. The first was the control beam which was undamaged HSRC beam. The second was the damaged HSRC beam retrofitted with CFRP on the soffit. The main objective of this study is to assess the crack modes of HSRC beams using AE signal strength. The relationship between signal strength, load and time were analysed and discussed. The crack pattern observed from the visual observation was also investigated. HSRC beam retrofitted with CFRP produced high signal strength compared to control beam. It demonstrates the effect of the AE signal strength for interpretation and prediction of failure modes that might occur in the beam specimens.
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
ICP/AES radioactive sample analyses at Pacific Northwest Laboratory
International Nuclear Information System (INIS)
Matsuzaki, C.L.; Hara, F.T.
1986-03-01
Inductively coupled argon plasma atomic emission spectroscopy (ICP/AES) analyses of radioactive materials at Pacific Northwest Laboratory (PNL) began about three years ago upon completion of the installation of a modified Applied Research Laboratory (ARL) 3560. Funding for the purchase and installation of the ICP/AES was provided by the Nuclear Waste Materials Characterization Center (MCC) established at PNL by the Department of Energy in 1979. MCC's objective is to ensure that qualified materials data are available on waste materials. This paper is divided into the following topics: (1) Instrument selection considerations; (2) initial installation of the simultaneous system with the source stand enclosed in a 1/2'' lead-shielded glove box; (3) retrofit installation of the sequential spectrometer; and (4) a brief discussion on several types of samples analyzed. 1 ref., 7 figs., 1 tab
Realization and optimization of AES algorithm on the TMS320DM6446 based on DaVinci technology
Jia, Wen-bin; Xiao, Fu-hai
2013-03-01
The application of AES algorithm in the digital cinema system avoids video data to be illegal theft or malicious tampering, and solves its security problems. At the same time, in order to meet the requirements of the real-time, scene and transparent encryption of high-speed data streams of audio and video in the information security field, through the in-depth analysis of AES algorithm principle, based on the hardware platform of TMS320DM6446, with the software framework structure of DaVinci, this paper proposes the specific realization methods of AES algorithm in digital video system and its optimization solutions. The test results show digital movies encrypted by AES128 can not play normally, which ensures the security of digital movies. Through the comparison of the performance of AES128 algorithm before optimization and after, the correctness and validity of improved algorithm is verified.
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
Pulsational stability of the SX Phe star AE UMa
Pena, J. H.; Renteria, A.; Villarreal, C.; Pina, D. S.; Soni, A. A.; Guillen, J.; Vargas, K.; Trejo, O.
2016-11-01
From newly determined times of maxima of the SX Phe star AE UMa and a compilation of previous times of maxima, we were able to determine the nature of this star. With uv photometry we determined its physical parameters.
Wireless AE Event and Environmental Monitoring for Wind Turbine Blades at Low Sampling Rates
Bouzid, Omar M.; Tian, Gui Y.; Cumanan, K.; Neasham, J.
Integration of acoustic wireless technology in structural health monitoring (SHM) applications introduces new challenges due to requirements of high sampling rates, additional communication bandwidth, memory space, and power resources. In order to circumvent these challenges, this chapter proposes a novel solution through building a wireless SHM technique in conjunction with acoustic emission (AE) with field deployment on the structure of a wind turbine. This solution requires a low sampling rate which is lower than the Nyquist rate. In addition, features extracted from aliased AE signals instead of reconstructing the original signals on-board the wireless nodes are exploited to monitor AE events, such as wind, rain, strong hail, and bird strike in different environmental conditions in conjunction with artificial AE sources. Time feature extraction algorithm, in addition to the principal component analysis (PCA) method, is used to extract and classify the relevant information, which in turn is used to classify or recognise a testing condition that is represented by the response signals. This proposed novel technique yields a significant data reduction during the monitoring process of wind turbine blades.
Loureiro, I.; Escorial, C.; García-Baudin, J.M.; Chueca, C.
2009-01-01
Some F1 hybrid plants between three species of the Aegilops genus and different hexaploid wheat Triticum aestivum cultivars show certain self-fertility, with averages of F1 hybrids bearing F2 seeds of 8.17%, 5.12% and 48.14% for Aegilops biuncialis, Aegilops geniculata and Aegilops triuncialis respectively. In the Ae. triuncialis-wheat combination with ";Astral" wheat cultivar, the fertility was higher than that found in the other combinations. All the F2 seeds studied were spontaneous amphip...
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
Hernández-Rodríguez, Carmen Sara; Hernández-Martínez, Patricia; Van Rie, Jeroen; Escriche, Baltasar; Ferré, Juan
2013-01-01
First generation of insect-protected transgenic corn (Bt-corn) was based on the expression of Cry1Ab or Cry1Fa proteins. Currently, the trend is the combination of two or more genes expressing proteins that bind to different targets. In addition to broadening the spectrum of action, this strategy helps to delay the evolution of resistance in exposed insect populations. One of such examples is the combination of Cry1A.105 with Cry1Fa and Cry2Ab to control O. nubilalis and S. frugiperda. Cry1A.105 is a chimeric protein with domains I and II and the C-terminal half of the protein from Cry1Ac, and domain III almost identical to Cry1Fa. The aim of the present study was to determine whether the chimeric Cry1A.105 has shared binding sites either with Cry1A proteins, with Cry1Fa, or with both, in O. nubilalis and in S. frugiperda. Brush-border membrane vesicles (BBMV) from last instar larval midguts were used in competition binding assays with 125I-labeled Cry1A.105, Cry1Ab, and Cry1Fa, and unlabeled Cry1A.105, Cry1Aa, Cry1Ab, Cry1Ac, Cry1Fa, Cry2Ab and Cry2Ae. The results showed that Cry1A.105, Cry1Ab, Cry1Ac and Cry1Fa competed with high affinity for the same binding sites in both insect species. However, Cry2Ab and Cry2Ae did not compete for the binding sites of Cry1 proteins. Therefore, according to our results, the development of cross-resistance among Cry1Ab/Ac, Cry1A.105, and Cry1Fa proteins is possible in these two insect species if the alteration of shared binding sites occurs. Conversely, cross-resistance between these proteins and Cry2A proteins is very unlikely in such case. PMID:23861865
International Nuclear Information System (INIS)
Lee, Jun Hyun; Lee, Min Rae; Shon, Myung Hwan; Kwon, Young Kil
1998-01-01
An acoustic emission(AE) technique has been used to monitor and diagnose quenching phenomenon in racetrack shaped superconducting magnets at cryogenic environment of 4.2 K. The ultimate goal is to ensure the safety and reliability of large superconducting magnet systems by being able to identity and locate the sources of quench in superconducting magnets. The characteristics of AE parameters have been analyzed by correlating with quench number, winding tension of superconducting coil and charge rate by transport current. It was found in this study that there was good correlation between quench current and AE parameters. The source location of quenching in superconducting magnet was also discussed on the hashing of correlation between magnet voltage and AE energy.
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
International Nuclear Information System (INIS)
1994-05-01
The Department of Energy (DOE) has identified the need for field-deployable elemental analysis devices that are safer, faster, and less expensive than the fixed laboratory procedures now used to screen hazardous waste sites. As a response to this need, the Technology Integration Program (TIP) created a mobile, field-deployable laser ablation-inductively coupled plasma-atomic emission spectrometry (LA-ICP-AES) sampling and analysis prototype. Although the elemental. screening prototype has been successfully field-tested, continued marketing and technical development efforts are required to transfer LA-ICP-AES technology to the commercial sector. TIP established and supported a student research and design group called the Integrated Design for Marketing and Manufacturing (IDMM) team to advance the technology transfer of mobile, field-deployable LA-ICP-AES. The IDMM team developed a conceptual design (which is detailed in this report) for a mobile, field-deployable LA-ICP-AES sampling and analysis system, and reports the following findings: Mobile, field-deployable LA-ICP-AES is commercially viable. Eventual regulatory acceptance of field-deployable LA-ICP-AES, while not a simple process, is likely. Further refinement of certain processes and components of LA-ICP-AES will enhance the device's sensitivity and accuracy
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
Formation of titanium nitride layers on titanium metal: Results of XPS and AES investigations
International Nuclear Information System (INIS)
Moers, H.; Pfennig, G.; Klewe-Nebenius, H.; Penzhorn, R.D.; Sirch, M.; Willin, E.
1988-09-01
The reaction of titanium metal with gaseous nitrogen and ammonia at temperatures of 890 0 C leads to the formation of nitridic overlayers on the metallic substrate. The thicknesses of the overlayers increase with increasing reaction time. Under comparable conditions ammonia reacts much slower than nitrogen. XPS and AES depth profile analyses show continuous changes of the in-depth compositions of the overlayers. This can be interpreted in terms of a very irregular thickness of the overlayers, an assumption which is substantiated by local AES analyses and by the observation of a pronounced crystalline structure of the substrate after annealing pretreatment, which can give rise to locally different reaction rates. The depth profile is also influenced by the broad ranges of stability of the titanium nitride phases formed during the reaction. The quantitative analysis of the titanium/nitrogen overlayers by AES is difficult because of the overlap of titanium and nitrogen Auger peaks. In quantitative XPS analysis problems arise due to difficulties in defining Ti 2p peak areas. This work presents practical procedures for the quantitative evaluation by XPS and AES of nitridic overlayers with sufficient accuracy. (orig.) [de
Repression of HNF1α-mediated transcription by amino-terminal enhancer of split (AES)
Energy Technology Data Exchange (ETDEWEB)
Han, Eun Hee [Section of Structural Biology, Hormel Institute, University of Minnesota, Austin, MN 55912 (United States); Gorman, Amanda A. [Department of Molecular and Cellular Biochemistry, University of Kentucky, Lexington, KY 40536 (United States); Singh, Puja [Section of Structural Biology, Hormel Institute, University of Minnesota, Austin, MN 55912 (United States); Chi, Young-In, E-mail: ychi@hi.umn.edu [Section of Structural Biology, Hormel Institute, University of Minnesota, Austin, MN 55912 (United States)
2015-12-04
HNF1α (Hepatocyte Nuclear Factor 1α) is one of the master regulators in pancreatic beta-cell development and function, and the mutations in Hnf1α are the most common monogenic causes of diabetes mellitus. As a member of the POU transcription factor family, HNF1α exerts its gene regulatory function through various molecular interactions; however, there is a paucity of knowledge in their functional complex formation. In this study, we identified the Groucho protein AES (Amino-terminal Enhancer of Split) as a HNF1α-specific physical binding partner and functional repressor of HNF1α-mediated transcription, which has a direct link to glucose-stimulated insulin secretion in beta-cells that is impaired in the HNF1α mutation-driven diabetes. - Highlights: • We identified AES as a transcriptional repressor for HNF1α in pancreatic beta-cell. • AES's repressive activity was HNF1α-specific and was not observed with HNF1β. • AES interacts with the transactivation domain of HNF1α. • Small molecules can be designed or discovered to disrupt this interaction and improve insulin secretion and glucose homeostasis.
Repression of HNF1α-mediated transcription by amino-terminal enhancer of split (AES)
International Nuclear Information System (INIS)
Han, Eun Hee; Gorman, Amanda A.; Singh, Puja; Chi, Young-In
2015-01-01
HNF1α (Hepatocyte Nuclear Factor 1α) is one of the master regulators in pancreatic beta-cell development and function, and the mutations in Hnf1α are the most common monogenic causes of diabetes mellitus. As a member of the POU transcription factor family, HNF1α exerts its gene regulatory function through various molecular interactions; however, there is a paucity of knowledge in their functional complex formation. In this study, we identified the Groucho protein AES (Amino-terminal Enhancer of Split) as a HNF1α-specific physical binding partner and functional repressor of HNF1α-mediated transcription, which has a direct link to glucose-stimulated insulin secretion in beta-cells that is impaired in the HNF1α mutation-driven diabetes. - Highlights: • We identified AES as a transcriptional repressor for HNF1α in pancreatic beta-cell. • AES's repressive activity was HNF1α-specific and was not observed with HNF1β. • AES interacts with the transactivation domain of HNF1α. • Small molecules can be designed or discovered to disrupt this interaction and improve insulin secretion and glucose homeostasis.
Directory of Open Access Journals (Sweden)
Konstantin A Tsetsarkin
2009-08-01
Full Text Available Between 2005 and 2007 Chikungunya virus (CHIKV caused its largest outbreak/epidemic in documented history. An unusual feature of this epidemic is the involvement of Ae. albopictus as a principal vector. Previously we have demonstrated that a single mutation E1-A226V significantly changed the ability of the virus to infect and be transmitted by this vector when expressed in the background of well characterized CHIKV strains LR2006 OPY1 and 37997. However, in the current study we demonstrate that introduction of the E1-A226V mutation into the background of an infectious clone derived from the Ag41855 strain (isolated in Uganda in 1982 does not significantly increase infectivity for Ae. albopictus. In order to elucidate the genetic determinants that affect CHIKV sensitivity to the E1-A226V mutation in Ae. albopictus, the genomes of the LR2006 OPY1 and Ag41855 strains were used for construction of chimeric viruses and viruses with a specific combination of point mutations at selected positions. Based upon the midgut infection rates of the derived viruses in Ae. albopictus and Ae. aegypti mosquitoes, a critical role of the mutations at positions E2-60 and E2-211 on vector infection was revealed. The E2-G60D mutation was an important determinant of CHIKV infectivity for both Ae. albopictus and Ae. aegypti, but only moderately modulated the effect of the E1-A226V mutation in Ae. albopictus. However, the effect of the E2-I211T mutation with respect to mosquito infections was much more specific, strongly modifying the effect of the E1-A226V mutation in Ae. albopictus. In contrast, CHIKV infectivity for Ae. aegypti was not influenced by the E2-1211T mutation. The occurrence of the E2-60G and E2-211I residues among CHIKV isolates was analyzed, revealing a high prevalence of E2-211I among strains belonging to the Eastern/Central/South African (ECSA clade. This suggests that the E2-211I might be important for adaptation of CHIKV to some particular conditions
Benahmed, A.; Bouhemadou, A.; Alqarni, B.; Guechi, N.; Al-Douri, Y.; Khenata, R.; Bin-Omran, S.
2018-05-01
First-principles calculations were performed to investigate the structural, elastic, electronic, optical and thermoelectric properties of the Zintl-phase Ae3AlAs3 (Ae = Sr, Ba) using two complementary approaches based on density functional theory. The pseudopotential plane-wave method was used to explore the structural and elastic properties whereas the full-potential linearised augmented plane wave approach was used to study the structural, electronic, optical and thermoelectric properties. The calculated structural parameters are in good consistency with the corresponding measured ones. The single-crystal and polycrystalline elastic constants and related properties were examined in details. The electronic properties, including energy band dispersions, density of states and charge-carrier effective masses, were computed using Tran-Blaha modified Becke-Johnson functional for the exchange-correlation potential. It is found that both studied compounds are direct band gap semiconductors. Frequency-dependence of the linear optical functions were predicted for a wide photon energy range up to 15 eV. Charge carrier concentration and temperature dependences of the basic parameters of the thermoelectric properties were explored using the semi-classical Boltzmann transport model. Our calculations unveil that the studied compounds are characterised by a high thermopower for both carriers, especially the p-type conduction is more favourable.
International Nuclear Information System (INIS)
Chung, Min Hwa; Cho, Yong Sang; Yoon, Dong Jin; Kwon, Oh Yang
1996-01-01
For the condition monitoring of the journal bearing in rotating machinery, a system for their diagnosis by acoustic emission(AE) was developed. AE has been used to detect abnormal conditions in the bearing system. It was found from the field application study as well as the laboratory experiment using a simulated journal bearing system that AE RMS voltage was the most efficient parameter for the purpose of current study. Based on the above results, algorithms and judgement criteria for the diagnosis system was established. The system is composed of four parts as follows: the sensing part including AE sensor and preamplifier, the signal processing part for RMS-to-DC conversion to measure AE ms voltage, the interface part for transferring RMS voltage data into PC using A/D converter, and the software part including the graphic display of bearing conditions and the diagnosis program
An AES chip with DPA resistance using hardware-based random order execution
International Nuclear Information System (INIS)
Yu Bo; Li Xiangyu; Chen Cong; Sun Yihe; Wu Liji; Zhang Xiangmin
2012-01-01
This paper presents an AES (advanced encryption standard) chip that combats differential power analysis (DPA) side-channel attack through hardware-based random order execution. Both decryption and encryption procedures of an AES are implemented on the chip. A fine-grained dataflow architecture is proposed, which dynamically exploits intrinsic byte-level independence in the algorithm. A novel circuit called an HMF (Hold-Match-Fetch) unit is proposed for random control, which randomly sets execution orders for concurrent operations. The AES chip was manufactured in SMIC 0.18 μm technology. The average energy for encrypting one group of plain texts (128 bits secrete keys) is 19 nJ. The core area is 0.43 mm 2 . A sophisticated experimental setup was built to test the DPA resistance. Measurement-based experimental results show that one byte of a secret key cannot be disclosed from our chip under random mode after 64000 power traces were used in the DPA attack. Compared with the corresponding fixed order execution, the hardware based random order execution is improved by at least 21 times the DPA resistance. (semiconductor integrated circuits)
An AES chip with DPA resistance using hardware-based random order execution
Bo, Yu; Xiangyu, Li; Cong, Chen; Yihe, Sun; Liji, Wu; Xiangmin, Zhang
2012-06-01
This paper presents an AES (advanced encryption standard) chip that combats differential power analysis (DPA) side-channel attack through hardware-based random order execution. Both decryption and encryption procedures of an AES are implemented on the chip. A fine-grained dataflow architecture is proposed, which dynamically exploits intrinsic byte-level independence in the algorithm. A novel circuit called an HMF (Hold-Match-Fetch) unit is proposed for random control, which randomly sets execution orders for concurrent operations. The AES chip was manufactured in SMIC 0.18 μm technology. The average energy for encrypting one group of plain texts (128 bits secrete keys) is 19 nJ. The core area is 0.43 mm2. A sophisticated experimental setup was built to test the DPA resistance. Measurement-based experimental results show that one byte of a secret key cannot be disclosed from our chip under random mode after 64000 power traces were used in the DPA attack. Compared with the corresponding fixed order execution, the hardware based random order execution is improved by at least 21 times the DPA resistance.
Infrared observations of AE Aquarii
Tanzi, E. G.; Chincarini, G.; Tarenghi, M.
1981-01-01
Broadband infrared observations of the cataclysmic variable AE Aquarii are reported. The observations were obtained in the J, H, K and L filters with the InSb photometer attached to the 1-m telescope of the European Southern Observatory. The infrared energy distribution observed from 0.35 to 3.5 microns for phase 0.5 suggests a spectral type of K5 V for the secondary and a distance to the system of approximately 70 pc if an absolute magnitude of 7.3 is assumed. Monitoring of the flux at 2.2 microns reveals a variability with an amplitude of approximately 0.3 magnitude over one third of the orbital period, the nature of which is under investigation.
2016-04-01
were built in-house at the SUNY Poly-technic Institute’s Center for Semiconductor Research ( CSR ); however, the initial devices for materials screening...A code that models the sweep-mode behavior of the bipolar ReRAM device that is initially in HRS. ............................................ 15...Standard (AES). AES is one of the most important encryption systems and is widely used in military and commercial systems. Based on an iterative
Decryption-decompression of AES protected ZIP files on GPUs
Duong, Tan Nhat; Pham, Phong Hong; Nguyen, Duc Huu; Nguyen, Thuy Thanh; Le, Hung Duc
2011-10-01
AES is a strong encryption system, so decryption-decompression of AES encrypted ZIP files requires very large computing power and techniques of reducing the password space. This makes implementations of techniques on common computing system not practical. In [1], we reduced the original very large password search space to a much smaller one which surely containing the correct password. Based on reduced set of passwords, in this paper, we parallel decryption, decompression and plain text recognition for encrypted ZIP files by using CUDA computing technology on graphics cards GeForce GTX295 of NVIDIA, to find out the correct password. The experimental results have shown that the speed of decrypting, decompressing, recognizing plain text and finding out the original password increases about from 45 to 180 times (depends on the number of GPUs) compared to sequential execution on the Intel Core 2 Quad Q8400 2.66 GHz. These results have demonstrated the potential applicability of GPUs in this cryptanalysis field.
Directory of Open Access Journals (Sweden)
Gabriel Lucian Radu
2010-12-01
Full Text Available A new modified glassy carbon electrode (GCE based on a synthesized N-(2-aminoethyl-4,4'-bipyridine (ABP was developed for the determination of Ag(I by differential pulse voltammetry (DPV. ABP was covalently immobilized on GC electrodes surface using 4-nitrobenzendiazonium (4-NBD and glutaraldehyde (GA. The Ag(I ions were preconcentrated by chemical interaction with bipyridine under a negative potential (−0.6 V; then the reduced ions were oxidized by differential pulse voltammetry and a peak was observed at 0.34 V. The calibration curve was linear in the concentration range from 0.05 μM to 1 μM Ag(I with a detection limit of 0.025 μM and RSD = 3.6%, for 0.4 μM Ag(I. The presence of several common ions in more than 125-fold excess had no effect on the determination of Ag(I. The developed sensor was applied to the determination of Ag(I in water samples using a standard addition method.
AE monitoring instrumentation for high performance superconducting dipoles and quadrupoles, Phase 2
Iwasa, Y.
1986-01-01
In the past year and a half, attention has been focused on the development of instrumentation for on-line monitoring of high-performance superconducting dipoles and quadrupoles. This instrumentation has been completed and satisfactorily demonstrated on a prototype Fermi dipole. Conductor motion is the principal source of acoustic emission (AE) and the major cause of quenches in the dipole, except during the virgin run when other sources are also present. The motion events are mostly microslips. The middle of the magnet is most susceptible to quenches. This result agrees with the peak field location in the magnet. In the virgin state the top and bottom of the magnet appeared acoustically similar but diverged after training, possibly due to minute structural asymmetry, for example differences in clamping and welding strength; however, the results do not indicate any major structural defects. There is good correlation between quench current and AE starting current. The correlation is reasonable if mechanical disturbances are indeed responsible for quench. Based on AE cumulative history, the average frictional power dissipation in the whole dipole winding is estimated to be approx. 10 (MU)W cm(-3). We expect to implement the following in the next phase of this project: Application of room-temperature techniques to detecting structural defects in the dipole; application of the system to other dipoles and quadrupoles in the same series to compare their performances; and further investigation of AE starting current approx. quench current relationship. Work has begun on the room temperature measurements. Preliminary Stress Wave Factor measurements have been made on a model dipole casing.
Design and implementation of an ASIP-based cryptography processor for AES, IDEA, and MD5
Directory of Open Access Journals (Sweden)
Karim Shahbazi
2017-08-01
Full Text Available In this paper, a new 32-bit ASIP-based crypto processor for AES, IDEA, and MD5 is designed. The instruction-set consists of both general purpose and specific instructions for the above cryptographic algorithms. The proposed architecture has nine function units and two data buses. It has also two types of 32-bit instruction formats for executing Memory Reference (M.R., Register Reference (R.R., and Input/Output Reference (I/O R. instructions. The maximum achieved frequency is 166.916 MHz. The encoded output results of the encryption process of a 128-bit input block are obtained after 122, 146 and 170 clock cycles for AES-128, AES-192, and AES-256, respectively. Moreover, it takes 95 clock cycles to encrypt or decrypt a 64-bit input block by using IDEA. Finally, the MD5 hash algorithm requires 469 clock cycles to generate the coded outputs for a block of 512 bits. The performance of the proposed processor is compared to some previous and state-of-the-art implementations in terms of speed, latency, throughput, and flexibility.
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
2012-11-29
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ER13-442-000] AES Beaver Valley, LLC; Supplemental Notice That Initial Market- Based Rate Filing Includes Request for Blanket Section 204 Authorization This is a supplemental notice in the above-referenced proceeding, of AES Beaver...
2010-11-18
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ER11-2036-000] AES Laurel Mountain, LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes Request for Blanket... proceeding of AES Laurel Mountain, LLC's application for market-based rate authority, with an accompanying...
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
Studies on the male sterility-fertility restoration system of AE. Kotschyi 19
International Nuclear Information System (INIS)
Cheng Junyuan; Sun Guoqing; Liu Luxiang; Zhao Linshu; Lu Xiuxia
1996-01-01
Sterile plants were obtained from the distant hybridization between Ae. Kotschyi 19 as the female parent and the Chinese Spring and T. yunnanense King as the male parent. Common wheat lines were used to testcross and backcross with the F 1 sterile plants successively. Male sterile line K-19 with Ae. Kotschyi cytoplasm and common wheat nucleus was bred. Over 10 K-19 MS lines were obtained. They are steady without monoploid. 7 restorers were obtained with the restoring ability from 88.2% to 96.9% according to the domestic method, from 116.4% to 150.4% according to the international method
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
KOMBINASI ALGORITMA AES, RC4 DAN ELGAMAL DALAM SKEMA HYBRID UNTUK KEAMANAN DATA
Directory of Open Access Journals (Sweden)
Adi Widarma
2016-01-01
Full Text Available Pengiriman atau pertukaran data adalah hal yang sering terjadi dalam dunia teknologi informasi. Data yang dikirim kadang sering berisi data informasi yang penting bahkan sangat rahasia dan harus dijaga keamanannya. Untuk menjaga keamanan data, dapat dilakukan dengan menggunakan teknik kriptografi. Algoritma AES dan RC4 adalah salah satu dari algoritma simetri. Kelemahan dari algoritma simetri adalah proses enkripsi dan dekripsi menggunakan kunci yang sama. Untuk mengatasi tersebut dilakukan dengan menggunakan algoritma Elgamal. Algoritma Elgamal adalah termasuk algoritma asimetri. Algoritma Elgamal digunakan untuk mengamankan kunci dari algoritma AES dan RC4. Peningkatan keamanan pesan dan kunci dilakukan dengan algoritma hybrid. Algoritma hybrid dengan mengkombinasikan beberapa algoritma baik algoritma simetri maupun algortima asimetri akan menambah keamanan sehingga menjadi lebih aman dan powerful (Jain & Agrawal 2014. Penelitian ini akan dilakukan metode hybrid yaitu mengkombinasikan beberapa algoritma kriptografi dengan menggunakan algoritma Advanced Encryption Standard (AES dan RC4 untuk kerahasiaan data serta algoritma Elgamal digunakan untuk enkripsi dan dekripsi kunci.
Energy Technology Data Exchange (ETDEWEB)
Tezuka, K [Japan Petroleum Exploration Corp., Tokyo (Japan); Niitsuma, H [Tohoku University, Sendai (Japan)
1997-05-27
With regard to a fracture system in the Hijiori hot dry rock artificial reservoir, an attempt was made on an interpretation which integrates different data. Major factors that characterize development and performance of an artificial reservoir are composed of a fracture system in rocks, which acts as circulating water paths, a heat exchange face and a reservoir space. The system relates not only with crack density distribution, but also with cracks activated by water pressure fracturing, cracks generating acoustic emission (AE), and cracks working as major flow paths, all of which are characterized by having respective behaviors and roles. Characteristics are shown on AE cluster distribution, crack distribution, production zone and estimated stress fields. Mutual relationship among these elements was discussed based on the Coulomb`s theory. The most important paths are characterized by distribution of slippery cracks. Directions and appearance frequencies of the slippery cracks affect strongly directionality of the paths, which are governed by distribution of the cracks (weak face) and stress field. Among the slippery cracks, cracks that generate AE are cracks that release large energy when a slip occurs. Evaluation on slippery crack distribution is important. 7 refs., 8 figs.
Almomani, Ensaf Y; Touret, Nicolas; Cordat, Emmanuelle
2018-04-13
Mutations in the gene encoding the kidney anion exchanger 1 (kAE1) can lead to distal renal tubular acidosis (dRTA). dRTA mutations reported within the carboxyl (C)-terminal tail of kAE1 result in apical mis-targeting of the exchanger in polarized renal epithelial cells. As kAE1 physically interacts with the μ subunit of epithelial adaptor protein 1 B (AP-1B), we investigated the role of heterologously expressed μ1B subunit of the AP-1B complex for kAE1 retention to the basolateral membrane in polarized porcine LLC-PK1 renal epithelial cells that are devoid of endogenous AP-1B. We confirmed the interaction and close proximity between kAE1 and μ1B using immunoprecipitation and proximity ligation assay, respectively. Expressing the human μ1B subunit in these cells decreased significantly the amount of cell surface kAE1 at the steady state, but had no significant effect on kAE1 recycling and endocytosis. We show that (i) heterologous expression of μ1B displaces the physical interaction of endogenous GAPDH with kAE1 WT supporting that both AP-1B and GAPDH proteins bind to an overlapping site on kAE1 and (ii) phosphorylation of tyrosine 904 within the potential YDEV interaction motif does not alter the kAE1/AP-1B interaction. We conclude that μ1B subunit is not involved in recycling of kAE1.
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
Suter, Tobias; Crespo, Mônica Maria; de Oliveira, Mariana Francelino; de Oliveira, Thaynan Sama Alves; de Melo-Santos, Maria Alice Varjal; de Oliveira, Cláudia Maria Fontes; Ayres, Constância Flávia Junqueira; Barbosa, Rosângela Maria Rodrigues; Araújo, Ana Paula; Regis, Lêda Narcisa; Flacio, Eleonora; Engeler, Lukas; Müller, Pie; Silva-Filha, Maria Helena Neves Lobo
2017-09-19
Aedes aegypti and Ae. albopictus are two highly invasive mosquito species, both vectors of several viruses, including dengue, chikungunya and Zika. While Ae. aegypti is the primary vector in the tropics and sub-tropics, Ae. albopictus is increasingly under the public health watch as it has been implicated in arbovirus-transmission in more temperate regions, including continental Europe. Vector control using insecticides is the pillar of most control programmes; hence development of insecticide resistance is of great concern. As part of a Brazilian-Swiss Joint Research Programme we set out to assess whether there are any signs of existing or incipient insecticide resistance primarily against the larvicide Bacillus thuringiensis svar. israelensis (Bti), but also against currently applied and potentially alternative insecticides in our areas, Recife (Brazil) and the Swiss-Italian border region. Following World Health Organization guidelines, dose-response curves for a range of insecticides were established for both colonized and field caught Ae. aegypti and Ae. albopictus. The larvicides included Bti, two of its toxins, Cry11Aa and Cry4Ba, Lysinibacillus sphaericus, Vectomax CG®, a formulated combination of Bti and L. sphaericus, and diflubenzuron. In addition to the larvicides, the Swiss-Italian Ae. albopictus populations were also tested against five adulticides (bendiocarb, dichlorodiphenyltrichloroethane, malathion, permethrin and λ-cyhalothrin). Showing a similar dose-response, all mosquito populations were fully susceptible to the larvicides tested and, in particular, to Bti which is currently used both in Brazil and Switzerland. In addition, there were no signs of incipient resistance against Bti as larvae were equally susceptible to the individual toxins, Cry11Aa and Cry4Ba. The field-caught Swiss-Italian populations were susceptible to the adulticides tested but DDT mortality rates showed signs of reduced susceptibility. The insecticides currently used for
Salameh, Ahlam I; Hübner, Christian A; Boron, Walter F
2017-01-01
A polymorphism of human AE3 is associated with idiopathic generalized epilepsy. Knockout of AE3 in mice lowers the threshold for triggering epileptic seizures. The explanations for these effects are elusive. Comparisons of cells from wild-type vs. AE3 -/- mice show that AE3 (present in hippocampal neurons, not astrocytes; mediates HCO 3 - efflux) enhances intracellular pH (pH i ) recovery (decrease) from alkali loads in neurons and, surprisingly, adjacent astrocytes. During metabolic acidosis (MAc), AE3 speeds initial acidification, but limits the extent of pH i decrease in neurons and astrocytes. AE3 speeds re-alkalization after removal of MAc in neurons and astrocytes, and speeds neuronal pH i recovery from an ammonium prepulse-induced acid load. We propose that neuronal AE3 indirectly increases acid extrusion in (a) neurons via Cl - loading, and (b) astrocytes by somehow enhancing NBCe1 (major acid extruder). The latter would enhance depolarization-induced alkalinization of astrocytes, and extracellular acidification, and thereby reduce susceptibility to epileptic seizures. The anion exchanger AE3, expressed in hippocampal (HC) neurons but not astrocytes, contributes to intracellular pH (pH i ) regulation by facilitating the exchange of extracellular Cl - for intracellular HCO 3 - . The human AE3 polymorphism A867D is associated with idiopathic generalized epilepsy. Moreover, AE3 knockout (AE3 -/- ) mice are more susceptible to epileptic seizure. The mechanism of these effects has been unclear because the starting pH i in AE3 -/- and wild-type neurons is indistinguishable. The purpose of the present study was to use AE3 -/- mice to investigate the role of AE3 in pH i homeostasis in HC neurons, co-cultured with astrocytes. We find that the presence of AE3 increases the acidification rate constant during pH i recovery from intracellular alkaline loads imposed by reducing [CO 2 ]. The presence of AE3 also speeds intracellular acidification during the early phase of
Zhou, Li
2018-01-01
This paper proposes an innovative method for identifying the locations of multiple simultaneous acoustic emission (AE) events in plate-like structures from the view of image processing. By using a linear lead zirconium titanate (PZT) sensor array to record the AE wave signals, a reverse-time frequency-wavenumber (f-k) migration is employed to produce images displaying the locations of AE sources by back-propagating the AE waves. Lamb wave theory is included in the f-k migration to consider the dispersive property of the AE waves. Since the exact occurrence time of the AE events is usually unknown when recording the AE wave signals, a heuristic artificial bee colony (ABC) algorithm combined with an optimal criterion using minimum Shannon entropy is used to find the image with the identified AE source locations and occurrence time that mostly approximate the actual ones. Experimental studies on an aluminum plate with AE events simulated by PZT actuators are performed to validate the applicability and effectiveness of the proposed optimal image-based AE source identification method. PMID:29466310
Yan, Gang; Zhou, Li
2018-02-21
This paper proposes an innovative method for identifying the locations of multiple simultaneous acoustic emission (AE) events in plate-like structures from the view of image processing. By using a linear lead zirconium titanate (PZT) sensor array to record the AE wave signals, a reverse-time frequency-wavenumber (f-k) migration is employed to produce images displaying the locations of AE sources by back-propagating the AE waves. Lamb wave theory is included in the f-k migration to consider the dispersive property of the AE waves. Since the exact occurrence time of the AE events is usually unknown when recording the AE wave signals, a heuristic artificial bee colony (ABC) algorithm combined with an optimal criterion using minimum Shannon entropy is used to find the image with the identified AE source locations and occurrence time that mostly approximate the actual ones. Experimental studies on an aluminum plate with AE events simulated by PZT actuators are performed to validate the applicability and effectiveness of the proposed optimal image-based AE source identification method.
Drug-resistant molecular mechanism of CRF01_AE HIV-1 protease due to V82F mutation
Liu, Xiaoqing; Xiu, Zhilong; Hao, Ce
2009-05-01
Human immunodeficiency virus type 1 protease (HIV-1 PR) is one of the major targets of anti-AIDS drug discovery. The circulating recombinant form 01 A/E (CRF01_AE, abbreviated AE) subtype is one of the most common HIV-1 subtypes, which is infecting more humans and is expanding rapidly throughout the world. It is, therefore, necessary to develop inhibitors against subtype AE HIV-1 PR. In this work, we have performed computer simulation of subtype AE HIV-1 PR with the drugs lopinavir (LPV) and nelfinavir (NFV), and examined the mechanism of resistance of the V82F mutation of this protease against LPV both structurally and energetically. The V82F mutation at the active site results in a conformational change of 79's loop region and displacement of LPV from its proper binding site, and these changes lead to rotation of the side-chains of residues D25 and I50'. Consequently, the conformation of the binding cavity is deformed asymmetrically and some interactions between PR and LPV are destroyed. Additionally, by comparing the interactive mechanisms of LPV and NFV with HIV-1 PR we discovered that the presence of a dodecahydroisoquinoline ring at the P1' subsite, a [2-(2,6-dimethylphenoxy)acetyl]amino group at the P2' subsite, and an N2 atom at the P2 subsite could improve the binding affinity of the drug with AE HIV-1 PR. These findings are helpful for promising drug design.
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
Chen, Ming-Chih; Hsiao, Shen-Fu
In this paper, we propose an area-efficient design of Advanced Encryption Standard (AES) processor by applying a new common-expression-elimination (CSE) method to the sub-functions of various transformations required in AES. The proposed method reduces the area cost of realizing the sub-functions by extracting the common factors in the bit-level XOR/AND-based sum-of-product expressions of these sub-functions using a new CSE algorithm. Cell-based implementation results show that the AES processor with our proposed CSE method has significant area improvement compared with previous designs.
AES/STEM grain boundary analysis of stabilized zirconia ceramics
Winnubst, Aloysius J.A.; Kroot, P.J.M.; Burggraaf, A.J.
1983-01-01
Semiquantitative Auger Electron Spectroscopy (AES) on pure monophasic (ZrO2)0.83(YO1.5)0.17 was used to determine the chemical composition of the grain boundaries. Grain boundary enrichment with Y was observed with an enrichment factor of about 1.5. The difference in activation energy of the ionic
Variations of thermospheric composition according to AE-C data and CTIP modelling
Directory of Open Access Journals (Sweden)
H. Rishbeth
2004-01-01
Full Text Available Data from the Atmospheric Explorer C satellite, taken at middle and low latitudes in 1975-1978, are used to study latitudinal and month-by-month variations of thermospheric composition. The parameter used is the "compositional Ρ-parameter", related to the neutral atomic oxygen/molecular nitrogen concentration ratio. The midlatitude data show strong winter maxima of the atomic/molecular ratio, which account for the "seasonal anomaly" of the ionospheric F2-layer. When the AE-C data are compared with the empirical MSIS model and the computational CTIP ionosphere-thermosphere model, broadly similar features are found, but the AE-C data give a more molecular thermosphere than do the models, especially CTIP. In particular, CTIP badly overestimates the winter/summer change of composition, more so in the south than in the north. The semiannual variations at the equator and in southern latitudes, shown by CTIP and MSIS, appear more weakly in the AE-C data. Magnetic activity produces a more molecular thermosphere at high latitudes, and at mid-latitudes in summer. Key words. Atmospheric composition and structure (thermosphere – composition and chemistry
Trigermanides AEGe{sub 3} (AE = Ca, Sr, Ba). Chemical bonding and superconductivity
Energy Technology Data Exchange (ETDEWEB)
Castillo, Rodrigo; Schnelle, Walter; Baranov, Alexey I.; Burkhardt, Ulrich; Bobnar, Matej; Cardoso-Gil, Raul; Schwarz, Ulrich; Grin, Yuri [Max-Planck-Institut fuer Chemische Physik Fester Stoffe, Dresden (Germany)
2016-08-01
The crystal structures of the trigermanides AEGe{sub 3}(tI32) (AE = Ca, Sr, Ba; space group I4/mmm, for SrGe{sub 3}: a = 7.7873(1), c = 12.0622(3) Aa) comprise Ge{sub 2} dumbbells forming layered Ge substructures which enclose embedded AE atoms. The chemical bonding analysis by application of the electron localizability approach reveals a substantial charge transfer from the AE atoms to the germanium substructure. The bonding within the dumbbells is of the covalent two-center type. A detailed analysis of SrGe{sub 3} reveals that the interaction on the bond-opposite side of the Ge{sub 2} groups is not lone pair-like - as it would be expected from the Zintl-like interpretation of the crystal structure with anionic Ge layers separated by alkaline-earth cations - but multi-center strongly polar between the Ge{sub 2} dumbbells and the adjacent metal atoms. Similar atomic interactions are present in CaGe{sub 3} and BaGe{sub 3}. The variation of the alkaline-earth metal has a merely insignificant influence on the superconducting transition temperatures in the s,p-electron compounds AEGe{sub 3}.
Variations of thermospheric composition according to AE-C data and CTIP modelling
Directory of Open Access Journals (Sweden)
H. Rishbeth
2004-01-01
Full Text Available Data from the Atmospheric Explorer C satellite, taken at middle and low latitudes in 1975-1978, are used to study latitudinal and month-by-month variations of thermospheric composition. The parameter used is the "compositional Ρ-parameter", related to the neutral atomic oxygen/molecular nitrogen concentration ratio. The midlatitude data show strong winter maxima of the atomic/molecular ratio, which account for the "seasonal anomaly" of the ionospheric F2-layer. When the AE-C data are compared with the empirical MSIS model and the computational CTIP ionosphere-thermosphere model, broadly similar features are found, but the AE-C data give a more molecular thermosphere than do the models, especially CTIP. In particular, CTIP badly overestimates the winter/summer change of composition, more so in the south than in the north. The semiannual variations at the equator and in southern latitudes, shown by CTIP and MSIS, appear more weakly in the AE-C data. Magnetic activity produces a more molecular thermosphere at high latitudes, and at mid-latitudes in summer.
Key words. Atmospheric composition and structure (thermosphere – composition and chemistry
AE analysis of delamination crack propagation in carbon fiber-reinforced polymer materials
Energy Technology Data Exchange (ETDEWEB)
Yoon, Sang Jae; Arakawa, Kazuo [Kyushu University, kasuga (Japan); Chen, Dingding [National University of Defense Technology, Changsha (China); Han, Seung Wook; Choi, Nak Sam [Hanyang University, Seoul (Korea, Republic of)
2015-01-15
Delamination fracture behavior was investigated using acoustic emission (AE) analysis on carbon fiber-reinforced polymer (CFRP) samples manufactured using vacuum-assisted resin transfer molding (VARTM). CFRP plate was fabricated using unidirectional carbon fiber fabric with a lay-up of six plies [+30/-30]6 , and a Teflon film was inserted as a starter crack. Test pieces were sectioned from the inlet and vent of the mold, and packed between two rectangular epoxy plates to load using a universal testing machine. The AE signals were monitored during tensile loading using two sensors. The average tensile load of the inlet specimens was slightly larger than that of the vent specimens; however, the data exhibited significant scattering due to non-uniform resin distribution, and there was no statistically significant different between the strength of the samples sectioned from the inlet or outlet of the mold. Each of the specimens exhibited similar AE characteristics, regardless of whether they were from the inlet or vent of the mold. Four kinds of damage mechanism were observed: micro-cracking, fiber-resin matrix debonding, fiber pull-out, and fiber failure; and three stages of the crack propagation process were identified.
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
Estimation of metal ions during the dissolution of corrosion product oxides by ICP-AES
International Nuclear Information System (INIS)
Sathyaseelan, V.S.; Mittal, Vinit Kumar; Velmurugan, S.
2012-01-01
Inductively coupled plasma atomic emission spectroscopy (ICP-AES) is one of the several techniques, which is being widely used for both qualitative and quantitative estimation of various elements. Determination of metals in wine, arsenic in food, trace elements in soil, nutrient levels in agricultural soils, trace elements bound to protein, motor oil analysis etc. are the examples of its application. ICP-AES utilizes plasma as the atomization and excitation source. The plasma temperature in the analytical zone ranges from 5000-8000 K. This high temperature assures that most of the compounds in the samples are completely atomized. Advantages of ICP-AES are high sensitivity and linear dynamic range, multi-element capability, low chemical interference and a stable and reproducible signal. The typical limits of detection for some of the elements like Mg, Sr, Ca, Li, Cu etc are well below 1 μg L -1
AE monitoring simplified using digital memory storage and source isolation
International Nuclear Information System (INIS)
Hutton, P.H.; Skorpik, J.R.
1977-01-01
The general trend in acoustic emission (AE) monitoring systems has been one of increasing complexity. This is particularly true in systems for continuous monitoring which are usually multichannel (perhaps 20 to 40) and incorporate a dedicated minicomputer. A unique concept which reverses this trend for selected applications has been developed at Battelle-Northwest, Richland, WA. This concept uses solid state digital memories to store acquired data in a permanent form which is easily retrieved. It also uses a fundamental method to accept AE data only from a selected area. The digital memory system is designed for short term or long term (months) monitoring. It has been successfully applied in laboratory testing such as fatigue crack growth studies, as well as field monitoring on bridges and piping to detect crack growth. The features of simplicity, versatility, and low cost contribute to expanded practical application of acoustic emission technology
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
Simultaneous multielement analysis of zirconium alloys by chlorination separation of matrix/ICP-AES
International Nuclear Information System (INIS)
Kato, Kaneharu
1990-01-01
An analytical method combined chlorination separation of matrix with ICP-AES has been developed for reactor grade Zr alloys (Zircaloy-2). A sample (1 g) is taken into a Pt boat and chlorinated with HCl gas of 100 ml/min in a glass reaction tube at ca. 330degC. Matrix Zr of the sample is volatilized and separated as ZrCl 4 . The analytic elements remaining quantitatively as chlorination residue are dissolved in a mixture of mineral acids (6 M HCl 3 ml+conc. HNO 3 0.5 ml+conc. H 2 SO 4 0.2 ml) and diluted to 20 ml with distilled water after filtration. ICP-AES was used for simultaneous multielement determination using a calibration curve method. The present method has the following advantages: simple sample preparation procedure; applicability to any form of samples to determine multielements; simple ICP-AES calibration procedure. This method was successfully applied to the determination of Fe, Ni, Cu, Co, Mn and Pb in the Zr alloys of JAERI CRM's and NBS SRM's. (author)
Key features of MIR.1200 (AES-2006) design and current stage of Leningrad NPP-2 construction
International Nuclear Information System (INIS)
Ivkov, Igor
2010-01-01
MIR.1200/AES-2006 is an abbreviated name of the evolving NPP design developed on the basis of the VVER-1000 Russian design with gross operation life of 480 reactor-years. This design is being implemented in four Units of Leningrad NPP-2 (LNPP-2. The AES-91/99 was used as reference during development of the AES-2006 design for LNPP-2; this design was implemented in two Units of Tianwan NPP (China). The main technical features of the MIR.1200/AES-2006 design include a double containment, four trains of active safety systems (4x100%, 4x50%), and special engineering measures for BDBA management (core catcher, H2 PARs, PHRS) based mainly on passive principles. The containment is described in detail, the main features in comparison with the reference NPP are outlined, the design layout principles are highlighted, the safety system structure and parameters are described. Attention is paid to the BDBA management system, hydrogen removal system, core catcher, and PHRS-SG and C-PHRS. (P.A.)
Directory of Open Access Journals (Sweden)
Renato Turchet
2006-06-01
Full Text Available O objetivo deste trabalho é a caracterização do AES, um copolímero de enxertia de poli(estireno-co-acrilonitrila, SAN, em poli(etileno-co-propileno-co-dieno, EPDM. Para tanto, o AES foi submetido à extração seletiva de seus componentes: o SAN livre, o EDPM livre, e o copolímero de enxertia EPDM-g-SAN. O AES e suas frações foram caracterizados por espectroscopia de infravermelho, análise elementar, calorimetria diferencial de varredura e ressonância magnética nuclear, RMN¹H e RMN13C. O AES analisado apresenta a seguinte composição em massa: 65% de EPDM-g-SAN, 13% de EPDM livre e 22% de SAN livre. O EPDM apresenta 69,8% em massa de etileno, 26,5% em massa de propileno e 4,6% em massa do dieno, 2-etilideno-5-norboneno, ENB. O SAN apresenta razão em massa acrilonitrila/estireno de 28/72 e distribuição randômica de comonômeros de estireno e acrilonitrila. Estes resultados são concordantes com a composição do AES fornecida pelo fabricante, indicando que a metodologia proposta é adequada.This work aims the characterization of AES, a graft copolymer based on poly(styrene-co-acrylonitrile, SAN, and poly(etyhlene-co-propylene-co-diene, EPDM. AES was submitted to selective extraction of its components: free SAN, EPDM chains and the graft copolymer EPDM-g-SAN. AES and its fractions were characterized by infrared spectroscopy, elemental analysis, differential scanning calorimetry, 13C and ¹H nuclear magnetic resonance. The AES has 65 wt % of EPDM-g-SAN, 13 wt % of free EPDM and 22 wt % of free SAN. EPDM has 69.8 wt % of ethylene, 26.5 wt % of propylene and 4.6 wt % of diene, 2-ethylidene-5-norbonene ENB. SAN presents acrylonitrile/styrene mass ratio of 28/72 and a random distribution of acrylonitrile and styrene comonomers. These results are in agreement with the composition reported by the AES supplier, indicating that the proposed methodology is adequate.
Harmonization in preclinical epilepsy research: A joint AES/ILAE translational initiative.
Galanopoulou, Aristea S; French, Jacqueline A; O'Brien, Terence; Simonato, Michele
2017-11-01
Among the priority next steps outlined during the first translational epilepsy research workshop in London, United Kingdom (2012), jointly organized by the American Epilepsy Society (AES) and the International League Against Epilepsy (ILAE), are the harmonization of research practices used in preclinical studies and the development of infrastructure that facilitates multicenter preclinical studies. The AES/ILAE Translational Task Force of the ILAE has been pursuing initiatives that advance these goals. In this supplement, we present the first reports of the working groups of the Task Force that aim to improve practices of performing rodent video-electroencephalography (vEEG) studies in experimental controls, generate systematic reviews of preclinical research data, and develop preclinical common data elements (CDEs) for epilepsy research in animals. Wiley Periodicals, Inc. © 2017 International League Against Epilepsy.
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
Karaağaç, Dursun; Kürkçüoğlu, Güneş Süheyla; Şenyel, Mustafa; Hökelek, Tuncer
2017-02-01
Three new cadmium(II)-metal(II) cyanide complexes, [Cd(4aepy)2(H2O)2][Ni(CN)4] (1), [Cd(4aepy)2(H2O)2][Pd(CN)4] (2) and [Cd(4aepy)2(H2O)2][Pt(CN)4] (3) [4aepy = 4-(2-aminoethyl)pyridine], have been synthesized and characterized by elemental, thermal, FT-IR and Raman spectral analyses. The crystal structures of 1 and 2 have been determined by single crystal X-ray diffraction technique, in which they crystallize in the monoclinic system and C2/c space group. The M(II) [M(II) = Ni(II), Pd(II) and Pt(II)] ions are coordinated with the carbon atoms of the four cyanide groups in the square planar geometries and the [M(CN)4]2- ions act as counter ions. The Cd(II) ions display an N4O2 coordination sphere with a distorted octahedral geometry, the nitrogen donors belonging to four molecules of the organic 4aepy that act as unidentate ligands and two oxygen atoms from aqua ligands. 3D supramolecular structures of 1 and 2 were occurred by M⋯π and hydrogen bonding (Nsbnd H⋯N and Osbnd H⋯N) interactions. Vibrational assignments of all the observed bands were given and the spectral properties were also supported the crystal structures of the complexes. A possible decompositions of the complexes were investigated in the temperature range 30-800 °C in the static atmosphere.
ICP-AES determination of trace elements in carbon steel
International Nuclear Information System (INIS)
Sengupta, Arijit; Rajeswari, B.; Kadam, R.M.; Babu, Y.; Godbole, S.V.
2010-01-01
Full text: Carbon steel, a combination of the elements iron and carbon, can be classified into four types as mild, medium, high and very high depending on the carbon content which varies from 0.05% to 2.1%. Carbon steel of different types finds application in medical devices, razor blades, cutlery and spring. In the nuclear industry, it is used in feeder pipes in the reactor. A strict quality control measure is required to monitor the trace elements, which have deleterious effects on the mechanical properties of the carbon steel. Thus, it becomes imperative to check the purity of carbon steel as a quality control measure before it is used in feeder pipes in the reactor. Several methods have been reported in literature for trace elemental determination in high purity iron. Some of these include neutron activation analysis, atomic absorption spectrometry and atomic emission spectrometry. Inductively coupled plasma atomic emission spectrometry (ICP-AES) is widely recognized as a sensitive technique for the determination of trace elements in various matrices, its major advantages being good accuracy and precision, high sensitivity, multi-element capability, large linear dynamic range and relative freedom from matrix effects. The present study mainly deals with the direct determination of trace elements in carbon steel using ICP-AES. An axially viewing ICP spectrometer having a polychromator with 35 fixed analytical channels and limited sequential facility to select any analytical line within 2.2 nm of a polychromator line was used in these studies. Iron, which forms one of the main constituents of carbon steel, has a multi electronic configuration with line rich emission spectrum and, therefore, tends to interfere in the determination of trace impurities in carbon steel matrix. Spectral interference in ICP-AES can be seriously detrimental to the accuracy and reliability of trace element determinations, particularly when they are performed in the presence of high
Complementary AES and AEM of grain boundary regions in irradiated γ'-strengthened alloys
International Nuclear Information System (INIS)
Farrell, K.; Kishimoto, N.; Clausing, R.E.; Heatherly, L.; Lehman, G.L.
1986-01-01
Two microchemical analysis techniques are used to measure solute segregation at grain boundaries in two γ'-strengthened, fcc Fe-Ni-Cr alloys that display radiation-induced intergranular fracture. Scanning Auger electron spectroscopy (AES) of grain boundary fracture surfaces and analytical electron microscopy (AEM) of intact grain boundaries using energy-dispersive x-ray spectroscopy show good agreement on the nature and extent of segregation. The elements Ni, Si, Ti, and Mo are found to accumulate in G, Laves and γ' phases on the grain boundaries. Segregation of P is detected by AES. The complementary features of the two analytical techniques are discussed briefly
Faraldo-Gómez, José D.
2017-01-01
The membrane transporter anion exchanger 1 (AE1), or band 3, is a key component in the processes of carbon-dioxide transport in the blood and urinary acidification in the renal collecting duct. In both erythrocytes and the basolateral membrane of the collecting-duct α-intercalated cells, the role of AE1 is to catalyze a one-for-one exchange of chloride for bicarbonate. After decades of biochemical and functional studies, the structure of the transmembrane region of AE1, which catalyzes the anion-exchange reaction, has finally been determined. Each protomer of the AE1 dimer comprises two repeats with inverted transmembrane topologies, but the structures of these repeats differ. This asymmetry causes the putative substrate-binding site to be exposed only to the extracellular space, consistent with the expectation that anion exchange occurs via an alternating-access mechanism. Here, we hypothesize that the unknown, inward-facing conformation results from inversion of this asymmetry, and we propose a model of this state constructed using repeat-swap homology modeling. By comparing this inward-facing model with the outward-facing experimental structure, we predict that the mechanism of AE1 involves an elevator-like motion of the substrate-binding domain relative to the nearly stationary dimerization domain and to the membrane plane. This hypothesis is in qualitative agreement with a wide range of biochemical and functional data, which we review in detail, and suggests new avenues of experimentation. PMID:29167180
Ficici, Emel; Faraldo-Gómez, José D; Jennings, Michael L; Forrest, Lucy R
2017-12-04
The membrane transporter anion exchanger 1 (AE1), or band 3, is a key component in the processes of carbon-dioxide transport in the blood and urinary acidification in the renal collecting duct. In both erythrocytes and the basolateral membrane of the collecting-duct α-intercalated cells, the role of AE1 is to catalyze a one-for-one exchange of chloride for bicarbonate. After decades of biochemical and functional studies, the structure of the transmembrane region of AE1, which catalyzes the anion-exchange reaction, has finally been determined. Each protomer of the AE1 dimer comprises two repeats with inverted transmembrane topologies, but the structures of these repeats differ. This asymmetry causes the putative substrate-binding site to be exposed only to the extracellular space, consistent with the expectation that anion exchange occurs via an alternating-access mechanism. Here, we hypothesize that the unknown, inward-facing conformation results from inversion of this asymmetry, and we propose a model of this state constructed using repeat-swap homology modeling. By comparing this inward-facing model with the outward-facing experimental structure, we predict that the mechanism of AE1 involves an elevator-like motion of the substrate-binding domain relative to the nearly stationary dimerization domain and to the membrane plane. This hypothesis is in qualitative agreement with a wide range of biochemical and functional data, which we review in detail, and suggests new avenues of experimentation. © 2017 Ficici et al.
Potential topical natural repellent against Ae. aegypti, Culex sp. and Anopheles sp. mosquitoes
Directory of Open Access Journals (Sweden)
Dewi Nur Hodijah
2014-08-01
Full Text Available AbstrakLatar belakang:Minyak atsiri daun sirih diketahui mempunyai daya proteksi. Dibuatkan losion berdasarkan pengantar sediaan farmasi yang ditambahkan minyak atsiri daun nilam. Sediaan losion dipilih agar dapat menempel lebih lama di permukaan kulit. Tujuan penelitian ini untuk membandingkan daya proteksi antara losion dengan penambahan minyak nilam dan losion tanpa penambahan minyak nilam dibandingkan daya proteksi dengan DEET. Metode: Penelitian ini merupakan penelitian eksperimental laboratorium. Semua nyamuk uji berasal dari insektarium laboratorium penelitian kesehatan Loka litbang P2B2 Ciamis. Konsentrasi minyak atsiri daun sirih dalam losion adalah 4%; konsentrasi minyak nilam sebagai zat pengikat adalah 0,4%. Formula yang digunakan yaitu formula dasar yang ada pada pengantar sediaan farmasi. Uji repelensi dilakukan dengan menggunakan metoda yang direkomendasikan oleh Komisi pestisida.Hasil: Dihasilkan formulasi losion yang stabil dan masih memenuhi standar formulasi sediaan. Berdasarkan hasil, diperoleh data bahwa DEET dan losion hasil modifikasi memiliki rata-rata daya proteksi di atas 90% selama 6 jam terhadap nyamuk Ae.aegypti dan Culex sp. Kesimpulan: Penambahan minyak nilam pada losion sirih dapat meningkatkan daya proteksi terhadap hinggapan nyamuk Ae. aegypti dan Culex sp. (Health Science Indones 2014;1:44-8Kata kunci:repelen alamiah, minyak atsiri, daun sirih, daun nilam, Ae. aegypti, Culex sp.AbstractBackground: Betel leaf essential oil lotion has been known to have insect repellent properties. A lotion was made based on a pharmaceutical formula from a monograph where patchouli leaf essential oil was added. A lotion preparation was intended to enhance adherence of the formula on the surface of the skin. The purpose of this study was to compare protection percentage of lotion with patchouli oil and without patchouli oil lotion compared to DEET.Methods: This study is an experimental laboratory-based research. All mosquitoes
Directory of Open Access Journals (Sweden)
Tuffery Pierre
2009-12-01
Full Text Available Abstract Background Previous studies have established a correlation between electrophoretic polymorphism of esterase B, and virulence and phylogeny of Escherichia coli. Strains belonging to the phylogenetic group B2 are more frequently implicated in extraintestinal infections and include esterase B2 variants, whereas phylogenetic groups A, B1 and D contain less virulent strains and include esterase B1 variants. We investigated esterase B as a marker of phylogeny and/or virulence, in a thorough analysis of the esterase B-encoding gene. Results We identified the gene encoding esterase B as the acetyl-esterase gene (aes using gene disruption. The analysis of aes nucleotide sequences in a panel of 78 reference strains, including the E. coli reference (ECOR strains, demonstrated that the gene is under purifying selection. The phylogenetic tree reconstructed from aes sequences showed a strong correlation with the species phylogenetic history, based on multi-locus sequence typing using six housekeeping genes. The unambiguous distinction between variants B1 and B2 by electrophoresis was consistent with Aes amino-acid sequence analysis and protein modelling, which showed that substituted amino acids in the two esterase B variants occurred mostly at different sites on the protein surface. Studies in an experimental mouse model of septicaemia using mutant strains did not reveal a direct link between aes and extraintestinal virulence. Moreover, we did not find any genes in the chromosomal region of aes to be associated with virulence. Conclusion Our findings suggest that aes does not play a direct role in the virulence of E. coli extraintestinal infection. However, this gene acts as a powerful marker of phylogeny, illustrating the extensive divergence of B2 phylogenetic group strains from the rest of the species.
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
Shot peening influence on corrosion resistance of AE21 magnesium alloy.
2010-12-15
"Evaluation of the electrochemical characteristics of the AE21 magnesium alloy is presented in the article. : The surfaces of tested alloys were treated by grinding and grinding followed by sodium bicarbonate shotpeening. : The specimens were evaluat...
Everyone is working together to ease the pressures in A&E.
Kimber, Mark
2015-01-27
Nurse consultant Janet Youd, chair of the RCN Emergency Care Association, says nurses struggling to cope with unprecedented pressures in A&E departments should be awarded an extra half day's annual leave (Online News January 8).
The spectrum and variability of radio emission from AE Aquarii
Abada-Simon, Meil; Lecacheux, Alain; Bastian, Tim S.; Bookbinder, Jay A.; Dulk, George A.
1993-01-01
The first detections of the magnetic cataclysmic variable AE Aquarii at millimeter wavelengths are reported. AE Aqr was detected at wavelengths of 3.4 and 1.25 mm. These data are used to show that the time-averaged spectrum is generally well fitted by a power law S(nu) varies as nu exp alpha, where alpha is approximately equal to 0.35-0.60, and that the power law extends to millimeter wavelengths, i.e., the spectral turnover is at a frequency higher than 240 GHz. It is suggested that the spectrum is consistent with that expected from a superposition of flarelike events where the frequency distribution of the initial flux density is a power law f (S0) varies as S0 exp -epsilon, with index epsilon approximately equal to 1.8. Within the context of this model, the high turnover frequency of the radio spectrum implies magnetic field strengths in excess of 250 G in the source.
Energy Technology Data Exchange (ETDEWEB)
Ito, H; Kuwahara, Y; Nishizawa, O [Geological Survey of Japan, Tsukuba (Japan); Yamamoto, K [Tohoku University, Sendai (Japan). Faculty of Science; Sano, O [Yamaguchi University, Yamaguchi (Japan). Faculty of Engineering; Yokoyama, T; Kudo, R [OYO Corp., Tokyo (Japan); Xue, Z [Kiso-Jiban Consultants Co. Ltd., Tokyo (Japan)
1996-05-01
A total of 5 wells were excavated in the Hanshin-Awaji area (Ikeda, Takarazuka, Tarumi, Hirabayashi and Ikunami) to collect the core samples, which were analyzed by the AE/DR and DSCA methods to determine crustal stresses. For the AE/DR analysis, the core sample was cut in the vertical direction, and in the horizontal direction at intervals of 45{degree}. The sample of unknown orientation was provided with a datum line common for both methods, to compare the results by these methods. A load was applied to the sample, provided with an AE sensor and strain gauge on the sides, in the longitudinal direction. For the DSCA analysis, the core sample was cut into a cube having a side length of 33mm, with a pair of planes directed in parallel to the datum line. A total of 18 strain gauges, 10mm in gauge length, were attached to the cube. The AE/DR analysis gave the maximum and minimum principal stresses in the horizontal plane and stresses in the vertical direction, whereas the DSCA the maximum, intermediate and minimum principal stresses. 3 refs., 7 figs.
Hello Darkness My Old Friend: The Fading of the Nearby TDE ASASSN-14ae
Brown, Jonathan S.; Shappee, Benjamin J.; Holoien, T. W. -S; Stanek, K. Z.; Kochanek, C. S.; Prieto, J. L.
2016-01-01
We present late-time optical spectroscopy taken with the Large Binocular Telescope's Multi-Object Double Spectrograph, an improved ASAS-SN pre-discovery non-detection, and late-time SWIFT observations of the nearby ($d=193$ Mpc, $z=0.0436$) tidal disruption event (TDE) ASASSN-14ae. Our observations span from $\\sim$20 days before to $\\sim$750 days after discovery. The proximity of ASASSN-14ae allows us to study the optical evolution of the flare and the transition to a host dominated state wit...
Dicty_cDB: Contig-U14348-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 71_1( FJ787371 |pid:none) Nicotiana repanda protein kinase-c... 94 3e-18 AC124968_9( AC124968 |pid:none) Med... 5e-17 FJ787374_1( FJ787374 |pid:none) Nicotiana repanda protein kinase-c... 90 5e-17 AE014298_1862( AE01429...08048_1( AY708048 |pid:none) Zea mays salt-inducible putative p... 90 5e-17 FJ787369_1( FJ787369 |pid:none) Nicotiana repanda
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
Dosimetry of 64Cu-DOTA-AE105, a PET tracer for uPAR imaging
International Nuclear Information System (INIS)
Persson, Morten; El Ali, Henrik H.; Binderup, Tina; Pfeifer, Andreas; Madsen, Jacob; Rasmussen, Palle; Kjaer, Andreas
2014-01-01
64 Cu-DOTA-AE105 is a novel positron emission tomography (PET) tracer specific to the human urokinase-type plasminogen activator receptor (uPAR). In preparation of using this tracer in humans, as a new promising method to distinguish between indolent and aggressive cancers, we have performed PET studies in mice to evaluate the in vivo biodistribution and estimate human dosimetry of 64 Cu-DOTA-AE105. Methods: Five mice received iv tail injection of 64 Cu-DOTA-AE105 and were PET/CT scanned 1, 4.5 and 22 h post injection. Volume-of-interest (VOI) were manually drawn on the following organs: heart, lung, liver, kidney, spleen, intestine, muscle, bone and bladder. The activity concentrations in the mentioned organs [%ID/g] were used for the dosimetry calculation. The %ID/g of each organ at 1, 4.5 and 22 h was scaled to human value based on a difference between organ and body weights. The scaled values were then exported to OLINDA software for computation of the human absorbed doses. The residence times as well as effective dose equivalent for male and female could be obtained for each organ. To validate this approach, of human projection using mouse data, five mice received iv tail injection of another 64 Cu-DOTA peptide-based tracer, 64 Cu-DOTA-TATE, and underwent same procedure as just described. The human dosimetry estimates were then compared with observed human dosimetry estimate recently found in a first-in-man study using 64 Cu-DOTA-TATE. Results: Human estimates of 64 Cu-DOTA-AE105 revealed the heart wall to receive the highest dose (0.0918 mSv/MBq) followed by the liver (0.0815 mSv/MBq), All other organs/tissue were estimated to receive doses in the range of 0.02–0.04 mSv/MBq. The mean effective whole-body dose of 64 Cu-DOTA-AE105 was estimated to be 0.0317 mSv/MBq. Relatively good correlation between human predicted and observed dosimetry estimates for 64 Cu-DOTA-TATE was found. Importantly, the effective whole body dose was predicted with very high
Dosimetry of 64Cu-DOTA-AE105, a PET tracer for uPAR imaging.
Persson, Morten; El Ali, Henrik H; Binderup, Tina; Pfeifer, Andreas; Madsen, Jacob; Rasmussen, Palle; Kjaer, Andreas
2014-03-01
(64)Cu-DOTA-AE105 is a novel positron emission tomography (PET) tracer specific to the human urokinase-type plasminogen activator receptor (uPAR). In preparation of using this tracer in humans, as a new promising method to distinguish between indolent and aggressive cancers, we have performed PET studies in mice to evaluate the in vivo biodistribution and estimate human dosimetry of (64)Cu-DOTA-AE105. Five mice received iv tail injection of (64)Cu-DOTA-AE105 and were PET/CT scanned 1, 4.5 and 22 h post injection. Volume-of-interest (VOI) were manually drawn on the following organs: heart, lung, liver, kidney, spleen, intestine, muscle, bone and bladder. The activity concentrations in the mentioned organs [%ID/g] were used for the dosimetry calculation. The %ID/g of each organ at 1, 4.5 and 22 h was scaled to human value based on a difference between organ and body weights. The scaled values were then exported to OLINDA software for computation of the human absorbed doses. The residence times as well as effective dose equivalent for male and female could be obtained for each organ. To validate this approach, of human projection using mouse data, five mice received iv tail injection of another (64)Cu-DOTA peptide-based tracer, (64)Cu-DOTA-TATE, and underwent same procedure as just described. The human dosimetry estimates were then compared with observed human dosimetry estimate recently found in a first-in-man study using (64)Cu-DOTA-TATE. Human estimates of (64)Cu-DOTA-AE105 revealed the heart wall to receive the highest dose (0.0918 mSv/MBq) followed by the liver (0.0815 mSv/MBq), All other organs/tissue were estimated to receive doses in the range of 0.02-0.04 mSv/MBq. The mean effective whole-body dose of (64)Cu-DOTA-AE105 was estimated to be 0.0317 mSv/MBq. Relatively good correlation between human predicted and observed dosimetry estimates for (64)Cu-DOTA-TATE was found. Importantly, the effective whole body dose was predicted with very high precision
Salameh, Ahlam I.; Hübner, Christian A.
2016-01-01
Key points A polymorphism of human AE3 is associated with idiopathic generalized epilepsy. Knockout of AE3 in mice lowers the threshold for triggering epileptic seizures. The explanations for these effects are elusive.Comparisons of cells from wild‐type vs. AE3–/– mice show that AE3 (present in hippocampal neurons, not astrocytes; mediates HCO3 – efflux) enhances intracellular pH (pHi) recovery (decrease) from alkali loads in neurons and, surprisingly, adjacent astrocytes.During metabolic acidosis (MAc), AE3 speeds initial acidification, but limits the extent of pHi decrease in neurons and astrocytes.AE3 speeds re‐alkalization after removal of MAc in neurons and astrocytes, and speeds neuronal pHi recovery from an ammonium prepulse‐induced acid load.We propose that neuronal AE3 indirectly increases acid extrusion in (a) neurons via Cl– loading, and (b) astrocytes by somehow enhancing NBCe1 (major acid extruder). The latter would enhance depolarization‐induced alkalinization of astrocytes, and extracellular acidification, and thereby reduce susceptibility to epileptic seizures. Abstract The anion exchanger AE3, expressed in hippocampal (HC) neurons but not astrocytes, contributes to intracellular pH (pHi) regulation by facilitating the exchange of extracellular Cl– for intracellular HCO3 –. The human AE3 polymorphism A867D is associated with idiopathic generalized epilepsy. Moreover, AE3 knockout (AE3–/–) mice are more susceptible to epileptic seizure. The mechanism of these effects has been unclear because the starting pHi in AE3–/– and wild‐type neurons is indistinguishable. The purpose of the present study was to use AE3–/– mice to investigate the role of AE3 in pHi homeostasis in HC neurons, co‐cultured with astrocytes. We find that the presence of AE3 increases the acidification rate constant during pHi recovery from intracellular alkaline loads imposed by reducing [CO2]. The presence of AE3 also speeds intracellular
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
Little, Eliza; Bajwa, Waheed; Shaman, Jeffrey
2017-08-01
Ae. albopictus, an invasive mosquito vector now endemic to much of the northeastern US, is a significant public health threat both as a nuisance biter and vector of disease (e.g. chikungunya virus). Here, we aim to quantify the relationships between local environmental and meteorological conditions and the abundance of Ae. albopictus mosquitoes in New York City. Using statistical modeling, we create a fine-scale spatially explicit risk map of Ae. albopictus abundance and validate the accuracy of spatiotemporal model predictions using observational data from 2016. We find that the spatial variability of annual Ae. albopictus abundance is greater than its temporal variability in New York City but that both local environmental and meteorological conditions are associated with Ae. albopictus numbers. Specifically, key land use characteristics, including open spaces, residential areas, and vacant lots, and spring and early summer meteorological conditions are associated with annual Ae. albopictus abundance. In addition, we investigate the distribution of imported chikungunya cases during 2014 and use these data to delineate areas with the highest rates of arboviral importation. We show that the spatial distribution of imported arboviral cases has been mostly discordant with mosquito production and thus, to date, has provided a check on local arboviral transmission in New York City. We do, however, find concordant areas where high Ae. albopictus abundance and chikungunya importation co-occur. Public health and vector control officials should prioritize control efforts to these areas and thus more cost effectively reduce the risk of local arboviral transmission. The methods applied here can be used to monitor and identify areas of risk for other imported vector-borne diseases.
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
Multilevel Analysis of Continuous AE from Helicopter Gearbox
Czech Academy of Sciences Publication Activity Database
Chlada, Milan; Převorovský, Zdeněk; Heřmánek, Jan; Krofta, Josef
2014-01-01
Roč. 19, č. 12 (2014) ISSN 1435-4934. [European Conference on Non-Destructive Testing (ECNDT 2014) /11./. Praha, 06.10.2014-10.10.2014] R&D Projects: GA MPO FR-TI3/755 Institutional support: RVO:61388998 Keywords : structural health monitoring (SHM) * signal processing * acoustic emission (AE) * diagnostics of helicopter gearbox * wavelet analysis * continuous acoustic emission Subject RIV: JU - Aeronautics, Aerodynamics, Aircrafts http://www.ndt.net/events/ECNDT2014/app/content/Paper/630_Chlada_Rev1.pdf
Spectroscopic classification of AT2018aes as a supernova impostor
Andrews, Jennifer; Smith, Nathan; Van Dyk, Schuyler D.
2018-03-01
A visual-wavelength optical spectrum of AT2018aes obtained on UT 2018 Mar 13 (JD 2458190.84) with the Magellan Clay telescope (+ LDSS3 spectrograph, VPH-all grism) reveals a narrow H-alpha emission line with a velocity of 525 km/s, with wings extending to roughly +/-1000 km/s.
Einstein X-ray observations of Herbig Ae/Be stars
Damiani, F.; Micela, G.; Sciortino, S.; Harnden, F. R., Jr.
1994-01-01
We have investigated the X-ray emission from Herbig Ae/Be stars, using the full set of Einstein Imaging Proportional Counter (IPC) observations. Of a total of 31 observed Herbig stars, 11 are confidently identified with X-ray sources, with four additonal dubious identifications. We have used maximum likelihood luminosity functions to study the distribution of X-ray luminosity, and we find that Be stars are significantly brighter in X-rays than Ae stars and that their X-ray luminosity is independent of projected rotational velocity v sin i. The X-ray emission is instead correlated with stellar bolometric luminosity and with effective temperature, and also with the kinetic luminosity of the stellar wind. These results seem to exclude a solar-like origin for the X-ray emission, a possibility suggested by the most recent models of Herbig stars' structure, and suggest an analogy with the X-ray emission of O (and early B) stars. We also observe correlations between X-ray luminosity and the emission at 2.2 microns (K band) and 25 microns, which strengthen the case for X-ray emission of Herbig stars originating in their circumstellar envelopes.
A intera??o tutor-alunos em EAD: protagonistas de a??es de leitura e escrita
Soares, Inaldo Firmino
2010-01-01
Sob os alicerces da Lingu?stica Aplicada, que vem focalizando as atividades linguageiras a partir de diferentes enfoques te?ricos, este trabalho resulta de uma pesquisa sobre as a??es de linguagem nas intera??es realizadas por alunos e tutores de um curso de Especializa??o em Ensino a Dist?ncia, a partir da plataforma Moodle, e os reflexos dessas a??es no desenvolvimento e aprimoramento da linguagem verbal desses sujeitos. O tema foi abordado ? luz do Interacionismo Sociodis...
On using peak amplitude and rise time for AE source characterization
Indian Academy of Sciences (India)
R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22
The major objective of signal analysis is to study the characteristics of the sources of emissions. ... When AE is used as a non-destructive evaluation tool, this information is extracted using a .... Hence, frequency response H (f ) of the transducer.
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
New Secure E-mail System Based on Bio-Chaos Key Generation and Modified AES Algorithm
Hoomod, Haider K.; Radi, A. M.
2018-05-01
The E-mail messages exchanged between sender’s Mailbox and recipient’s Mailbox over the open systems and insecure Networks. These messages may be vulnerable to eavesdropping and itself poses a real threat to the privacy and data integrity from unauthorized persons. The E-mail Security includes the following properties (Confidentiality, Authentication, Message integrity). We need a safe encryption algorithm to encrypt Email messages such as the algorithm Advanced Encryption Standard (AES) or Data Encryption Standard DES, as well as biometric recognition and chaotic system. The proposed E-mail system security uses modified AES algorithm and uses secret key-bio-chaos that consist of biometric (Fingerprint) and chaotic system (Lu and Lorenz). This modification makes the proposed system more sensitive and random. The execution time for both encryption and decryption of the proposed system is much less from original AES, in addition to being compatible with all Mail Servers.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
Analysis by SIMS and AES of H:TiO2 electrodes
International Nuclear Information System (INIS)
Pena, J.L.; Farias, M.H.; Sanchez Sinencio, F.
1981-01-01
TiO 2 electrodes produced by heating in H 2 atmosphere have been analysed. SIMS (Secondary Ion Mass Spectroscopy) and AES (Auger Electron Spectroscopy) techniques were used in order to identify the atomic composition in the electrodes surface. (A.R.H.) [pt
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
AES Encryption Algorithm Optimization Based on 64-bit Processor Android Platform
Directory of Open Access Journals (Sweden)
ZHAO Jun
2017-06-01
Full Text Available Algorithm implemented on the mobile phone is different from one on PC. It requires little storage space and low power consumption. Standard AES S-box design uses look up table,and has high complexity and high power consumption,so it needs to be optimized when used in mobile phones. In our optimization AES encryption algorithm,the packet length is expanded to 256 bits,which would increase the security of our algorithm; look up table is replaced by adding the affine transformation based on inversion,which would reduce the storage space; operation is changed into 16-bit input and 64-bit output by merging the three steps,namely SubWords,ShiftRows MixColumns and AddRoundKey,which would improve the operation efficiency of the algorithm. The experimental results show that our algorithm not only can greatly enhance the encryption strength,but also maintain high computing efficiency.
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
Quench detection/protection of an HTS coil by AE signals
International Nuclear Information System (INIS)
Yoneda, M.; Nanato, N.; Aoki, D.; Kato, T.; Murase, S.
2011-01-01
A quench detection/protection system based on measuring AE signals was developed. The system was tested for a Bi2223 coil. Temperature rise after a quench occurrence was restrained at very low value. The normal zone propagation velocities in high T c superconductors are slow at high operation temperature and therefore local and excessive temperature rise generates at quench occurrence, and then the superconductors are degraded or burned. Therefore it is essential to detect the temperature rise in high T c superconducting (HTS) coils as soon as possible and protect them. The authors have presented a quench detection method for HTS coils by time-frequency visualization of AE signals and have shown its usefulness for a HTS coil with height and outer diameter of 40-50 mm. In this paper, the authors present a quench detection/protection system based on superior method in quench detection time to the previous method and show its usefulness for a larger HTS coil (height and outer diameter: 160-190 mm) than the previous coil.
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
International Nuclear Information System (INIS)
Schmidt, R.R.; Betz, H.; Rehm, H.
1988-01-01
The presynaptically active snake venom neurotoxin β-bungarotoxin (β-Butx) is known to affect neurotransmitter release by binding to a subtype of voltage-activated K + channels. Here the authors show that mast cell degranulating (MCD) peptide from bee venom inhibits the binding of 125 I-labeled β-Butx to chick and rat brain membranes with apparent K/sub i/ values of 180 nM and 1100 nM, respectively. The mechanisms of inhibition of MCD peptide is noncompetitive, as is inhibition of 125 I-β-Butx binding by the protease inhibitor homologue from mamba venom, toxin I. β-Butx and its binding antagonists thus bind to different sites of the same membrane protein. Removal of Ca 2+ by ethylene glycol bis(β-aminoethyl ether)-N,N,N',N'-tetraacetic acid inhibits the binding of 125 I-β-Butx by lowering its affinity to brain membranes
Chemical spots on the surface of the strongly magnetic Herbig Ae star HD 101412
DEFF Research Database (Denmark)
Järvinen, S. P.; Hubrig, S.; Schöller, M.
2016-01-01
Due to the knowledge of the rotation period and the presence of a rather strong surface magnetic field, the sharp-lined young Herbig Ae star HD 101412 with a rotation period of 42 d has become one of the most well-studied targets among the Herbig Ae stars. High-resolution HARPS polarimetric spectra...... that is opposite to the behaviour of the other elements studied. Since classical Ap stars usually show a relationship between the magnetic field geometry and the distribution of element spots, we used in our magnetic field measurements different line samples belonging to the three elements with the most numerous...
Development of ICP-AES based method for the characterization of high level waste
International Nuclear Information System (INIS)
Seshagiri, T.K.; Thulsidas, S.K.; Adya, V.C.; Kumar, Mithlesh; Radhakrishnan, K.; Mary, G.; Kulkarni, P.G.; Bhalerao, Bharti; Pant, D.K.
2011-01-01
An Inductively Coupled Plasma Atomic Emission Spectrometry (ICP-AES) method was developed for the trace metal characterization of high level waste solutions (HLW) of different origin and the method was validated by analysis of synthetic samples of simulated high level waste solutions (SHLW) from spent fuels of varying composition. In this context, an inter-laboratory comparison exercise (ILCE) was carried out with the simulated HLW of different spent fuel types, viz., research reactor (RR), pressurized heavy water reactor (PHWR) and fast breeder reactor (FBR). An over view of the ICP-AES determination of trace metallic constituents in such SHLW solutions is presented. The overall agreement between the various laboratories was good. (author)
Junking, Mutita; Sawasdee, Nunghathai; Duangtum, Natapol; Cheunsuchon, Boonyarit; Limjindaporn, Thawornchai; Yenchitsomanus, Pa-thai
2014-07-01
Kidney anion exchanger 1 (kAE1) plays an important role in acid-base homeostasis by mediating chloride/bicarbornate (Cl-/HCO3-) exchange at the basolateral membrane of α-intercalated cells in the distal nephron. Impaired intracellular trafficking of kAE1 caused by mutations of SLC4A1 encoding kAE1 results in kidney disease - distal renal tubular acidosis (dRTA). However, it is not known how the intracellular sorting and trafficking of kAE1 from trans-Golgi network (TGN) to the basolateral membrane occurs. Here, we studied the role of basolateral-related sorting proteins, including the mu1 subunit of adaptor protein (AP) complexes, clathrin and protein kinase D, on kAE1 trafficking in polarized and non-polarized kidney cells. By using RNA interference, co-immunoprecipitation, yellow fluorescent protein-based protein fragment complementation assays and immunofluorescence staining, we demonstrated that AP-1 mu1A, AP-3 mu1, AP-4 mu1 and clathrin (but not AP-1 mu1B, PKD1 or PKD2) play crucial roles in intracellular sorting and trafficking of kAE1. We also demonstrated colocalization of kAE1 and basolateral-related sorting proteins in human kidney tissues by double immunofluorescence staining. These findings indicate that AP-1 mu1A, AP-3 mu1, AP-4 mu1 and clathrin are required for kAE1 sorting and trafficking from TGN to the basolateral membrane of acid-secreting α-intercalated cells. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Radiochemical separation and ICP-AES determination of some common metallic elements in ThO2 matrix
International Nuclear Information System (INIS)
Adya, V.C.; Hon, N.S.; Bangia, T.R.; Sastry, M.D.; Iyer, R.H.
1997-01-01
Radioactive tracer and also ICP-AES studies have been carried out to determine Al, Cd, Ca, Cr, Co, Cu, Mn, Mo and Pd in ThO 2 matrix after chemical separation. Di-2-ethyl-hexyl phosphoric acid/xylene/HNO 3 extraction system was used for quantitative separation of thorium. The recovery of elements as determined by tracers and ICP-AES was found to be quantitative within experimental error. (author). 3 refs., 1 tab
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
A Study on the Fracture Behavior of Composite Laminated T-Joints Using AE
International Nuclear Information System (INIS)
Kim, J. H.; Sa, J. W.; Park, B. J.; Ahn, B. W.
1999-01-01
Quasi-static tests such as monotonic tension and loading/unloading tension were performed to investigate the bond characteristics and the failure processes for the T-joint specimens made from fiber/epoxy composite material. Two types of specimens, each consists of two components, e. g. skin and frame. were manufactured by co-curing and secondary bonding. During the monotonic tension test, AE instrument was used to predict AE signal at the initial and middle stage of the damage propagation. The damage initiation and progression were monitored optically using m (Charge Coupled Device) camera. And the internal crack front profile was examined using ultrasonic C-scan. The results indicate that the loads representing the abrupt increase of the AE signal are within the error range of 5 percent comparing to the loads shown in the load-time curve. Also it is shown that the initiation of crack occurred in the noodle region for both co cured and secondarily bonded specimen. The final failure occurred in the noodle region for the co-cured specimen. but at the skin/frame termination point for the secondarily bonded specimen. Based on the results, it was found that two kinds of specimen show different failure modes depending on the manufacturing methods
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
Implementing AES via an Actively/Covertly Secure Dishonest-Majority MPC Protocol
DEFF Research Database (Denmark)
Damgård, Ivan Bjerre; Keller, Marcel; Keller, Enrique
2012-01-01
, but produces significant performance enhancements; the second enables us to perform bit-wise operations in characteristic two fields. As a bench mark application we present the evaluation of the AES cipher, a now standard bench marking example for multi-party computation. We need examine two different...
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
Gao, Jin-gui; Jiang, Zhao-fang; Luo, Lai-peng
2017-04-01
Taking the MJ3210A motion band saw as the research object, the AE value of the band saw blade vibration was obtained by analyzing the VIBSYS vibration signal acquisition and analysis software system in Beijing, and the change of the AE value of the band saw and the crack was found out. The experimental results show that in the MJ3210A sports car sawing machine, the band saw blade with width of 130 mm is used, and the AE value of the cracked band saw blade is well in the high band saw blade AE value. Under the best working condition of the band saw, the band saw blade AE If the value exceeds 104.7 dB (A) above, it means that the band saw blade has at least one crack length greater than 1.38 mm for the crack defect and the need to replace the band saw blade in time. Different species with saw blade of the AE value is different, white pine wood minimum, the largest oak wood; according to a variety of wood processing AE instrument value to determine the band saw blade crack to the situation; so as to fully rational use of band saw blade, The failure and the degree of development to find a new method.
Secure Data Encryption Through a Combination of AES, RSA and HMAC
Directory of Open Access Journals (Sweden)
E. S. I. Harba
2017-08-01
Full Text Available Secure file transfer based upon well-designed file encryption and authorization systems expend considerable effort to protect passwords and other credentials from being stolen. Transferring and storing passwords in plaintext form leaves them at risk of exposure to attackers, eavesdroppers and spyware. In order to avoid such exposure, powerful encryption/authentication systems use various mechanisms to minimize the possibility that unencrypted credentials will be exposed, as well as be sure that any authentication data that does get transmitted and stored will be of minimal use to an attacker. In this paper we proposed a method to protect data transferring by three hybrid encryption techniques: symmetric AES algorithm used to encrypt files, asymmetric RSA used to encrypt AES password and HMAC to encrypt symmetric password and/or data to ensure a secure transmitting between server-client or client-client from verifying in-between client and server and make it hard to attack by common attacked methods.
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
HDE 323771: a new Herbig Ae star
International Nuclear Information System (INIS)
Persi, P.; Polcaro, V.F.; Viotti, R.
1991-01-01
From an analysis of the blue and red spectrum, and a study of the energy distribution from the optical up to the far infrared, we identify HDE 323771 as a new PMS Herbig Ae star. The P Cygni line profiles observed in the Balmer and Fe II lines indicate the presence of a stellar wind with a velocity of about 250-350 km s -1 . An upper limit of mass loss rate is derived from the observed upper limit for the Br γ luminosity. The near-IR images and the IR energy distribution indicate the presence of an extended circumstellar dust envelope with a temperature of about 1500 K. (author)
Hao, Qiushi; Shen, Yi; Wang, Yan; Zhang, Xin
2018-01-01
Nondestructive test (NDT) of rails has been carried out intermittently in traditional approaches, which highly restricts the detection efficiency under rapid development of high speed railway nowadays. It is necessary to put forward a dynamic rail defect detection method for rail health monitoring. Acoustic emission (AE) as a practical real-time detection technology takes advantage of dynamic AE signal emitted from plastic deformation of material. Detection capacities of AE on rail defects have been verified due to its sensitivity and dynamic merits. Whereas the application under normal train service circumstance has been impeded by synchronous background noises, which are directly linked to the wheel speed. In this paper, surveys on a wheel-rail rolling rig are performed to investigate defect AE signals with varying speed. A dynamic denoising method based on Kalman filter is proposed and its detection effectiveness and flexibility are demonstrated by theory and computational results. Moreover, after comparative analysis of modelling precision at different speeds, it is predicted that the method is also applicable for high speed condition beyond experiments.
Corrosion testing on crude oil tankers and other product carriers by means of acoustic emission (AE)
Energy Technology Data Exchange (ETDEWEB)
Lackner, Gerald [TUV Austria, Deutschstrasse 10, 1230 Wien (Austria); Tscheliesnig, Peter [TUV Austria, Deutschstrasse 10, 1230 Wien (Austria)
2004-07-01
In the last decades a lot of maritime disasters with crude oil tankers occurred (e.g. Exxon- Valdez, Erika, Prestige). Every accident led to extreme pollution with horrible consequences not only for the environment but also for the life of the inhabitants of the affected coasts. Although most of these accidents were caused by human errors, the material degradation of the ship hull due to corrosion played an important role. Acoustic emission (AE) is already used to detect and discriminate the stage of corrosion of structures located on land. A consortium consisting of experienced partners from the fields of ship building and classification as well as from AE testing and equipment manufacturing started to investigate the feasibility of this testing technique for its application on oil tankers. The aim of the research project funded by the European Commission is to develop an on-line corrosion monitoring technique based on a permanent installation of AE sensors as well as a spot testing technique during stops in harbors or at anchorages using mobile equipment. Since the project was started, a lot of lab tests as well as background measurements were done on different types of tankers up to a size of 35.000 dead weight tons (DWT). The gathered data were evaluated with a frequency domain based pattern recognition system and it was possible to distinguish the AE signals related to corrosion from those signals, which were emitted by the structure due to the harsh environment on sea (background noise). Together with the oncoming developments of the AE equipment and the improvement of the data base, this project will lead to an important breakthrough for the safe shipping of hazardous products like crude oil. (authors)
Developing A/E capabilities; areas of special interest
International Nuclear Information System (INIS)
Gonzalez, A.; Gurbindo, J.
1988-01-01
During the last few years, the methods used by Empresarios Agrupados and INITEC to perform Architect-Engineering work in Spain for nuclear projects has undergone a process of significant change in project management and engineering approaches. Specific practical examples of management techniques and design practices which represent a good record of results will be discussed. They are identified as areas of special interest in developing A/E capabilities for nuclear projects. Command of these areas should produce major payoffs in local participation and contribute to achieving real nuclear engineering capabilities in the country
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
Uses of AES and RGA to study neutron-irradiation-enhanced segregation to internal surfaces
International Nuclear Information System (INIS)
Gessel, G.R.; White, C.L.
1980-01-01
The high flux of point defects to sinks during neutron irradiation can result in segregation of impurity or alloy additions to metals. Such segregants can be preexisting or produced by neutron-induced transmutations. This segregation is known to strongly influence swelling and mechanical properties. Over a period of years, facilities have been developed at ORNL incorporating AES and RGA to examine irradiated materials. Capabilities of this system include in situ tensile fracture at elevated temperatures under ultrahigh vacuum 10 -10 torr and helium release monitoring. AES and normal incidence inert ion sputtering are exploited to examine segregation at the fracture surface and chemical gradients near the surface
2012-02-08
... rather provides a guide for readers regarding entities likely to be affected by this action. Other types... degradation by acid and proteases (Ref. 4). The Cry2Ae protein was rapidly digested (within 30 seconds) in SGF... shown to be rapidly digested in vitro. As previously stated, when Cry2Ae protein is used as a PIP in...
Rapid synthesis of the A-E fragment of ciguatoxin CTX3C.
Clark, J Stephen; Conroy, Joanne; Blake, Alexander J
2007-05-24
The A-E fragment of the marine natural product CTX3C has been prepared in an efficient manner by using a strategy in which two-directional and iterative ring-closing metathesis (RCM) reactions were employed for ring construction.
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
Directory of Open Access Journals (Sweden)
Camacho-Nuez Minerva
2006-10-01
Full Text Available Abstract Background Dengue viruses (DENV attach to the host cell surface and subsequently enter the cell by receptor-mediated endocytosis. Several primary and low affinity co-receptors for this flavivirus have been identified. However, the presence of these binding molecules on the cell surface does not necessarily render the cell susceptible to infection. Determination of which of them serve as bona fide receptors for this virus in the vector may be relevant to treating DENV infection and in designing control strategies. Results (1 Overlay protein binding assay showed two proteins with molecular masses of 80 and 67 kDa (R80 and R67. (2 Specific antibodies against these two proteins inhibited cell binding and infection. (3 Both proteins were bound by all four serotypes of dengue virus. (4 R80 and R67 were purified by affinity chromatography from Ae. aegypti mosquito midguts and from Ae albopictus C6/36 cells. (5 In addition, a protein with molecular mass of 57 kDa was purified by affinity chromatography from the midgut extracts. (6 R80 and R67 from radiolabeled surface membrane proteins of C6/36 cells were immunoprecipitated by antibodies against Ae. aegypti midgut. Conclusion Our results strongly suggest that R67 and R80 are receptors for the four serotypes of dengue virus in the midgut cells of Ae. aegypti and in C6/36 Ae. albopictus cells.
Water Depletion in the Disk Atmosphere of Herbig AeBe Stars
Fedele, D.; Pascucci, I.; Brittain, S.; Kamp, I.; Woitke, P.; Williams, J. P.; Dent, W. R. F.; Thi, W. -F.
2011-01-01
We present high-resolution (R similar to 100,000) L-band spectroscopy of 11 Herbig AeBe stars with circumstellar disks. The observations were obtained with the VLT/CRIRES to detect hot water and hydroxyl radical emission lines previously detected in disks around T Tauri stars. OH emission lines are
On the solar wind - magnetosphere - ionosphere coupling: AMPTE/CCE particle data and the AE indices
International Nuclear Information System (INIS)
Daglis, I.A.; Wilken, B.; Sarris, E.T.; Kremser, G.
1992-01-01
We present a statistical study of the substorm particle energization in terms of the energy density of the major magnetospheric ions (H + , O + , He ++ , He + ). The correlation between energy density during substorm expansion phase and the auroral indices (AE, AU, Al) is examined and interpreted. Most distinct result is that the ionospheric origin O + energy density correlate remarkable well with the AE index, while the solar wind origin He ++ energy density does not correlate at all with AE. Mixed origin H + and He + ions exhibit an intermediate behavior. Furthermore, the O + energy density correlates very well with the pre-onset AU index level, while there is no correlation with the pre-onset AL index. The results are interpreted as a result of solar wind. The results are interpreted as a result of solar wind - magnetosphere - ionosphere coupling through the internal magnetospheric dynamo: the ionosphere responds to the increased activity of the internal dynamo (which is due to the high solar wind input) and influences substorm dynamics by feeding the near-Earth magnetotail with energetic ionospheric ions during late growth phase and expansion phase
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
Directory of Open Access Journals (Sweden)
G. P. Pavlos
1999-01-01
Full Text Available A long AE index time series is used as a crucial magnetospheric quantity in order to study the underlying dynainics. For this purpose we utilize methods of nonlinear and chaotic analysis of time series. Two basic components of this analysis are the reconstruction of the experimental tiine series state space trajectory of the underlying process and the statistical testing of an null hypothesis. The null hypothesis against which the experimental time series are tested is that the observed AE index signal is generated by a linear stochastic signal possibly perturbed by a static nonlinear distortion. As dis ' ' ating statistics we use geometrical characteristics of the reconstructed state space (Part I, which is the work of this paper and dynamical characteristics (Part II, which is the work a separate paper, and "nonlinear" surrogate data, generated by two different techniques which can mimic the original (AE index signal. lie null hypothesis is tested for geometrical characteristics which are the dimension of the reconstructed trajectory and some new geometrical parameters introduced in this work for the efficient discrimination between the nonlinear stochastic surrogate data and the AE index. Finally, the estimated geometric characteristics of the magnetospheric AE index present new evidence about the nonlinear and low dimensional character of the underlying magnetospheric dynamics for the AE index.
Ac irreversibility line of bismuth-based high temperature superconductors
International Nuclear Information System (INIS)
Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.
1997-01-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society
Chaturvedi, Sanjay; Sharma, Neha; Kakkar, Manish
2017-08-08
Acute Encephalitis Syndrome (AES) and Japanese Encephalitis (JE) stay as poorly understood phenomena in India. Multiple linkages to determinants such as poverty, socio-economic status, gender, environment, and population distribution, make it a greater developmental issue than just a zoonotic disease. A qualitative study was conducted to map knowledge, perceptions and practices of community and health systems level stakeholders. Seventeen interviews with utilizers of AES care, care givers from human and veterinary sectors, Non-governmental Organizations (NGOs), and pig owners and 4 Focused Group Discussions (FGDs) with farmers, community leaders, and students were conducted in an endemic north Indian district-Kushinagar. Core themes that emerged were: JE/AES been perceived as a deadly disease, but not a major health problem; filthy conditions, filthy water and mosquitoes seen to be associated with JE/AES; pigs not seen as a source of infection; minimal role of government health workers in the first-contact care of acute Illness; no social or cultural resistance to JE vaccination or mosquito control; no gender-based discrimination in the care of acute Illness; and non-utilization of funds available with local self govt. Serious challenges and systematic failures in delivery of care during acute illness, which can critically inform the health systems, were also identified. There is an urgent need for promotive interventions to address lack of awareness about the drivers of JE/AES. Delivery of care during acute illness suffers with formidable challenges and systematic failures. A large portion of mortality can be prevented by early institution of rational management at primary and secondary level, and by avoiding wastage of time and resources for investigations and medications that are not actually required.
Directory of Open Access Journals (Sweden)
Kwanyuen Prachuab
2009-11-01
Full Text Available Abstract Background In soybean somatic embryo transformation, the standard selection agent currently used is hygromycin. It may be preferable to avoid use of antibiotic resistance genes in foods. The objective of these experiments was to develop a selection system for producing transgenic soybean somatic embryos without the use of antibiotics such as hygromycin. Results When tested against different alternate selection agents our studies show that 0.16 μg/mL glufosinate, 40 mg/L isopropylamine-glyphosate, 0.5 mg/mL (S-(2 aminoethyl-L-cysteine (AEC and the acetolactate synthase (ALS inhibitors Exceed® and Synchrony® both at 150 μg/mL inhibited soybean somatic embryo growth. Even at the concentration of 2 mg/mL, lysine+threonine (LT were poor selection agents. The use of AEC may be preferable since it is a natural compound. Unlike the plant enzyme, dihydrodipicolinate synthase (DHPS from E. coli is not feed-back inhibited by physiological concentrations of lysine. The dapA gene which codes for E. coli DHPS was expressed in soybean somatic embryos under the control of the CaMV 35S promoter. Following introduction of the construct into embryogenic tissue of soybean, transgenic events were recovered by incubating the tissue in liquid medium containing AEC at a concentration of 5 mM. Only transgenic soybeans were able to grow at this concentration of AEC; no escapes were observed. Conclusion Genetically engineered soybeans expressing a lysine insensitive DHPS gene can be selected with the non-antibiotic selection agent AEC. We also report here the inhibitory effects of glufosinate, (isopropylamine-glyphosate (Roundup®, AEC and the ALS inhibitors Exceed® and Synchrony® against different tissues of soybean
ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching
Taylor, Terri
2009-05-01
In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.
Directory of Open Access Journals (Sweden)
Eriko Kage-Nakadai
Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.
Magnetic irreversibility in granular superconductors: ac susceptibility study
International Nuclear Information System (INIS)
Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.
1991-01-01
Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)
A SOPC-BASED Evaluation of AES for 2.4 GHz Wireless Network
Ken, Cai; Xiaoying, Liang
In modern systems, data security is needed more than ever before and many cryptographic algorithms are utilized for security services. Wireless Sensor Networks (WSN) is an example of such technologies. In this paper an innovative SOPC-based approach for the security services evaluation in WSN is proposed that addresses the issues of scalability, flexible performance, and silicon efficiency for the hardware acceleration of encryption system. The design includes a Nios II processor together with custom designed modules for the Advanced Encryption Standard (AES) which has become the default choice for various security services in numerous applications. The objective of this mechanism is to present an efficient hardware realization of AES using very high speed integrated circuit hardware description language (Verilog HDL) and expand the usability for various applications. As compared to traditional customize processor design, the mechanism provides a very broad range of cost/performance points.
Control of hybrid AC/DC microgrid under islanding operational conditions
DEFF Research Database (Denmark)
Ding, G.; Gao, F.; Zhang, S.
2014-01-01
This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....
Ac irreversibility line of bismuth-based high temperature superconductors
Energy Technology Data Exchange (ETDEWEB)
Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)
1997-09-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}
Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation
Reitan, D. K.
1973-01-01
Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.
International Nuclear Information System (INIS)
Sengupta, Arijit; Thulasidas, S.K.; Natarajan, V.
2015-01-01
A comparative study was carried out to determine Ag, Au and Pt in aqueous samples, uranium, zirconium, and thorium based nuclear fuels and associated materials by CCD based ICP-AES and EDXRF. In ICP-AES, the spectral interference of U, Th, Zr matrices on trace level determination of Ag, Au and Pt were studied for different analytical lines of these analytes. The analytical performance of different lines including detection limits, sensitivity, linear dynamic range etc were studied both by ICP-AES and EDXRF. Though EDXRF technique was known its non destructive nature, the overall analytical performance of ICP-AES technique was found to be superior to EDXRF. Based on the spectral contribution from emission rich matrix elements and the analytical performance of different analytical lines of these analytes, a method was developed for direct determination of these analytes by ICP-AES without chemical separation. The method was validated with synthetic samples and compared with EDXRF technique and conventional ICP-AES technique where the major matrix was chemically separated using suitable organic phase containing selective ligands. The ICP-AES method for direct determination of analytes without chemical separation was found to be simple, less time consuming, without generation of organic waste with acceptable analytical performance
NuSTAR and swift observations of the fast rotating magnetized white dwarf AE Aquarii
DEFF Research Database (Denmark)
Kitaguchi, Takao; An, Hongjun; Beloborodov, Andrei M.
2014-01-01
AE Aquarii is a cataclysmic variable with the fastest known rotating magnetized white dwarf (P-spin = 33.08 s). Compared to many intermediate polars, AE Aquarii shows a soft X-ray spectrum with a very low luminosity (L-X similar to 10(31) erg s(-1)). We have analyzed overlapping observations...... of this system with the NuSTAR and the Swift X-ray observatories in 2012 September. We find the 0.5-30 keV spectra to be well fitted by either an optically thin thermal plasma model with three temperatures of 0.75(-0.45)(+0.18), 2.29(-0.82)(+0.96), and 9.33(-2.18)(+6.07) keV, or an optically thin thermal plasma...
Modified Redundancy based Technique—a New Approach to Combat Error Propagation Effect of AES
Sarkar, B.; Bhunia, C. T.; Maulik, U.
2012-06-01
Advanced encryption standard (AES) is a great research challenge. It has been developed to replace the data encryption standard (DES). AES suffers from a major limitation of error propagation effect. To tackle this limitation, two methods are available. One is redundancy based technique and the other one is bite based parity technique. The first one has a significant advantage of correcting any error on definite term over the second one but at the cost of higher level of overhead and hence lowering the processing speed. In this paper, a new approach based on the redundancy based technique is proposed that would certainly speed up the process of reliable encryption and hence the secured communication.
A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network
Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.
2017-05-01
Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.
Lifescience Database Archive (English)
Full Text Available izophrenia region contig 2 section 3 of 3 of the complete sequence. 40 0.11 5 AC098...logy vs DNA Score E Sequences producing significant alignments: (bits) Value N AE014303 |AE014303.1 Homo sapiens chromosome 13q34 sch
Investigation of Participation in Adult Education in Turkey: AES Data Analysis
Dincer, N. Nergiz; Tekin-Koru, Ayca; Askar, Petek
2016-01-01
The aim of this study is to identify the determinants of participation in adult education in Turkey. The analysis is conducted using the Adult Education Survey (AES), conducted by TurkStat. The results indicate that economic growth in the sector of employment significantly and positively affects the odds for adult education participation. The data…
DEFF Research Database (Denmark)
Blaabjerg, Frede; Aquila, A. Dell; Liserre, Marco
2004-01-01
of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....
Comparison of elemental quantity by PIXE and ICP-MS and/or ICP-AES for NIST standards
International Nuclear Information System (INIS)
Saitoh, K.; Sera, K.; Gotoh, T.; Nakamura, M.
2002-01-01
Urban particulate matter (SRM 1648), Buffalo River sediment (SRM 2704) and pine needle (SRM 1575) standard reference materials prepared by the National Institute of Standards and Technology (NIST, USA) were analyzed by three multi-element analysis methods, i.e., particle induced X-ray emission (PIXE), inductively coupled plasma-mass spectrometry (ICP-MS) and inductively coupled plasma-atomic emission spectrometry (ICP-AES); values determined by those analysis methods were compared with certified and/or non-certified values of NIST samples. Values determined by PIXE were 70-120% relative to certified and/or non-certified values of NIST samples except for Co in the urban particulate matter, for V and Co in Buffalo River sediment and for Ni and Br in the pine needles samples. In particular, Al, K, Ca, Cr, Mn, Fe, Cu, Zn and Pb were 85-110% in all samples. On the other hand, Na and Fe values determined by ICP-MS were very much different from the certified values in all samples, but the other elements were 70-120%. As for ICP-AES, all elements except for Na were 80-100% in all samples. Comparing the values determined by PIXE and those determined by ICP-MS and/or ICP-AES, there was a slight difference between the samples, but the range was 75-120% except for Na, V, Fe and Co determined by ICP-MS and Na determined by ICP-AES, which was generally consistent with PIXE
21 CFR 880.5100 - AC-powered adjustable hospital bed.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...
Nonlinear AC susceptibility, surface and bulk shielding
van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.
1996-02-01
We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.
Matthews, Edwin J; Frid, Anna A
2010-04-01
This is the first of two reports that describes the compilation of a database of drug-related cardiac adverse effects (AEs) that was used to construct quantitative structure-activity relationship (QSAR) models to predict these AEs, to identify properties of pharmaceuticals correlated with the AEs, and to identify plausible mechanisms of action (MOAs) causing the AEs. This database of 396,985 cardiac AE reports was linked to 1632 approved drugs and their chemical structures, 1851 clinical indications (CIs), 997 therapeutic targets (TTs), 432 pharmacological MOAs, and 21,180 affinity coefficients (ACs) for the MOA receptors. AEs were obtained from the Food and Drug Administration's (FDA's) Spontaneous Reporting System (SRS) and Adverse Event Reporting System (AERS) and publicly available medical literature. Drug TTs were obtained from Integrity; drug MOAs and ACs were predicted by BioEpisteme. Significant cardiac AEs and patient exposures were estimated based on the proportional reporting ratios (PRRs) for each drug and each AE endpoint as a percentage of the total AEs. Cardiac AE endpoints were bundled based on toxicological mechanism and concordance of drug-related findings. Results revealed that significant cardiac AEs formed 9 clusters affecting Purkinje nerve fibers (arrhythmia, bradycardia, conduction disorder, electrocardiogram, palpitations, QT prolongation, rate rhythm composite, tachycardia, and Torsades de pointes), and 5 clusters affecting the heart muscle (coronary artery disorders, heart failure, myocardial disorders, myocardial infarction, and valve disorders). Based on the observation that each drug had one TT and up to 9 off-target MOAs, cardiac AEs were highly correlated with drugs affecting cardiovascular and cardioneurological functions and certain MOAs (e.g., alpha- and beta-adeno, dopamine, and hydroxytryptomine receptors). Copyright 2010. Published by Elsevier Inc.
electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.
Dougherty, Laura; Zhu, Yuandi; Xu, Kenong
2016-01-01
Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553
AC electric motors control advanced design techniques and applications
Giri, Fouad
2013-01-01
The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var
Penicyclones A-E, Antibacterial Polyketides from the Deep-Sea-Derived Fungus Penicillium sp. F23-2.
Guo, Wenqiang; Zhang, Zhenzhen; Zhu, Tianjiao; Gu, Qianqun; Li, Dehai
2015-11-25
Five new ambuic acid analogues, penicyclones A-E (1-5), were isolated from the extract of the deep-sea-derived fungus Penicillium sp. F23-2. The structures including the absolute configurations were established by interpretation of NMR and MS data, as well as the application of ECD, X-ray crystallography, and a chemical conversion, as well as the TDDFT-ECD calculations. Penicyclones A-E (1-5) exhibited antimicrobial activity against the Gram-positive bacterium Staphylococcus aureus with MIC values ranging from 0.3 to 1.0 μg/mL.
Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi
Directory of Open Access Journals (Sweden)
Rudy Ariyanto
2017-11-01
Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu
Directory of Open Access Journals (Sweden)
Sanjay Chaturvedi
2017-08-01
Full Text Available Abstract Background Acute Encephalitis Syndrome (AES and Japanese Encephalitis (JE stay as poorly understood phenomena in India. Multiple linkages to determinants such as poverty, socio-economic status, gender, environment, and population distribution, make it a greater developmental issue than just a zoonotic disease. Methods A qualitative study was conducted to map knowledge, perceptions and practices of community and health systems level stakeholders. Seventeen interviews with utilizers of AES care, care givers from human and veterinary sectors, Non-governmental Organizations (NGOs, and pig owners and 4 Focused Group Discussions (FGDs with farmers, community leaders, and students were conducted in an endemic north Indian district-Kushinagar. Results Core themes that emerged were: JE/AES been perceived as a deadly disease, but not a major health problem; filthy conditions, filthy water and mosquitoes seen to be associated with JE/AES; pigs not seen as a source of infection; minimal role of government health workers in the first-contact care of acute Illness; no social or cultural resistance to JE vaccination or mosquito control; no gender-based discrimination in the care of acute Illness; and non-utilization of funds available with local self govt. Serious challenges and systematic failures in delivery of care during acute illness, which can critically inform the health systems, were also identified. Conclusion There is an urgent need for promotive interventions to address lack of awareness about the drivers of JE/AES. Delivery of care during acute illness suffers with formidable challenges and systematic failures. A large portion of mortality can be prevented by early institution of rational management at primary and secondary level, and by avoiding wastage of time and resources for investigations and medications that are not actually required.
Energy Technology Data Exchange (ETDEWEB)
Loureiro, I.; Escorial, C.; Garcia-Baudin, J. M.; Chueca, M. C.
2009-07-01
Some F1 hybrid plants between three species of the Aegilops genus and different hexaploid wheat Triticum aestivum cultivars show certain self-fertility, with averages of F{sub 1} hybrids bearing F{sub 2} seeds of 8.17%, 5.12% and 48.14% for Aegilops biuncialis, Aegilops geniculata and Aegilops triuncialis respectively. In the Ae. triuncialis-wheat combination with Astral wheat cultivar, the fertility was higher than that found in the other combinations. All the F2 seeds studied were spontaneous amphiploids (2n=10x=70). The present study evidences the possibility of spontaneous formation of amphiploids between these three Aegilops species and hexaploid wheat and discusses their relevance for gene transference. Future risk assessment of transgenic wheat cultivars needs to evaluate the importance of amphiploids as a bridge for transgene introgression and for gene escape to the wild. (Author)
Successful enrichment of the ubiquitous freshwater acI Actinobacteria.
Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk
2014-02-01
Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.
“Smart COPVs” - Continued Successful Development of JSC IR&D Acoustic Emissions (AE) SHM
National Aeronautics and Space Administration — Developed and applied promising quantitative pass/fail criteria to COPVs using acoustic emission (AE) and developed automated data analysis software. This lays the...
The Peculiar Binary System AE Aquarii from its Characteristic Multi-wavelength Emission
Directory of Open Access Journals (Sweden)
Oruru B.
2014-01-01
Full Text Available The multi-wavelength properties of the novalike variable system AE Aquarii are discussed in terms of the interaction between the accretion inflow from a late-type main sequence star and the magnetosphere of a fast rotating white dwarf. This results in an efficient magnetospheric propeller process and particle acceleration. The spin-down of the white dwarf at a period rate of 5.64×10−14 s s−1 results in a huge spin-down luminosity of Ls−d ≃ 6 10×33 erg s−1. Hence, the observed non-thermal hard X-ray emission and VHE and TeV gamma-ray emission may suggest that AE Aquarii can be placed in the category of spin-powered pulsars. Besides, observed hard X-ray luminosity of LX,hard ≤ 5 × 1030 erg s−1 constitutes 0.1 % of the total spin-down luminosity of the white dwarf. This paper will discuss some recent theoretical studies and data analysis of the system.
Shi, Yanan; Qiao, Jiayun; Mu, Biao; Zuo, Bingfeng; Yuan, Jihong
2017-11-04
3-(2-amino-ethyl)-5-[3-(4-butoxyl-phenyl)-propylidene]-thiazolidine-2,4-dione (K145) is identified as a selective SphK2 inhibitor. It was previously reported as an anti-tumor agent, in this study we demonstrated that K145 was able to regulate hepatic gluconeogenesis and improve glucose intolerance in mice. C57BL/6 mice treated with dexamethasone injection were used as experimental animals, which exhibited impaired glucose tolerance and increased gluconeogenetic enzymes. After K145 treatment, we found that the impairment of glucose tolerance and gluconeogenetic genes mRNA expression were improved. Besides, both in vivo and in votro studies suggested that K145 stimulated insulin dependent Akt phosphorylation and subsequently activates FoxO1 phosphorylation therefore inhibited gluconeogenetic genes expression including PEPCK and G6pase. Our study figures out a potential extent increase the value of developing K145 as therapeutic candidate for diabetes. Copyright © 2017. Published by Elsevier Inc.
Energy Technology Data Exchange (ETDEWEB)
Fujii, Yoshimichi. [Seikow Chemical Engineering and Machinery, Ltd., Hyogo (Japan). Laboratory of Composite Materials; Nishiyabu, Kazuaki. [Osaka Prefectural College of Tehcnology, Osaka (Japan)
1999-05-15
The objective of this investigation is to estimate the creep life of glass fiber reinforced plastic (GFRP) under stress-corrosive environments using acoustic emission(AE). The laminates were fabricated using combinations of vinylester resin (R806) and random fiber mat or woven cloth. The creep tests were conducted in 5% nitric acid (HNO{sub 3}) environment. The AE depends on the loading level and the environment condition. For the creep test, the woven cloth reinforced specimens gave higher number of AE counts than the random mat reinforced specimens. The creep life decreased with increasing creep stress, whereas the rate of AE counts increased with increasing creep stress. A linear relationship was found between the creep life and the AE count rate. Using the proposed equation, a prediction of the creep life of GFRP under corrosive environments would presumably be possible. (author)
Lifescience Database Archive (English)
Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris
Low-Level Space Optimization of an AES Implementation for a Bit-Serial Fully Pipelined Architecture
Weber, Raphael; Rettberg, Achim
A previously developed AES (Advanced Encryption Standard) implementation is optimized and described in this paper. The special architecture for which this implementation is targeted comprises synchronous and systematic bit-serial processing without a central controlling instance. In order to shrink the design in terms of logic utilization we deeply analyzed the architecture and the AES implementation to identify the most costly logic elements. We propose to merge certain parts of the logic to achieve better area efficiency. The approach was integrated into an existing synthesis tool which we used to produce synthesizable VHDL code. For testing purposes, we simulated the generated VHDL code and ran tests on an FPGA board.
Design and synthesis of 225Ac radioimmunopharmaceuticals
International Nuclear Information System (INIS)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.
2002-01-01
The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans
International Nuclear Information System (INIS)
Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.
2008-01-01
The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus
Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly
International Nuclear Information System (INIS)
Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production
Marketingová komunikace AC Sparta Praha
Fanta, Jan
2016-01-01
Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...
AES, Automated Construction Cost Estimation System
International Nuclear Information System (INIS)
Holder, D.A.
1995-01-01
A - Description of program or function: AES (Automated Estimating System) enters and updates the detailed cost, schedule, contingency, and escalation information contained in a typical construction or other project cost estimates. It combines this information to calculate both un-escalated and escalated and cash flow values for the project. These costs can be reported at varying levels of detail. AES differs from previous versions in at least the following ways: The schedule is entered at the WBS-Participant, Activity level - multiple activities can be assigned to each WBS-Participant combination; the spending curve is defined at the schedule activity level and a weighing factor is defined which determines percentage of cost for the WBS-Participant applied to the schedule activity; Schedule by days instead of Fiscal Year/Quarter; Sales Tax is applied at the Line Item Level- a sales tax codes is selected to indicate Material, Large Single Item, or Professional Services; a 'data filter' has been added to allow user to define data the report is to be generated for. B - Method of solution: Average Escalation Rate: The average escalation for a Bill of is calculated in three steps. 1. A table of quarterly escalation factors is calculated based on the base fiscal year and quarter of the project entered in the estimate record and the annual escalation rates entered in the Standard Value File. 2. The percentage distribution of costs by quarter for the Bill of Material is calculated based on the schedule entered and the curve type. 3. The percent in each fiscal year and quarter in the distribution is multiplied by the escalation factor for the fiscal year and quarter. The sum of these results is the average escalation rate for that Bill of Material. Schedule by curve: The allocation of costs to specific time periods is dependent on three inputs, starting schedule date, ending schedule date, and the percentage of costs allocated to each quarter. Contingency Analysis: The
A New Structural-Differential Property of 5-Round AES
DEFF Research Database (Denmark)
Grassi, Lorenzo; Rechberger, Christian; Ronjom, Sondre
2017-01-01
AES is probably the most widely studied and used block cipher. Also versions with a reduced number of rounds are used as a building block in many cryptographic schemes, e.g. several candidates of the SHA-3 and CAESAR competition are based on it.So far, non-random properties which are independent ...... a random permutation with only 2 32 chosen texts that has a computational cost of 2(35.6) look-ups into memory of size 2 36 bytes which has a success probability greater than 99%....
International Nuclear Information System (INIS)
Yang, Kai-Chun; Stepanov, Vladimir; Amini, Nahid; Martinsson, Stefan; Takano, Akihiro; Halldin, Christer; Nielsen, Jacob; Bundgaard, Christoffer; Bang-Andersen, Benny; Grimwood, Sarah; Farde, Lars; Finnema, Sjoerd J.
2017-01-01
["1"1C]Lu AE92686 is a positron emission tomography (PET) radioligand that has recently been validated for examining phosphodiesterase 10A (PDE10A) in the human striatum. ["1"1C]Lu AE92686 has high affinity for PDE10A (IC_5_0 = 0.39 nM) and may also be suitable for examination of the substantia nigra, a region with low density of PDE10A. Here, we report characterization of regional ["1"1C]Lu AE92686 binding to PDE10A in the nonhuman primate (NHP) brain. A total of 11 PET measurements, seven baseline and four following pretreatment with unlabeled Lu AE92686 or the structurally unrelated PDE10A inhibitor MP-10, were performed in five NHPs using a high resolution research tomograph (HRRT). ["1"1C]Lu AE92686 binding was quantified using a radiometabolite-corrected arterial input function and compartmental and graphical modeling approaches. Regional time-activity curves were best described with the two-tissue compartment model (2TCM). However, the distribution volume (V_T) values for all regions were obtained by the Logan plot analysis, as reliable cerebellar V_T values could not be derived by the 2TCM. For cerebellum, a proposed reference region, V_T values increased by ∝30 % with increasing PET measurement duration from 63 to 123 min, while V_T values in target regions remained stable. Both pretreatment drugs significantly decreased ["1"1C]Lu AE92686 binding in target regions, while no significant effect on cerebellum was observed. Binding potential (BP_N_D) values, derived with the simplified reference tissue model (SRTM), were 13-17 in putamen and 3-5 in substantia nigra and correlated well to values from the Logan plot analysis. The method proposed for quantification of ["1"1C]Lu AE92686 binding in applied studies in NHP is based on 63 min PET data and SRTM with cerebellum as a reference region. The study supports that ["1"1C]Lu AE92686 can be used for PET examinations of PDE10A binding also in substantia nigra. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Yang, Kai-Chun; Stepanov, Vladimir; Amini, Nahid; Martinsson, Stefan; Takano, Akihiro; Halldin, Christer [Karolinska Institutet, Karolinska University Hospital, Department of Clinical Neuroscience, Center for Psychiatric Research, Stockholm (Sweden); Nielsen, Jacob [H. Lundbeck A/S, Synaptic Transmission, Valby (Denmark); Bundgaard, Christoffer; Bang-Andersen, Benny [H. Lundbeck A/S, Discovery Chemistry and DMPK, Valby (Denmark); Grimwood, Sarah [Pfizer Inc., Neuroscience and Pain Research Unit, Cambridge, MA (United States); Farde, Lars [Karolinska Institutet, Karolinska University Hospital, Department of Clinical Neuroscience, Center for Psychiatric Research, Stockholm (Sweden); AstraZeneca PET Science Center at Karolinska Institutet, Personalized Health Care and Biomarkers, Stockholm (Sweden); Finnema, Sjoerd J. [Karolinska Institutet, Karolinska University Hospital, Department of Clinical Neuroscience, Center for Psychiatric Research, Stockholm (Sweden); Yale University, Department of Radiology and Biomedical Imaging, New Haven, CT (United States)
2017-02-15
[{sup 11}C]Lu AE92686 is a positron emission tomography (PET) radioligand that has recently been validated for examining phosphodiesterase 10A (PDE10A) in the human striatum. [{sup 11}C]Lu AE92686 has high affinity for PDE10A (IC{sub 50} = 0.39 nM) and may also be suitable for examination of the substantia nigra, a region with low density of PDE10A. Here, we report characterization of regional [{sup 11}C]Lu AE92686 binding to PDE10A in the nonhuman primate (NHP) brain. A total of 11 PET measurements, seven baseline and four following pretreatment with unlabeled Lu AE92686 or the structurally unrelated PDE10A inhibitor MP-10, were performed in five NHPs using a high resolution research tomograph (HRRT). [{sup 11}C]Lu AE92686 binding was quantified using a radiometabolite-corrected arterial input function and compartmental and graphical modeling approaches. Regional time-activity curves were best described with the two-tissue compartment model (2TCM). However, the distribution volume (V{sub T}) values for all regions were obtained by the Logan plot analysis, as reliable cerebellar V{sub T} values could not be derived by the 2TCM. For cerebellum, a proposed reference region, V{sub T} values increased by ∝30 % with increasing PET measurement duration from 63 to 123 min, while V{sub T} values in target regions remained stable. Both pretreatment drugs significantly decreased [{sup 11}C]Lu AE92686 binding in target regions, while no significant effect on cerebellum was observed. Binding potential (BP{sub ND}) values, derived with the simplified reference tissue model (SRTM), were 13-17 in putamen and 3-5 in substantia nigra and correlated well to values from the Logan plot analysis. The method proposed for quantification of [{sup 11}C]Lu AE92686 binding in applied studies in NHP is based on 63 min PET data and SRTM with cerebellum as a reference region. The study supports that [{sup 11}C]Lu AE92686 can be used for PET examinations of PDE10A binding also in substantia
Effect of sulfur analogue of lysine on bacterial protein biosynthesis
International Nuclear Information System (INIS)
Tanaka, Hidehiko; Soda, Kenji.
1976-01-01
S-(beta-Aminoethyl)-L-cysteine, a sulfur analogue of lysine inhibited strongly growth of Escherichia coli A-19, and weakly that of Corynebacterium sp. isolated from soil, but did not inhibit growth of Aerobacter aerogenes. In Corynebacterium sp. the inhibitory effect was markedly enhanced in the presence of L-threonine. The inhibition of growth by S-(beta-aminoethyl)-L-cysteine was rapidly reversed by the addition of L-lysine. S-(beta-Aminoethyl)-L-cysteine inhibited protein synthesis and the activity of lysyl-tRNA synthetase from E. coli and A. aerogenes. All the other lysine analogues tested inhibited the activity of enzyme, but S-(beta-aminoethyl)-L-cysteine derivatives, S-(beta-N-acetyl-aminoethyl)-L-cysteine and S-(beta-aminoethyl)-alpha-N-acetyl-L-cysteine were not effective. (auth.)
Brittain, Sean D.; Najita, Joan R.; Carr, John S.
2015-01-01
In this review, we describe how high resolution near infrared spectroscopy and spectro-astrometry have been used to study the disks around Herbig~Ae/Be stars. We show how these tools can be used to identify signposts of planet formation and elucidate the mechanism by which Herbig Ae/Be stars accrete. We also highlight some of the artifacts that can complicate the interpretation of spectro-astrometric measurements and discuss best practices for mitigating these effects. We conclude with a brie...
c-axis ac susceptibility in high-Tc superconductors
International Nuclear Information System (INIS)
Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.
1996-01-01
We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society
Fast electric dipole transitions in Ra-Ac nuclei
International Nuclear Information System (INIS)
Ahmad, I.
1985-01-01
Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs
Vegetation and Grazing in the St. Katherine Protectorate, South ...
African Journals Online (AJOL)
5. Grazing pressure. 1. 2. 3. 4. 5. P lant health. Unk . La bita e. Le gu m ino s a e. Co m p o sita e. A m ara nthac ea e. B ora gin ace ae. C h en opo dia c e ae. E u ph orb iac ea e. S cro ph ula ria cea e. A sc lep id ac e ae. C a ry o phy lla cea e. R ese dace ae. C a pp arace ae. Cuc urb ita cea e. Cruc ife rae. Gram inae. U m be.
Directory of Open Access Journals (Sweden)
Umer Farooq
2017-07-01
Full Text Available Over the past few years, cryptographic algorithms have become increasingly important. Advanced Encryption Standard (AES algorithm was introduced in early 2000. It is widely adopted because of its easy implementation and robust security. In this work, AES is implemented on FPGA using five different techniques. These techniques are based on optimized implementation of AES on FPGA by making efficient resource usage of the target device. Experimental results obtained are quite varying in nature. They range from smallest (suitable for area critical application to fastest (suitable for performance critical applications implementation. Finally, technique making efficient usage of resources leads to frequency of 886.64 MHz and throughput of 113.5 Gb/s with moderate resource consumption on a Spartan-6 device. Furthermore, comparison between proposed technique and existing work shows that our technique has 32% higher frequency, while consuming 2.63× more slice LUTs, 8.33× less slice registers, and 12.59× less LUT-FF pairs.
Advanced DC/AC inverters applications in renewable energy
Luo, Fang Lin
2013-01-01
DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,
Energy Technology Data Exchange (ETDEWEB)
Rugi, F.; Becagli, S.; Ghedini, C.; Marconi, M.; Severi, M.; Traversi, R.; Udisti, R. [Dep. of Chemistry, University of Florence, Sesto F.no (Fl) (Italy); Calzolai, G.; Chiari, M.; Lucarelli, F.; Nava, S. [Dep. of Physics and Astronomy , University of Florence and INFN, Sesto F. no (Fl) (Italy)
2013-07-01
Full text: A recent EU regulation (EN 149022005) requests the quantification of selected metals in the atmospheric particulate by mineralization with H{sub 2}0{sub 2} and HN0{sub 3} in microwave oven.This method might possibly conflict with the determination of the total metal content. In fact, the more the aerosol is enriched in crustal elements the more the difference in the two methods are expected, since the H{sub 2}0{sub 2}+ HN0{sub 3}, extraction is not reliable for metals in silicate form. In order to evaluate the extracted fraction, PIXE and ICP-AES measurements were carried out on the two halves of a series of PM10 and PM2.5 samples collected on Teflon filters in an urban site in the surrounding of Florence (Italy). An ICP-AES (Inductively Coupled Plasma -Atomic Emission Spectroscopy) method was optimized by an ultrasound nebuliser (CETAC 5000 AT+), in order to improve reproducibility and detection limit. In these conditions, it was possible quantifying AI, As, Cr, Cu, Fe, Mn, Ni, Pb and Vatsub-ppb levels. PIXE analysis using the external beam set-up at LABEC and a 3 MeV proton beam was carried out in order to measure the total elemental content of the metals. By comparing the ICP-AES and the PIXE results, a preliminary evaluation of the efficiency of the H{sub 2}0{sub 2} and HN0{sub 3} extraction method was performed. The obtained results (the mean values for the ICP-AES/PIXE ratio are reported in Table 1) show that the extraction procedure following the EN 14902 directive allows quantitative recoveries (80-120%, including the analytical uncertainties)for the majority of the analysed metals, especially for those mainly emitted by anthropic sources. This result points out that anthropic metals are present in the atmosphere as relatively available species (free metals, labile complexes, carbonates, oxides). On the contrary, lower recoveries were obtained for AI (mean value around 75%), a metal that has a relevant crustal fraction. Percentage of recovery of
A single-phase embedded Z-source DC-AC inverter.
Kim, Se-Jin; Lim, Young-Cheol
2014-01-01
In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.
Hoffert, Michael J.; Weise, Eric; Clow, Jenna; Hirzel, Jacquelyn; Leeder, Brett; Molyneux, Scott; Scutti, Nicholas; Spartalis, Sarah; Tokuhara, Corey
2014-05-01
Six beginning astronomy students, part of an undergraduate stellar astronomy course, one advanced undergraduate student assistant, and a professor measured the position angles and separations of Washington Double Stars (WDS) 05460 + 2119 (also known as ARY 6 AD and ARY 6 AE). The measurements were made at the Manzanita Observatory (116° 20'42" W, 32° 44' 5" N) of the Tierra Astronomical Institute on 10 Blackwood Rd. in Boulevard, California (www.youtube.com/watch?v=BHVdcMGBGDU), at an elevation of 4,500 ft. A Celestron 11" HD Edge telescope was used to measure the position angles and separations of ARY 6 AD and ARY 6 AE. The averages of our measurements are as follows: separation AD: trial 1 124.1 arcseconds and trial 2 124.5 arcseconds. The average of separation for AE: trial 1 73.3 arcseconds and trial 2 73.8 arcseconds. The averages of position angle for AD: trial 1 159.9 degrees and trial 2 161.3 degrees. The averages of position angle for AE: trial 1 232.6 degrees and trial 2 233.7 degrees.
dc Arc Fault Effect on Hybrid ac/dc Microgrid
Fatima, Zahra
The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.
AEMnSb2 (AE=Sr, Ba): a new class of Dirac materials
International Nuclear Information System (INIS)
Farhan, M Arshad; Lee, Geunsik; Shim, Ji Hoon
2014-01-01
The Dirac fermions of Sb square net in AEMnSb 2 (AE=Sr, Ba) are investigated by using first-principles calculation. BaMnSb 2 contains Sb square net layers with a coincident stacking of Ba atoms, exhibiting Dirac fermion behavior. On the other hand, SrMnSb 2 has a staggered stacking of Sr atoms with distorted zig-zag chains of Sb atoms. Application of hydrostatic pressure on the latter induces a structural change from a staggered to a coincident arrangement of AE ions accompanying a transition from insulator to a metal containing Dirac fermions. The structural investigations show that the stacking type of cation and orthorhombic distortion of Sb layers are the main factors to decide the crystal symmetry of the material. We propose that the Dirac fermions can be obtained by controlling the size of cation and the volume of AEMnSb 2 compounds. (fast track communication)
Energy Technology Data Exchange (ETDEWEB)
Schmidt, R.R.; Betz, H.; Rehm, H.
1988-02-09
The presynaptically active snake venom neurotoxin ..beta..-bungarotoxin (..beta..-Butx) is known to affect neurotransmitter release by binding to a subtype of voltage-activated K/sup +/ channels. Here the authors show that mast cell degranulating (MCD) peptide from bee venom inhibits the binding of /sup 125/I-labeled ..beta..-Butx to chick and rat brain membranes with apparent K/sub i/ values of 180 nM and 1100 nM, respectively. The mechanisms of inhibition of MCD peptide is noncompetitive, as is inhibition of /sup 125/I-..beta..-Butx binding by the protease inhibitor homologue from mamba venom, toxin I. ..beta..-Butx and its binding antagonists thus bind to different sites of the same membrane protein. Removal of Ca/sup 2 +/ by ethylene glycol bis(..beta..-aminoethyl ether)-N,N,N',N'-tetraacetic acid inhibits the binding of /sup 125/I-..beta..-Butx by lowering its affinity to brain membranes.
Auroral Electrojet (AE, AL, AO, AU) - A Global Measure of Auroral Zone Magnetic Activity
National Oceanic and Atmospheric Administration, Department of Commerce — The AE index is derived from geomagnetic variations in the horizontal component observed at selected (10-13) observatories along the auroral zone in the northern...
Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.
Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong
2018-05-01
Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.
Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide
2015-10-01
Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Safety, Dosimetry, and Tumor Detection Ability of 68Ga-NOTA-AE105
DEFF Research Database (Denmark)
Skovgaard Lund, Dorthe; Persson, Morten; Brandt-Larsen, Malene
2017-01-01
The overexpression of urokinase-type plasminogen activator receptors (uPARs) represents an established biomarker for aggressiveness in most common malignant diseases, including breast cancer (BC), prostate cancer (PC), and urinary bladder cancer (UBC), and is therefore an important target for new...... cancer therapeutic and diagnostic strategies. In this study, uPAR PET imaging using a68Ga-labeled version of the uPAR-targeting peptide (AE105) was investigated in a group of patients with BC, PC, and UBC. The aim of this first-in-human, phase I clinical trial was to investigate the safety.......Conclusion:This first-in-human, phase I clinical trial demonstrates the safe use and clinical potential of68Ga-NOTA-AE105 as a new radioligand for uPAR PET imaging in cancer patients....
ICP-AES analysis of trace elements in serum from animals fed with irradiated food
International Nuclear Information System (INIS)
Huang Zongzhi; Zhou Hongdi
1986-01-01
A method of trace element analysis by ICP-AES in serum from animals fed with irradiated food is described. In order to demonstrate that irradiated food is suitable for human consumption, it is necessary to perform an experiment of animal feeding with these food before use for human. Trace element analysis in animal serum could provide an actual evidence for further human consumption study. 53 serum samples of the rats fed with irradiated food were obtained. After ashed and solved, ICP-AES analysis has been used for determining 20 trace elements in specimen solution. The detection limitation is in the range of 10 -2 -10 -3 ppm for different elements. The recovery of elements is from 70.08% to 98.28%. The relative standard deviation is found to be 0.71% to 11.52%
Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte
International Nuclear Information System (INIS)
García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.
2016-01-01
The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.
Superconducting three element synchronous ac machine
International Nuclear Information System (INIS)
Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.
1975-01-01
There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition
ECONOMIC MODEL FOR EVALUATION OF INTEGRAL COMPETITIVENESS OF AUTOMOTIVE ENTERPRISES (AE
Directory of Open Access Journals (Sweden)
A. F. Zubritsky
2010-01-01
Full Text Available The paper considers problems pertaining to evaluation of competitiveness of automotive enterprises in the field of international consignments. An economic model for determination of the integral AE competitiveness is proposed in the paper and the model permits to substitute an expert estimation in respect of some factors by their qualitative calculation on the basis of data on enterprise activity in the international consignment market.
AE$\\mathrm{\\bar{g}}$IS Experiment Positron Accumulator: Optimization and Control
Moura, Joao Pedro
2013-01-01
The present document describes my 8-week work project at the AE$\\mathrm{\\bar{g}}$IS experiment. The project can be divided into three main tasks: 1. Theoretical preparation; 2. Support at the experiment; and 3. Control of the ES075-2 Power Supply. A description of these tasks is presented. Special emphasis is put on the third task and further developments are proposed.
Nontrivial ac spin response in the effective Luttinger model
International Nuclear Information System (INIS)
Hu Liangbin; Zhong Jiansong; Hu Kaige
2006-01-01
Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before
Vertical Transmission of Zika Virus by Aedes aegypti and Ae. albopictus Mosquitoes.
Ciota, Alexander T; Bialosuknia, Sean M; Ehrbar, Dylan J; Kramer, Laura D
2017-05-01
To determine the potential role of vertical transmission in Zika virus expansion, we evaluated larval pools of perorally infected Aedes aegypti and Ae. albopictus adult female mosquitoes; ≈1/84 larvae tested were Zika virus-positive; and rates varied among mosquito populations. Thus, vertical transmission may play a role in Zika virus spread and maintenance.
7 CFR 1737.31 - Area Coverage Survey (ACS).
2010-01-01
... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...
Energy Technology Data Exchange (ETDEWEB)
Ikeda, Takuji [AIST Tohoku, Sendai (Japan). Research Center for Compact Chemical System; Ideta, Chiaki; Yamamoto, Katsutoshi [Kitakyushu Univ. (Japan). Faculty of Environmental Engineering
2013-07-01
A new strontium-containing layered silicate, alkaline earth-containing silicate (AES)-18 [chemical composition: Si{sub 16}O{sub 24}(OH){sub 16} . {Sr(OH)_2}{sub 8} . (KOH){sub 2}], was synthesized utilizing a mechanochemical reaction in which an admixture of strontium hydroxide, which unfavorably precipitates in conventional syntheses, and a fumed silica (Aerosil) was allowed to react in the solid phase. The crystal structure of AES-18 was elucidated by the charge-flipping method using powder X-ray diffraction data, and the obtained structure was refined by a combination with the Rietveld method and the maximum entropy method (MEM). The structure analyses showed a tetragonal symmetry with a = 0.912738(3) nm, c = 1.628120(8) nm, and the space group P4{sub 2}/mnc. Two silicate layers composed of Q{sup 3} local structure [(-SiO){sub 3}Si-OH], 7-coordinated Sr{sup 2+} cations, and K{sup +} cations were included in a unit cell, and a Sr{sub 4}(OH){sub 17} cluster was formed between adjacent silicate layers. The framework topology of AES-18 containing 4- and 8-Si-membered rings was similar to that of paracelsian.
Performance Analysis of Phase Controlled Unidirectional and Bidirectional AC Voltage Controllers
Directory of Open Access Journals (Sweden)
Abdul Sattar Larik
2011-01-01
Full Text Available AC voltage controllers are used to vary the output ac voltage from a fixed ac input source. They are also commonly called ac voltage regulators or ac choppers. The output voltage is either controlled by PAC (Phase Angle Control method or on-off control method. Due to various advantages of ac voltage controllers, such as high efficiency, simplicity, low cost and ability to control large amount of power they efficiently control the speed of ac motors, light dimming and industrial heating, etc. These converters are variable structure systems and generate harmonics during the operation which will affect the power quality when connected to system network. During the last couple of years, a number of new semiconductor devices and various power electronic converters has been introduced. Accordingly the subject of harmonics and its problems are of great concern to power industry and customers. In this research work, initially the simulation models of single phase unidirectional and bidirectional ac voltage controllers were developed by using MATLAB software. The harmonics of these models are investigated by simulation. In the end, the harmonics were also analyzed experimentally. The simulated as well as experimental results are presented.
Importance of Attenuation Correction (AC) for Small Animal PET Imaging
DEFF Research Database (Denmark)
El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær
2012-01-01
was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...
THE ACS NEARBY GALAXY SURVEY TREASURY
International Nuclear Information System (INIS)
Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.
2009-01-01
The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.
Predicting AC loss in practical superconductors
International Nuclear Information System (INIS)
Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P
2006-01-01
Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time
The anion exchanger Ae2 is required for enamel maturation in mouse teeth
Lyaruu, D.M.; Bronckers, A.L.J.J.; Mulder, L.; Mardones, P.; Medina, J.F.; Kellokumpu, S.; Oude Elferink, R.P.J.; Everts, V.
2008-01-01
One of the mechanisms by which epithelial cells regulate intracellular pH is exchanging bicarbonate for Cl-. We tested the hypothesis that in ameloblasts the anion exchanger-2 (Ae2) is involved in pH regulation during maturation stage amelogenesis. Quantitative X-ray microprobe mineral content
The anion exchanger Ae2 is required for enamel maturation in mouse teeth
Lyaruu, D. M.; Bronckers, A. L. J. J.; Mulder, L.; Mardones, P.; Medina, J. F.; Kellokumpu, S.; Oude Elferink, R. P. J.; Everts, V.
2008-01-01
One of the mechanisms by which epithelial cells regulate intracellular pH is exchanging bicarbonate for Cl(-). We tested the hypothesis that in ameloblasts the anion exchanger-2 (Ae2) is involved in pH regulation during maturation stage amelogenesis. Quantitative X-ray microprobe mineral content
International Nuclear Information System (INIS)
Sakai, Takeshi; Nakagawa, Koji; Nakajima, Hiroshi; Itoh, Akihide; Ji, Shan; Haraguchi, Hiroki
2002-01-01
Major-to-ultratrace elements in deep-seawater salts were determined by ICP-AES and ICP-MS, after they were separated into the water-soluble, acid-soluble, and insoluble particle components. Deep-seawater salts were prepared from seawater collected at 344 m deep near the off-shore of Cape Muroto in Kochi Prefecture. The major and minor elements in salts were determined by ICP-AES after appropriate dilution with pure water. Trace and ultratrace elements in the water-soluble and acid-soluble components were preconcentrated by a chelating resin preconcentration method. In addition, the major to-ultratrace elements in the insoluble particle component were determined by ICP-AES and ICP-MS, after acid-digestion using HNO 3 /HF/HClO 4 . As a result, 21-35 elements in deep-seawater salts could be determined over the wide concentration range. It was found that the elements, such as Al, V, Fe, Mn, Co, Cu, Zn, and rare earth elements, were more abundant in the acid-soluble component of deep-seawater salts, which may play some essential roles in physiological effectiveness for intake of salt. (author)
Scaling and universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Schrøder, Thomas; Dyre, Jeppe
2000-01-01
Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...
Chemical separation and ICP-AES determination of rare earths in Al2O3 matrix
International Nuclear Information System (INIS)
Argekar, A.A.; Kulkarni, M.J.; Page, A.G.; Manchanda, V.K.
2005-01-01
A chemical separation-ICP-AES method has been developed for determination of rare earths in alumina matrix. The quantitative separation of rare earths has also been confirmed using radiotracers. (author)
Directory of Open Access Journals (Sweden)
Mukherjee Sunil K
2010-06-01
Full Text Available Abstract Background Geminiviruses are emerging plant viruses that infect a wide variety of vegetable crops, ornamental plants and cereal crops. They undergo recombination during co-infections by different species of geminiviruses and give rise to more virulent species. Antiviral strategies targeting a broad range of viruses necessitate a detailed understanding of the basic biology of the viruses. ToLCKeV, a virus prevalent in the tomato crop of Kerala state of India and a member of genus Begomovirus has been used as a model system in this study. Results AC3 is a geminiviral protein conserved across all the begomoviral species and is postulated to enhance viral DNA replication. In this work we have successfully expressed and purified the AC3 fusion proteins from E. coli. We demonstrated the higher order oligomerization of AC3 using sucrose gradient ultra-centrifugation and gel-filtration experiments. In addition we also established that ToLCKeV AC3 protein interacted with cognate AC1 protein and enhanced the AC1-mediated ATPase activity in vitro. Conclusions Highly hydrophobic viral protein AC3 can be purified as a fusion protein with either MBP or GST. The purification method of AC3 protein improves scope for the biochemical characterization of the viral protein. The enhancement of AC1-mediated ATPase activity might lead to increased viral DNA replication.
Preliminary study on AC superconducting machines
International Nuclear Information System (INIS)
Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.
1988-01-01
This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed
Study of determination of microelements in Chinese herbal medicine by AES
International Nuclear Information System (INIS)
Wei Jiuning
2002-01-01
An AES method has been proposed for micro elements analysis in Chinese herbal medicine and the pretreatments of samples are discussed in detail. The method is proved accurate by analyzing peach leaves with the level of the national standard substance and by comparing results using different methods: the data obtained are accurate and reliable and the method can be used for determination 10 kinds of micro elements in Chinese herbal medicine
21 CFR 880.5500 - AC-powered patient lift.
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...
Electron and ion beam degradation effects in AES analysis of silicon nitride thin films
International Nuclear Information System (INIS)
Fransen, F.; Vanden Berghe, R.; Vlaeminck, R.; Hinoul, M.; Remmerie, J.; Maes, H.E.
1985-01-01
Silicon nitride films are currently investigated by AES combined with ion profiling techniques for their stoichiometry and oxygen content. During this analysis, ion beam and primary electron effects were observed. The effect of argon ion bombardment is the preferential sputtering of nitrogen, forming 'covalent' silicon at the surface layer (AES peak at 91 eV). The electron beam irradiation results in a decrease of the covalent silicon peak, either by an electron beam annealing effect in the bulk of the silicon nitride film, or by an ionization enhanced surface diffusion process of the silicon (electromigration). By the electron beam annealing, nitrogen species are liberated in the bulk of the silicon nitride film and migrate towards the surface where they react with the covalent silicon. The ionization enhanced diffusion originates from local charging of the surface, induced by the electron beam. (author)
Cooperative Frequency Control for Autonomous AC Microgrids
DEFF Research Database (Denmark)
Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.
2015-01-01
Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....
CHANDRA HIGH-ENERGY TRANSMISSION GRATING SPECTRUM OF AE AQUARII
International Nuclear Information System (INIS)
Mauche, Christopher W.
2009-01-01
The nova-like cataclysmic binary AE Aqr, which is currently understood to be a former supersoft X-ray binary and current magnetic propeller, was observed for over two binary orbits (78 ks) in 2005 August with the High-Energy Transmission Grating (HETG) on board the Chandra X-ray Observatory. The long, uninterrupted Chandra observation provides a wealth of details concerning the X-ray emission of AE Aqr, many of which are new and unique to the HETG. First, the X-ray spectrum is that of an optically thin multi-temperature thermal plasma; the X-ray emission lines are broad, with widths that increase with the line energy from σ ∼ 1 eV (510 km s -1 ) for O VIII to σ ∼ 5.5 eV (820 km s -1 ) for Si XIV; the X-ray spectrum is reasonably well fit by a plasma model with a Gaussian emission measure distribution that peaks at log T(K) = 7.16, has a width σ = 0.48, an Fe abundance equal to 0.44 times solar, and other metal (primarily Ne, Mg, and Si) abundances equal to 0.76 times solar; and for a distance d = 100 pc, the total emission measure EM = 8.0 x 10 53 cm -3 and the 0.5-10 keV luminosity L X = 1.1 x 10 31 erg s -1 . Second, based on the f/(i + r) flux ratios of the forbidden (f), intercombination (i), and recombination (r) lines of the Heα triplets of N VI, O VII, and Ne IX measured by Itoh et al. in the XMM-Newton Reflection Grating Spectrometer spectrum and those of O VII, Ne IX, Mg XI, and Si XIII in the Chandra HETG spectrum, either the electron density of the plasma increases with temperature by over three orders of magnitude, from n e ∼ 6 x 10 10 cm -3 for N VI [log T(K) ∼ 6] to n e ∼ 1 x 10 14 cm -3 for Si XIII [log T(K) ∼ 7], and/or the plasma is significantly affected by photoexcitation. Third, the radial velocity of the X-ray emission lines varies on the white dwarf spin phase, with two oscillations per spin cycle and an amplitude K ∼ 160 km s -1 . These results appear to be inconsistent with the recent models of Itoh et al., Ikhsanov, and
Diagnostics of the Fermilab Tevatron using an AC dipole
Energy Technology Data Exchange (ETDEWEB)
Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)
2008-08-01
The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.
Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters
DEFF Research Database (Denmark)
Qin, Zian
. The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...
AC power flow importance measures considering multi-element failures
International Nuclear Information System (INIS)
Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling
2017-01-01
Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.
Systémový pohled na klub AC Sparta
Čečák, František
2015-01-01
Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...
Generic demonstration plant study (A/E package)
International Nuclear Information System (INIS)
Molzen, D.F.
1979-01-01
Molzen--Corbin and Associates, Albuquerque, New Mexico, under contract to Sandia Laboratories, has prepared preliminary drawings, descriptive material and a scale model of the demonstration plant. This information will be made available to A/E firms to assist them in the preparation of proposals for complete construction plans and specifications. The four categories for which preliminary work has been prepared consist of structural work, mechanical work, electrical work, and cost estimates. In addition, preliminary specifications, including a written description of the facility consisting of mechanical electrical systems and operations, a description of the safety features, the basic design criteria, three-dimensional sketches, and a scale model of the design have been prepared. The preliminary drawings indicate the required minimum wall thicknesses, overall dimensions and the necessary layout of the removable concrete blocks and slabs required for radiation protection and control
Energy Technology Data Exchange (ETDEWEB)
Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College
1991-04-30
This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.
Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals
Energy Technology Data Exchange (ETDEWEB)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org
2002-12-01
The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.
ac propulsion system for an electric vehicle
Geppert, S.
1980-01-01
It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.
International Nuclear Information System (INIS)
Singh, A.K.; Mehta, H.R.; Bhattacharya, S.
2003-01-01
Acoustic Emission data is very weak and passive in nature that leads to a challenging task to separate AE data from noise. This paper illuminates the work done of post analysis of acoustic emission data of seal plug leakage of operating PHWR, NAPS-2, Narora and Fatigue Crack initiation of three-point bend sample using cluster analysis and artificial neural network (ANN). First the known AE data generated in lab by PCB debonding and pencil leak break were analyzed using ANN to get the confidence. After that the AE data acquired by scanning all 306-coolant channels at NAPS-2 was sorted out in five separate clusters for different leakage rate and background noise. Fatigue crack initiation, AE data generated in MSD lab on three-point bend sample was clustered in ten separate clusters in which one cluster was having 98% AE data of crack initiation period noted with the help of travelling microscope but remaining clusters indicating AE data of different sources and noise. The above data was further analysed with self organizing map of Artificial Neural Network. (author)
Directory of Open Access Journals (Sweden)
Cheong Huat Tan
2017-05-01
Full Text Available Zika (ZIKV and Chikungunya (CHIKV viruses are emerging Aedes-borne viruses that are spreading outside their known geographic range and causing wide-scale epidemics. It has been reported that these viruses can be transmitted efficiently by Ae. aegypti. Recent studies have shown that Ae. aegypti when transinfected with certain Wolbachia strains shows a reduced replication and dissemination of dengue (DENV, Chikungunya (CHIKV, and Yellow Fever (YFV viruses. The aim of this study was to determine whether the wMel strain of Wolbachia introgressed onto a Singapore Ae. aegypti genetic background was able to limit ZIKV and CHIKV infection in the mosquito.Five to seven-day old mosquitoes either infected or uninfected with wMel Wolbachia were orally infected with a Ugandan strain of ZIKV and several outbreak strains of CHIKV. The midgut and salivary glands of each mosquito were sampled at days 6, 9 and 13 days post infectious blood meal to determine midgut infection and salivary glands dissemination rates, respectively. In general, all wild type Ae. aegypti were found to have high ZIKV and CHIKV infections in their midguts and salivary glands, across all sampling days, compared to Wolbachia infected counterparts. Median viral titre for all viruses in Wolbachia infected mosquitoes were significantly lower across all time points when compared to wild type mosquitoes. Most significantly, all but two and one of the wMel infected mosquitoes had no detectable ZIKV and CHIKV, respectively, in their salivary glands at 14 days post-infectious blood meal.Our results showed that wMel limits both ZIKV and CHIKV infection when introgressed into a Singapore Ae. aegypti genetic background. These results also strongly suggest that female Aedes aegypti carrying Wolbachia will have a reduced capacity to transmit ZIKV and CHIKV.
Systémový pohled na klub AC Sparta
Čečák, František
2014-01-01
Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...
Ortiz, Diana I; Kang, Wenli; Weaver, Scoti C
2008-11-01
To test the hypothesis that enzootic and epidemic Venezuelan equine encephalitis (VEE) complex alphaviruses can infect and be transmitted by Ae. aegypti, we conducted a series of experimental infection studies. One set of experiments tested the susceptibility of geographic strains of Ae. aegypti from Peru and Texas (U.S.A.) for epidemic (subtype IC) and enzootic (subtype ID) strains from Colombia/Venezuela, whereas the second set of experiments tested the susceptibility of Ae. aegypti from Iquitos, Peru, to enzootic VEE complex strains (subtypes ID, IIIC, and IIID) isolated in the same region, at different infectious doses. Experimental infections using artificial bloodmeals suggested that Ae. aegypti mosquitoes, particularly the strain from Iquitos, Peru, is moderately to highly susceptible to all of these VEE complex alphaviruses. The occurrence of enzootic VEE complex viruses circulating endemically in Iquitos suggests the possibility of a dengue-like transmission cycle among humans in tropical cities.
Advanced reliability improvement of AC-modules (ARIA)
International Nuclear Information System (INIS)
Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.
2001-09-01
The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string
Mapa acústico parcial de Benetusser
MORILLA CASTELLANOS, EMILIO
2012-01-01
Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...
DEFF Research Database (Denmark)
Liu, Xiong; Wang, Peng; Loh, Poh Chiang
2011-01-01
This paper proposes an approach for DC-link second-order harmonic power cancellation in single-phase AC/DC/AC converter with reduced number of switches. The proposed six-switch converter has two bridges with three switches in each of them, where the middle switch in each bridge is shared by the A...
AC conductivity of a quantum Hall line junction
International Nuclear Information System (INIS)
Agarwal, Amit; Sen, Diptiman
2009-01-01
We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.
International Nuclear Information System (INIS)
King, D.S.; Cox, A.N.; Hodson, S.W.
1975-01-01
Calculations indicate that AC Andromedae is population I rather than population II. A mass and radius for this star are calculated using a new set of opacities for the Kippenhahn Ia mixture. It is concluded that the mass is too high for an ordinary RR Lyrae star. (BJG)
ac18 is not essential for the propagation of Autographa californica multiple nucleopolyhedrovirus
International Nuclear Information System (INIS)
Wang Yanjie; Wu Wenbi; Li Zhaofei; Yuan Meijin; Feng Guozhong; Yu Qian; Yang Kai; Pang Yi
2007-01-01
orf18 (ac18) of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is a highly conserved gene in lepidopteran nucleopolyhedroviruses, but its function remains unknown. In this study, an ac18 knockout AcMNPV bacmid was generated to determine the role of ac18 in baculovirus life cycle. After transfection of Sf-9 cells, the ac18-null mutant showed similar infection pattern to the parent virus and the ac18 repair virus with respect to the production of infectious budded virus, occlusion bodies, or the formation of nucleocapsids as visualized by electron microscopy. The deletion mutant did not reduce AcMNPV infectivity for Trichoplusia ni in LD 50 bioassay; however, it did take 24 h longer for deleted mutant to kill T. ni larvae than wild-type virus in LT 50 bioassay. Our results demonstrate that ac18 is not essential for viral propagation both in vitro and in vivo, but it may play a role in efficient virus infection in T. ni larvae
Implementation of T-box/T/sup -1/-box based AES design on latest xilinx fpga
International Nuclear Information System (INIS)
Kundi, D.E.; Aziz, A.
2015-01-01
This work presents an efficient implementation of the AES (Advance Encryption Standard) based on Tbox/T-1-box design for both the encryption and decryption on FPGA (Field Programmable Gate Array). The proposed architecture not only make efficient use of full capacity of dedicated 32 Kb BRAM (Block RAM) of latest Xilinx FPGAs (Virtex-5, Virtex-6 and 7 Series) but also saves considerable amount of BRAM and logical resources by using multiple accesses from single BRAM in one cycle of system clock as compared to conventional LUT (Look-Up-Table) techniques. The proposed T-box/T-1-box based AES design for both the encryption and decryption fits into just 4 BRAMs on FPGA and results in good efficiency TPS (Throughput per Slice) with less power consumption. (author)
Gangadari, Bhoopal Rao; Ahamed, Shaik Rafi
2016-12-01
In this paper, we presented a novel approach of low energy consumption architecture of S-Box used in Advanced Encryption Standard (AES) algorithm using programmable second order reversible cellular automata (RCA 2 ). The architecture entails a low power implementation with minimal delay overhead and the performance of proposed RCA 2 based S-Box in terms of security is evaluated using the cryptographic properties such as nonlinearity, correlation immunity bias, strict avalanche criteria, entropy and also found that the proposed architecture is secure enough for cryptographic applications. Moreover, the proposed AES algorithm architecture simulation studies show that energy consumption of 68.726 nJ, power dissipation of 3.856 mW for 0.18- μm at 13.69 MHz and energy consumption of 29.408 nJ, power dissipation of 1.65 mW for 0.13- μm at 13.69 MHz. The proposed AES algorithm with RCA 2 based S-Box shows a reduction power consumption by 50 % and energy consumption by 5 % compared to best classical S-Box and composite field arithmetic based AES algorithm. Apart from that, it is also shown that RCA 2 based S-Boxes are dynamic in nature, invertible, low power dissipation compared to that of LUT based S-Box and hence suitable for Wireless Body Area Network (WBAN) applications.
Probable alpha and 14C cluster emission from hyper Ac nuclei
International Nuclear Information System (INIS)
Santhosh, K.P.
2013-01-01
A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)
Detection of Genetic Modification 'ac2' in Potato Foodstuffs
Directory of Open Access Journals (Sweden)
Petr Kralik
2009-01-01
Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.
Schmidt, Chris A; Comeau, Genevieve; Monaghan, Andrew J; Williamson, Daniel J; Ernst, Kacey C
2018-04-25
Transmission dynamics of mosquito-borne viruses such as dengue, Zika and chikungunya are affected by the longevity of the adult female mosquito. Environmental conditions influence the survival of adult female Aedes mosquitoes, the primary vectors of these viruses. While the association of temperature with Aedes mortality has been relatively well-explored, the role of humidity is less established. The current study's goals were to compile knowledge of the influence of humidity on adult survival in the important vector species Aedes aegypti and Ae. albopictus, and to quantify this relationship while accounting for the modifying effect of temperature. We performed a systematic literature review to identify studies reporting experimental results informing the relationships among temperature, humidity and adult survival in Ae. aegypti and Ae. albopictus. Using a novel simulation approach to harmonize disparate survival data, we conducted pooled survival analyses via stratified and mixed effects Cox regression to estimate temperature-dependent associations between humidity and mortality risk for these species across a broad range of temperatures and vapor pressure deficits. After screening 1517 articles, 17 studies (one in semi-field and 16 in laboratory settings) met inclusion criteria and collectively reported results for 192 survival experiments. We review and synthesize relevant findings from these studies. Our stratified model estimated a strong temperature-dependent association of humidity with mortality in both species, though associations were not significant for Ae. albopictus in the mixed effects model. Lowest mortality risks were estimated around 27.5 °C and 21.5 °C for Ae. aegypti and Ae. albopictus, respectively, and mortality increased non-linearly with decreasing humidity. Aedes aegypti had a survival advantage relative to Ae. albopictus in the stratified model under most conditions, but species differences were not significant in the mixed effects model
Izadpanah, Kaywan; Jaeger, Martin; Ogon, Peter; Südkamp, Norbert P.; Maier, Dirk
2015-01-01
An arthroscopically assisted technique for the treatment of acute acromioclavicular joint dislocations is presented. This pathology-based procedure aims to achieve anatomic healing of both the acromioclavicular ligament complex (ACLC) and the coracoclavicular ligaments. First, the acromioclavicular joint is reduced anatomically under macroscopic and radiologic control and temporarily transfixed with a K-wire. A single-channel technique using 2 suture tapes provides secure coracoclavicular stabilization. The key step of the procedure consists of the anatomic repair of the ACLC (“AC-Reco”). Basically, we have observed 4 patterns of injury: clavicular-sided, acromial-sided, oblique, and midportion tears. Direct and/or transosseous ACLC repair is performed accordingly. Then, an X-configured acromioclavicular suture tape cerclage (“AC-Bridge”) is applied under arthroscopic assistance to limit horizontal clavicular translation to a physiological extent. The AC-Bridge follows the principle of internal bracing and protects healing of the ACLC repair. The AC-Bridge is tightened on top of the repair, creating an additional suture-bridge effect and promoting anatomic ACLC healing. We refer to this combined technique of anatomic ACLC repair and protective internal bracing as the “AC-RecoBridge.” A detailed stepwise description of the surgical technique, including indications, technical pearls and pitfalls, and potential complications, is given. PMID:26052493
Honda, Atsushi; Nakamura, Yuji; Ohara, Hiroshi; Cao, Xin; Nomura, Hiroaki; Katagi, Jun; Wada, Takeshi; Izumi-Nakaseko, Hiroko; Ando, Kentaro; Sugiyama, Atsushi
2016-03-15
Cardiac effects of a prostagrandin EP4-receptor agonist ONO-AE1-329 were assessed in the halothane-anesthetized dogs under the monitoring of left ventricular pressure-volume relationship, which were compared with those of clinically recommended doses of dopamine, dobutamine and milrinone (n=4-5 for each treatment). ONO-AE1-329 was intravenously administered in doses of 0.3, 1 and 3 ng/kg/min for 10 min with a pause of 20 min. Dopamine in a dose of 3 µg/kg/min for 10 min, dobutamine in a dose of 1 µg/kg/min for 10 min and milrinone in a dose of 5 µg/kg/min for 10 min followed by 0.5 µg/kg/min for 10 min were intravenously administered. Low dose of ONO-AE1-329 increased the stroke volume. Middle dose of ONO-AE1-329 increased the cardiac output, left ventricular end-diastolic volume, ejection fraction, maximum upstroke/downstroke velocities of the left ventricular pressure and external work, but decreased the end-systolic pressure and internal work besides the change by the low dose. High dose of ONO-AE1-329 increased the heart rate and maximum elastance, but decreased the end-systolic volume besides the changes by the middle dose. Dopamine, dobutamine and milrinone exerted essentially similar cardiac effects to ONO-AE1-329, but they did not significantly change the end-diastolic volume, end-systolic volume, stroke volume, ejection fraction, end-systolic pressure, maximum elastance, external work or internal work. Thus, EP4-receptor stimulation by ONO-AE1-329 may have potential to better promote the passive ventricular filling than the conventional cardiotonic drugs, which could become a candidate of novel therapeutic strategy for the treatment of heart failure with preserved ejection fraction. Copyright © 2016 Elsevier B.V. All rights reserved.
García-Rejón, Julián E; López-Uribe, Mildred P; Loroño-Pino, María Alba; Arana-Guardia, Roger; Puc-Tinal, Maria; López-Uribe, Genny M; Coba-Tún, Carlos; Baak-Baak, Carlos M; Machain-Williams, Carlos; Reyes-Solis, Guadalupe C; Lozano-Fuentes, Saul; Saavedra-Rodriguez, Karla; Black, William C; Beaty, Barry J; Eisen, Lars
2012-12-01
We collected mosquito immatures from artificial containers during 2010-2011 from 26 communities, ranging in size from small rural communities to large urban centers, located in different parts of Yucatán State in southeastern México. The arbovirus vector Aedes (Stegomyia) aegypti was collected from all 26 examined communities, and nine of the communities also yielded another container-inhabiting Aedes mosquito: Aedes (Howardina) cozumelensis. The communities from which Ae. cozumelensis were collected were all small rural communities (holes as well as various artificial containers including metal cans, flower vases, buckets, tires, and a water storage tank. The co-occurrence with Ae. aegypti in small rural communities poses intriguing questions regarding linkages between these mosquitoes, including the potential for direct competition for larval development sites. Additional studies are needed to determine how commonly Ae. cozumelensis feeds on human blood and whether it is naturally infected with arboviruses or other pathogens of medical or veterinary importance. We also summarize the published records for Ae. cozumelensis, which are restricted to collections from México's Yucatán Peninsula and Belize, and uniformly represent geographic locations where Ae. aegypti can be expected to occur. © 2012 The Society for Vector Ecology.
Ammonia treated Mo/AC catalysts for CO hydrogenation with ...
Indian Academy of Sciences (India)
SHARIF F ZAMAN
the influence of acid treated AC as a support with K-Ni-. Mo active ... K-Ni-Mo/AC catalyst was more selective to oxygenates. (>40% ... mineral impurities (K, Si, Sn and Fe) <1%. ...... edge technical support with thanks Science and Technology.
Estimation of the Thurstonian model for the 2-AC protocol
DEFF Research Database (Denmark)
Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.
2012-01-01
. This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative......The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model...
System and method for determining stator winding resistance in an AC motor
Lu, Bin [Kenosha, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Theisen, Peter J [West Bend, WI
2011-05-31
A system and method for determining stator winding resistance in an AC motor is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of an AC motor. The circuit includes at least one contactor and at least one switch to control current flow and terminal voltages in the AC motor. The system also includes a controller connected to the circuit and configured to modify a switching time of the at least one switch to create a DC component in an output of the system corresponding to an input to the AC motor and determine a stator winding resistance of the AC motor based on the injected DC component of the voltage and current.
Lamin A/C might be involved in the EMT signalling pathway.
Zuo, Lingkun; Zhao, Huanying; Yang, Ronghui; Wang, Liyong; Ma, Hui; Xu, Xiaoxue; Zhou, Ping; Kong, Lu
2018-07-15
We have previously reported a heterogeneous expression pattern of the nuclear membrane protein lamin A/C in low- and high-Gleason score (GS) prostate cancer (PC) tissues, and we have now found that this change is not associated with LMNA mutations. This expression pattern appears to be similar to the process of epithelial to mesenchymal transition (EMT) or to that of mesenchymal to epithelial transition (MET). The role of lamin A/C in EMT or MET in PC remains unclear. Therefore, we first investigated the expression levels of and the associations between lamin A/C and several common EMT markers, such as E-cadherin, N-cadherin, β-catenin, snail, slug and vimentin in PC tissues with different GS values and in different cell lines with varying invasion abilities. Our results suggest that lamin A/C might constitute a type of epithelial marker that better signifies EMT and MET in PC tissue, since a decrease in lamin A/C expression in GS 4 + 5 cases is likely associated with the EMT process, while the re-expression of lamin A/C in GS 5 + 4 cases is likely linked with MET. The detailed GS better exhibited the changes in lamin A/C and the EMT markers examined. Lamin A/C overexpression or knockdown had an impact on EMT biomarkers in a cell model by direct regulation of β-catenin. Hence, we suggest that lamin A/C might serve as a reliable epithelial biomarker for the distinction of PC cell differentiation and might also be a fundamental factor in the occurrence of EMT or MET in PC. Copyright © 2018. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Yong Zhang
2006-11-01
Full Text Available Dating back to the first epidemic among injection drug users in 1989, the Yunnan province has had the highest number of human immunodeficiency virus type 1 (HIV-1 infections in China. However, the molecular epidemiology of HIV-1 in Yunnan has not been fully characterized.Using immunoassays, we identified 103,015 accumulated cases of HIV-1 infections in Yunnan between 1989 and 2004. We studied 321 patients representing Yunnan's 16 prefectures from four risk groups, 11 ethnic populations, and ten occupations. We identified three major circulating subtypes: C/CRF07_BC/CRF08_BC (53%, CRF01_AE (40.5%, and B (6.5% by analyzing the sequence of p17, which is part of the gag gene. For patients with known risk factors, 90.9% of injection drug users had C/CRF07_BC/CRF08_BC viruses, whereas 85.4% of CRF01_AE infections were acquired through sexual transmission. No distinct segregation of CRF01_AE viruses was found among the Dai ethnic group. Geographically, C/CRF07_BC/CRF08_BC was found throughout the province, while CRF01_AE was largely confined to the prefectures bordering Myanmar. Furthermore, C/CRF07_BC/CRF08_BC viruses were found to consist of a group of viruses, including C, CRF08_BC, CRF07_BC, and new BC recombinants, based on the characterization of their reverse transcriptase genes.This is the first report of a province-wide HIV-1 molecular epidemiological study in Yunnan. While C/CRF07_BC/CRF08_BC and CRF01_AE are codominant, the discovery of many sexually transmitted CRF01_AE cases is new and suggests that this subtype may lead to a new epidemic in the general Chinese population. We discuss implications of our results for understanding the evolution of the HIV-1 pandemic and for vaccine development.
Near Full-Length Identification of a Novel HIV-1 CRF01_AE/B/C Recombinant in Northern Myanmar.
Zhou, Yan-Heng; Chen, Xin; Liang, Yue-Bo; Pang, Wei; Qin, Wei-Hong; Zhang, Chiyu; Zheng, Yong-Tang
2015-08-01
The Myanmar-China border appears to be the "hot spot" region for the occurrence of HIV-1 recombination. The majority of the previous analyses of HIV-1 recombination were based on partial genomic sequences, which obviously cannot reflect the reality of the genetic diversity of HIV-1 in this area well. Here, we present a near full-length characterization of a novel HIV-1 CRF01_AE/B/C recombinant isolated from a long-distance truck driver in Northern Myanmar. It is the first description of a near full-length genomic sequence in Myanmar since 2003, and might be one of the most complicated HIV-1 chimeras ever detected in Myanmar, containing four CRF01_AE, six B segments, and five C segments separated by 14 breakpoints throughout its genome. The discovery and characterization of this new CRF01_AE/B/C recombinant indicate that intersubtype recombination is ongoing in Myanmar, continuously generating new forms of HIV-1. More work based on near full-length sequence analyses is urgently needed to better understand the genetic diversity of HIV-1 in these regions.
Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids
DEFF Research Database (Denmark)
Chiang Loh, Poh; Li, Ding; Kang Chai, Yi
2013-01-01
sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment.......This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...
Das, Suman; Sadique Uz Zaman, J. K. M.; Ghosh, Ranjan
2016-06-01
In Advanced Encryption Standard (AES), the standard S-Box is conventionally generated by using a particular irreducible polynomial {11B} in GF(28) as the modulus and a particular additive constant polynomial {63} in GF(2), though it can be generated by many other polynomials. In this paper, it has been shown that it is possible to generate secured AES S-Boxes by using some other selected modulus and additive polynomials and also can be generated randomly, using a PRNG like BBS. A comparative study has been made on the randomness of corresponding AES ciphertexts generated, using these S-Boxes, by the NIST Test Suite coded for this paper. It has been found that besides using the standard one, other moduli and additive constants are also able to generate equally or better random ciphertexts; the same is true for random S-Boxes also. As these new types of S-Boxes are user-defined, hence unknown, they are able to prevent linear and differential cryptanalysis. Moreover, they act as additional key-inputs to AES, thus increasing the key-space.
Biomimetic Syntheses of Callistrilones A-E via an Oxidative [3 + 2] Cycloaddition.
Guo, Yonghong; Zhang, Yuhan; Xiao, Mingxing; Xie, Zhixiang
2018-04-16
Concise total syntheses of callistrilones A-E have been achieved from 7 and commercially available α-phellandrene (8). The synthetic strategy, which was primarily inspired by the biogenetic hypothesis, was enabled by an oxidative [3 + 2] cycloaddition followed by a Michael addition and an intramolecular nucleophilic addition to construct the target molecules. Moreover, viminalin I was also synthesized, and its absolute configuration was unambiguously confirmed.
A Novel Image Cryptosystem Based on S-AES and Chaotic Map
Directory of Open Access Journals (Sweden)
Bai Lan
2015-01-01
Full Text Available This paper proposes a novel scheme based on simplified advanced encryption standard (S-AES for image encryption. Modified Arnold Map applied as diffusion technique for an image, and the key and dynamic S-box of encryption is generated by PWLCM. The goal is to balance rapidity and security of encryption. Experimental implementation has been done. This light encryption scheme shows resistance against chosen-plaintext attack and is suitable for sensor networks and IoT.
Neural network AE source location apart from structure size and material
Czech Academy of Sciences Publication Activity Database
Chlada, Milan; Převorovský, Zdeněk; Blaháček, Michal
2010-01-01
Roč. 28, - (2010), s. 99-107 ISSN 0730-0050. [European Conference on Acoustic Emission Testing 2010 /29./. Vídeň, 08.09.2010-10.09.2010] R&D Projects: GA ČR(CZ) GAP104/10/1430; GA MPO(CZ) FR-TI1/274 Institutional research plan: CEZ:AV0Z20760514 Keywords : AE source location * artificial neural network * arrival time profiles Subject RIV: BI - Acoustics http://www.ndt.net/search/abstract.php3?AbsID=10828
An Efficient Side-Channel Protected AES Implementation with Arbitrary Protection Order
Groß, Hannes; Mangard, Stefan; Korak, Thomas
2017-01-01
Passive physical attacks, like power analysis, pose a serious threat to the security of digital circuits. In this work, we introduce an efficient sidechannel protected Advanced Encryption Standard (AES) hardware design that is completely scalable in terms of protection order. Therefore, we revisit the private circuits scheme of Ishai et al. [13] which is known to be vulnerable to glitches. We demonstrate how to achieve resistance against multivariate higher-order attacks in the presence of gl...
The Effects of Theta and Gamma tACS on Working Memory and Electrophysiology
Directory of Open Access Journals (Sweden)
Anja Pahor
2018-01-01
Full Text Available A single blind sham-controlled study was conducted to explore the effects of theta and gamma transcranial alternating current stimulation (tACS on offline performance on working memory tasks. In order to systematically investigate how specific parameters of tACS affect working memory, we manipulated the frequency of stimulation (theta frequency vs. gamma frequency, the type of task (n-back vs. change detection task and the content of the tasks (verbal vs. figural stimuli. A repeated measures design was used that consisted of three sessions: theta tACS, gamma tACS and sham tACS. In total, four experiments were conducted which differed only with respect to placement of tACS electrodes (bilateral frontal, bilateral parietal, left fronto-parietal and right-fronto parietal. Healthy female students (N = 72 were randomly assigned to one of these groups, hence we were able to assess the efficacy of theta and gamma tACS applied over different brain areas, contrasted against sham stimulation. The pre-post/sham resting electroencephalogram (EEG analysis showed that theta tACS significantly affected theta amplitude, whereas gamma tACS had no significant effect on EEG amplitude in any of the frequency bands of interest. Gamma tACS did not significantly affect working memory performance compared to sham, and theta tACS led to inconsistent changes in performance on the n-back tasks. Active theta tACS significantly affected P3 amplitude and latency during performance on the n-back tasks in the bilateral parietal and right-fronto parietal protocols.
AC power losses in Bi-2223/Ag HTS tapes
International Nuclear Information System (INIS)
Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.
1998-01-01
Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour
Nuclear structure of {sup 231}Ac
Energy Technology Data Exchange (ETDEWEB)
Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)
2008-10-15
The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.
Statistical time lags in ac discharges
International Nuclear Information System (INIS)
Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F
2011-01-01
The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.
Statistical time lags in ac discharges
Energy Technology Data Exchange (ETDEWEB)
Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)
2011-04-06
The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms{sup -1}. The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.
MODIFIED AES WITH RANDOM S BOX GENERATION TO OVERCOME THE SIDE CHANNEL ASSAULTS USING CLOUD
Directory of Open Access Journals (Sweden)
M. Navaneetha Krishnan
2017-01-01
Full Text Available Development of any communication system with secure and complex cryptographic algorithms highly depends on concepts of data security which is crucial in the current technological world. The security and complexity of the cryptography algorithms need to get increased by randomization of secret keys. To overcome the issues associated to data security and for improvising it during encryption and decryption process over the encrypting device, a novel Secure Side Channel Assault Prevention (SSCAP approach has been projected which will eliminate outflow of side channel messages and also provides effective security over the encrypting device. An effective Enriched AES (E-AES encryption algorithm is proposed to reduce the side channel attack; the modified algorithm in this research shows its improvement in the Generation of Random Multiple S - Box (GRM S-Box which makes it hard to the attacks to break the text which is in encrypted form. Our novel SSCAP approach also improves the security over the original information; it widely minimizes the leakage of the side channel information. Attackers cannot easily get a clue about the proposed S-Box Generation technique. Our E-AES algorithm will be implemented in cloud environment thereby improving the cloud security. The proposed SSCAP approach is judged against the existing security based algorithms on the scale of encryption and decryption time, time taken for generating the key, and performance. The proposed work proves to outperform over all other methods used in the past.
A Very Compact AES-SPIHT Selective Encryption Computer Architecture Design with Improved S-Box
Directory of Open Access Journals (Sweden)
Jia Hao Kong
2013-01-01
Full Text Available The “S-box” algorithm is a key component in the Advanced Encryption Standard (AES due to its nonlinear property. Various implementation approaches have been researched and discussed meeting stringent application goals (such as low power, high throughput, low area, but the ultimate goal for many researchers is to find a compact and small hardware footprint for the S-box circuit. In this paper, we present our version of minimized S-box with two separate proposals and improvements in the overall gate count. The compact S-box is adopted with a compact and optimum processor architecture specifically tailored for the AES, namely, the compact instruction set architecture (CISA. To further justify and strengthen the purpose of the compact crypto-processor’s application, we have also presented a selective encryption architecture (SEA which incorporates the CISA as a part of the encryption core, accompanied by the set partitioning in hierarchical trees (SPIHT algorithm as a complete selective encryption system.
Study on AC loss measurements of HTS power cable for standardizing
Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi
2017-09-01
High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..
International Nuclear Information System (INIS)
Tsurutani, B.T.; Gonzalez, W.D.
1987-01-01
It is shown that high intensity (AE > 1,000 nT), long duration (T > 2 d) continuous auroral activity (HILDCAA) events are caused by outward (from the sun) propagating interplanetary Alfven wave trains. The Alfven waves are often (but not always) detected several days after major interplanetary events, such as shocks and solar wind density enhancements. Presumably magnetic reconnection between the southward components of the Alfven wave magnetic fields and magnetospheric fields is the mechanism for transfer of solar wind energy to the magnetosphere. If the stringent requirements for HILDCAA events are relaxed, there are many more AE events of this type. A brief inspection indicates that these are also related to interplanetary Alfvenic fluctuations. We therefore suggest that most auroral activity may be caused by reconnection associated with Alfven waves in the interplanetary medium. (author)
a.c. conductance study of polycrystal C60
International Nuclear Information System (INIS)
Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin
1995-01-01
The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))
Spatially and spectrally resolved 10 mu m emission in Herbig Ae/Be stars
van Boekel, R; Waters, LBFM; Dominik, C; Dullemond, CP; Tielens, AGGM; de Koter, A
We present new mid-infrared spectroscopy of the emission from warm circumstellar dust grains in the Herbig Ae stars HD 100546. HD 97048 and HD 104237, with a spatial resolution Of of approximate to0."9. We find that the emission in the UIR bands at 8.6, 11.3 and (HD 97048 only) 12.7 mum is extended
Erdmann, Nicole; Wölk, Christian; Schulze, Ingo; Janich, Christopher; Folz, Manuela; Drescher, Simon; Dittrich, Matthias; Meister, Annette; Vogel, Jürgen; Groth, Thomas; Dobner, Bodo; Langner, Andreas
2015-10-01
The synthesis of a new class of cationic lipids, tris(2-aminoethyl)amine-based α-branched fatty acid amides, is described resulting in a series of lipids with specific variations in the lipophilic as well as the hydrophilic part of the lipids. In-vitro structure/transfection relationships were established by application of complexes of these lipids with plasmid DNA (pDNA) to different cell lines. The α-branched fatty acid amide bearing two tetradecyl chains and two lysine molecules (T14diLys) in mixture with the co-lipid 1,2-di-[(9Z)-octadec-9-enoyl]-sn-glycero-3-phosphoethanolamine (DOPE) (1/2, n/n) exhibits effective pDNA transfer in three different cell lines, namely Hep-G2, A549, and COS-7. The presence of 10% serum during lipoplex incubation of the cells did not affect the transfection efficiency. Based on that, detailed investigations of the complexation of pDNA with the lipid formulation T14diLys/DOPE 1/2 (n/n) were carried out with respect to particle size and charge using dynamic light scattering (DLS), ζ-potential measurements, and transmission electron microscopy (TEM). Additionally, the lipoplex uptake was investigated by confocal laser scanning microscopy (CLSM). Overall, lipoplexes prepared from T14diLys/DOPE 1/2 (n/n) offer large potential as lipid-based polynucleotide carriers and further justify advanced examinations. Copyright © 2015 Elsevier B.V. All rights reserved.
Control of Power Converters in AC Microgrids
DEFF Research Database (Denmark)
Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede
2012-01-01
The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...
Droop-free Distributed Control for AC Microgrids
DEFF Research Database (Denmark)
Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.
2016-01-01
A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...
Effect of AC electric fields on the stabilization of premixed bunsen flames
Kim, Minkuk
2011-01-01
The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.
Algoritmo de cifrado simétrico AES : Aceleración de tiempo de cómputo sobre arquitecturas multicore
Pousa, Adrián
2011-01-01
El objetivo de este trabajo es mostrar la aceleración en el tiempo de cómputo del algoritmo criptográfico Advanced Encryption Standard (AES) con clave de tamaño 128bits, que se obtiene al aprovechar el paralelismo que proveen las arquitecturas multicores actuales utilizando herramientas de programación paralela. AES es uno de los algoritmos de criptografía más usados en la actualidad, con el crecimiento de las redes y la información que se maneja hoy en día puede ser necesario cifra...
Objectives and status of development of AC600
International Nuclear Information System (INIS)
Zhao Chengkun
1997-01-01
AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600
Introduction of hvdc transmission into a predominantly ac network
Energy Technology Data Exchange (ETDEWEB)
Casson, W; Last, F H; Huddart, K W
1966-02-01
Methods for reinforcing the supply network, including systems employing dc links, without introducing a new primary network are briefly described. The arrangement for dc links is outlined and the application to an existing ac system is considered. The economics of ac and dc for reinforcement schemes are briefly mentioned.
21 CFR 880.5510 - Non-AC-powered patient lift.
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is a hydraulic, battery, or mechanically powered device, either fixed or mobile, used to lift and transport a...
Effect of temperature on the AC impedance of protein
Indian Academy of Sciences (India)
The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...
Comparision of ICP-OES and MP-AES in determing soil nutrients by Mechlich3 method
Tonutare, Tonu; Penu, Priit; Krebstein, Kadri; Rodima, Ako; Kolli, Raimo; Shanskiy, Merrit
2014-05-01
Accurate, routine testing of nutrients in soil samples is critical to understanding soil potential fertility. There are different factors which must be taken into account selecting the best analytical technique for soil laboratory analysis. Several techniques can provide adequate detection range for same analytical subject. In similar cases the choise of technique will depend on factors such as sample throughput, required infrastructure, ease of use, used chemicals and need for gas supply and operating costs. Mehlich 3 extraction method is widely used for the determination of the plant available nutrient elements contents in agricultural soils. For determination of Ca, K, and Mg from soil extract depending of laboratory ICP and AAS techniques are used, also flame photometry for K in some laboratories. For the determination of extracted P is used ICP or Vis spectrometry. The excellent sensitivity and wide working range for all extracted elements make ICP a nearly ideal method, so long as the sample throughput is big enough to justify the initial capital outlay. Other advantage of ICP techniques is the multiplex character (simultaneous acquisition of all wavelengths). Depending on element the detection limits are in range 0.1 - 1000 μg/L. For smaller laboratories with low sample throughput requirements the use of AAS is more common. Flame AAS is a fast, relatively cheap and easy technique for analysis of elements. The disadvantages of the method is single element analysis and use of flammable gas, like C2H2 and oxidation gas N2O for some elements. Detection limits of elements for AAS lays from 1 to 1000 μg/L. MP-AES offers a unique alternative to both, AAS and ICP-OES techniques with its detection power, speed of analysis. MP-AES is quite new, simple and relatively inexpensive multielemental technique, which is use self-sustained atmospheric pressure microwave plasma (MP) using nitrogen gas generated by nitrogen generator. Therefore not needs for argon and
Directory of Open Access Journals (Sweden)
Vinod Kumar Singh
2016-09-01
Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.
International Nuclear Information System (INIS)
Schneider, Jochen M.; Music, Denis; Sun Zhimei
2005-01-01
We have studied the effect of the valence electron concentration, on the bulk modulus and the chemical bonding in Ta 2 AC and Zr 2 AC (A=Al, Si, and P) by means of ab initio calculations. Our equilibrium volume and the hexagonal ratio (c/a) agree well (within 2.7% and 1.2%, respectively) with previously published experimental data for Ta 2 AlC. The bulk moduli of both Ta 2 AC and Zr 2 AC increase as Al is substituted with Si and P by 13.1% and 20.1%, respectively. This can be understood since the substitution is associated with an increased valence electron concentration, resulting in band filling and an extensive increase in cohesion
Low ac loss geometries in YBCO coated conductors and impact on conductor stability
Energy Technology Data Exchange (ETDEWEB)
Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.
Measurement of ac electrical characteristics of SSC dipole magnets at Brookhaven
International Nuclear Information System (INIS)
Smedley, K.
1992-04-01
The SSC collider is designed to have circumference of 87 km. The superconducting magnets along the collider ring are grouped into ten sectors. Each sector, a string of average length of 8.7 km,m is powered by one power source located near the center of the sector. Because of the alternating-current (ac) electrical characteristics of the magnets, the power supply ripple currents and transients form a time and space distribution in the magnet string which affects particle motions. Additionally, since the power supply load is a magnet string, the current regulation loop design is highly dependent upon the ac electrical characteristics of the magnets. A means is needed to accurately determine the ac electrical characteristics of the superconducting magnets. The ac characteristics of magnets will be used to predict the ripple distribution of the long string of superconducting magnets. Magnet ac characteristics can also provide necessary information for the regulation loop design. This paper presents a method for measuring the ac characteristics of superconducting magnets. Two collider dipole magnets, one superconducting and one at room temperature, were tested at Brookhaven National Lab
Flame spread over inclined electrical wires with AC electric fields
Lim, Seung J.; Park, Sun H.; Park, Jeong; Fujita, Osamu; Keel, Sang I.; Chung, Suk-Ho
2017-01-01
Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field
DC and AC biasing of a transition edge sensor microcalorimeter
International Nuclear Information System (INIS)
Cunningham, M.F.; Ullom, J.N.; Miyazaki, T.; Drury, O.; Loshak, A.; Berg, M.L. van den; Labov, S.E.
2002-01-01
We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions
Coordination Control Strategy for AC/DC Hybrid Microgrids in Stand-Alone Mode
Directory of Open Access Journals (Sweden)
Dwi Riana Aryani
2016-06-01
Full Text Available Interest in DC microgrids is rapidly increasing along with the improvement of DC power technology because of its advantages. To support the integration process of DC microgrids with the existing AC utility grids, the form of hybrid AC/DC microgrids is considered for higher power conversion efficiency, lower component cost and better power quality. In the system, AC and DC portions are connected through interlink bidirectional AC/DC converters (IC with a proper control system and power management. In the stand-alone operation mode of AC/DC hybrid microgrids, the control of power injection through the IC is crucial in order to maintain the system security. This paper mainly deals with a coordination control strategy of IC and a battery energy storage system (BESS converter under stand-alone operation. A coordinated control strategy for the IC, which considers the state of charge (SOC level of BESS and the load shedding scheme as the last resort, is proposed to obtain better power sharing between AC and DC subgrids. The scheme will be tested with a hybrid AC/DC microgrid, using the tool of the PSCAD/EMTDC software.
Adlar, F. R.; Bela, B.
2017-08-01
To anticipate the potential use of anti-integrase drugs in Indonesia for treatment of HIV-1 infection, the development of a drug resistance genotyping assay for anti-integrase is crucial in identifying the genetic drug resistance profile of Indonesian HIV-1 strains. This experiment aimed to amplify a target region in the integrase gene of Indonesian HIV-1 subtypes CRF01_AE and B that contain genetic mutations known to confer resistance to anti-integrase drug. Eleven archived plasma samples from individuals living with HIV-1 were obtained from the Virology and Cancer Pathobiology Research Center for Health Service (VCPRC FKUI-RSCM) laboratory. One of the plasma samples contained HIV-1 subtype B, and the remaining plasma samples contained subtype CRF01_AE. The target regions for all samples were amplified through RT-PCR, with an annealing temperature of 55 °C, using the primer pair AE_POL 4086F and AE_POL 5232R that were designed by VCPRC FKUI-RSCM. The results of this experiment show that 18.2% (2/11) of the samples were successfully amplified using the one-step RT-PCR. While the primer pair was effective in amplifying the target region in the integrase gene sequence for subtype B (100%; 1/1), it had a low efficacy (10%, 1/10) for subtype CRF01_AE. In conclusion, the primer pair can be used to amplify the target region in Indonesian HIV-1 strain subtypes CRF01_AE and B. However, optimization of the PCR condition and an increased number of samples would help to determine an accurate representation of the efficacy of the primer pair.
Directory of Open Access Journals (Sweden)
María del Rosario Rodríguez-Guillén
2009-02-01
Full Text Available OBJECTIVE: To asses the association between intake of folate and B vitamins and the incidence of spontaneous abortion (SA according to the maternal methylenetetrahydrofolate reductase (MTHFR polymorphisms (677 C>T and 1298 A>C. MATERIAL AND METHODS: We conducted a nested case-control study within a perinatal cohort of women recruited in the state of Morelos, Mexico. Twenty-three women with SA were compared to 74 women whose pregnancy survived beyond week 20th. Intake of folate and B vitamins respectively, was estimated using a validated food frequency questionnaire. Maternal MTHFR polymorphisms were determined by PCR-RFLP and serum homocysteine levels by HPLC. RESULTS: Carriers of MTHFR 677TT and 1298AC genotypes respectively showed an increased risk of SA (OR 677TT vs. CC/CT=5.0; 95% CI: 1.2, 20.9 and OR 1298 AC vs. AA=5.5; 95% CI: 1.1, 26.6. CONCLUSIONS: Our results support the role of MTHFR polymorphisms as a risk factor for SA, regardless of dietary intake of B vitamins.OBJETIVO: Evaluar la asociación entre aborto espontáneo (AE y el consumo dietético de vitaminas B en mujeres mexicanas portadoras de los polimorfismos de la metilentetrahidrofolato reductasa (MTHFR (677 C>T y 1298 A>C. MATERIAL Y MÉTODOS: Mediante un diseño de casos y controles anidados en una cohorte, se comparó la ingesta dietética materna de vitaminas B y folato, los polimorfismos maternos de la MTHFR y la concentración sérica de homocisteina de 23 casos de AE ( 20 semanas. RESULTADOS: Las portadoras de los genotipos MTHFR 677TT y 1298AC presentaron un incremento significativo en el riesgo de AE (RM 677TT vs. CC/CT=5.0; IC 95%: 1.2, 20.9 RM 1298 AC vs. AA=5.5; IC95%: 1.1, 26.6, respectivamente. CONCLUSIONES: Nuestros resultados apoyan el papel de la mutación de la MTHFR como posible factor de riesgo para el AE, independientemente del consumo de vitaminas B.
Dong, Zhijun; Yu, Yanwen; Li, Shenghui; Wang, Juan; Tang, Saijun; Huang, Rongfeng
2016-01-04
Increasing evidence has revealed that abscisic acid (ABA) negatively modulates ethylene biosynthesis, although the underlying mechanism remains unclear. To identify the factors involved, we conducted a screen for ABA-insensitive mutants with altered ethylene production in Arabidopsis. A dominant allele of ABI4, abi4-152, which produces a putative protein with a 16-amino-acid truncation at the C-terminus of ABI4, reduces ethylene production. By contrast, two recessive knockout alleles of ABI4, abi4-102 and abi4-103, result in increased ethylene evolution, indicating that ABI4 negatively regulates ethylene production. Further analyses showed that expression of the ethylene biosynthesis genes ACS4, ACS8, and ACO2 was significantly decreased in abi4-152 but increased in the knockout mutants, with partial dependence on ABA. Chromatin immunoprecipitation-quantitative PCR assays showed that ABI4 directly binds the promoters of these ethylene biosynthesis genes and that ABA enhances this interaction. A fusion protein containing the truncated ABI4-152 peptide accumulated to higher levels than its full-length counterpart in transgenic plants, suggesting that ABI4 is destabilized by its C terminus. Therefore, our results demonstrate that ABA negatively regulates ethylene production through ABI4-mediated transcriptional repression of the ethylene biosynthesis genes ACS4 and ACS8 in Arabidopsis. Copyright © 2016 The Author. Published by Elsevier Inc. All rights reserved.
D'Andrea, M.; Argan, A.; Lotti, S.; Macculi, C.; Piro, L.; Biasotti, M.; Corsini, D.; Gatti, F.; Torrioli, G.
2016-07-01
The ATHENA observatory is the second large-class mission in ESA Cosmic Vision 2015-2025, with a launch foreseen in 2028 towards the L2 orbit. The mission addresses the science theme "The Hot and Energetic Universe", by coupling a high-performance X-ray Telescope with two complementary focal-plane instruments. One of these is the X-ray Integral Field Unit (X-IFU): it is a TES based kilo-pixel order array able to provide spatially resolved high-resolution spectroscopy (2.5 eV at 6 keV) over a 5 arcmin FoV. The X-IFU sensitivity is degraded by the particles background expected at L2 orbit, which is induced by primary protons of both galactic and solar origin, and mostly by secondary electrons. To reduce the background level and enable the mission science goals, a Cryogenic Anticoincidence (CryoAC) detector is placed address the final design of the CryoAC. It will verify some representative requirements at single-pixel level, especially the detector operation at 50 mK thermal bath and the threshold energy at 20 keV. To reach the final DM design we have developed and tested the AC-S7 prototype, with 1 cm2 absorber area sensed by 65 Ir TESes. Here we will discuss the pulse analysis of this detector, which has been illuminated by the 60 keV line from a 241Am source. First, we will present the analysis performed to investigate pulses timings and spectrum, and to disentangle the athermal component of the pulses from the thermal one. Furthermore, we will show the application to our dataset of an alternative method of pulse processing, based upon Principal Component Analysis (PCA). This kind of analysis allow us to recover better energy spectra than achievable with traditional methods, improving the evaluation of the detector threshold energy, a fundamental parameter characterizing the CryoAC particle rejection efficiency.
Here Be Dragons: Characterization of ACS/WFC Scattered Light Anomalies
Porterfield, B.; Coe, D.; Gonzaga, S.; Anderson, J.; Grogin, N.
2016-11-01
We present a study characterizing scattered light anomalies that occur near the edges of Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) images. We inspected all 8,573 full-frame ACS/WFC raw images with exposure times longer than 350 seconds obtained in the F606W and F814W filters from 2002 to October 2013. We visually identified two particular scattered light artifacts known as "dragon's breath" and edge glow. Using the 2MASS point source catalog and Hubble Guide Star Catalog (GSC II), we identified the stars that caused these artifacts. The stars are all located in narrow bands ( 3" across) just outside the ACS/WFC field of view (2" - 16" away). We provide a map of these risky areas around the ACS/WFC detectors - users should avoid positioning bright stars in these regions when designing ACS/WFC imaging observations. We also provide interactive webpages which display all the image artifacts we identified, allowing users to see examples of the severity of artifacts they might expect for a given stellar magnitude at a given position relative to the ACS/WFC field of view. On average, 10th (18th) magnitude stars produce artifacts about 1,000 (100) pixels long. But the severity of these artifacts can vary strongly with small positional shifts (∼ 1"). The results are similar for both filters (F606W and F814W) when expressed in total fluence, or flux multiplied by exposure time.
The (related-key) impossible boomerang attack and its application to the AES block cipher
Lu, J.
2011-01-01
The Advanced Encryption Standard (AES) is a 128-bit block cipher with a user key of 128, 192 or 256 bits, released by NIST in 2001 as the next-generation data encryption standard for use in the USA. It was adopted as an ISO international standard in 2005. Impossible differential cryptanalysis and
Development of low AC loss windings for superconducting traction transformer
International Nuclear Information System (INIS)
Kamijo, H; Hata, H; Fukumoto, Y; Tomioka, A; Bohno, T; Yamada, H; Ayai, N; Yamasaki, K; Kato, T; Iwakuma, M; Funaki, K
2010-01-01
We have been developing a light weight and high efficiency superconducting traction transformer for railway rolling stock. We designed and fabricated a prototype superconducting traction transformer of a floor-mount type for Shinkansen rolling stock in 2004. We performed the type-test, the system-test, and the vibration-test. Consequently, we could verify that the transformer satisfied the requirement almost exactly as initially planned. However, there have been raised some problems to be solved to put superconducting traction transformer into practical use such that AC loss of the superconducting tape must be lower and the capacity of the refrigerator must be larger. Especially it is the most important to reduce the AC loss of superconducting windings for lightweight and high efficiency. The AC loss must be reduced near the theoretical value of superconducting tape with multifilament. In this study, we fabricated and evaluated the Bi2223 tapes as introduced various measures to reduce the AC loss. We confirmed that the AC loss of the narrow type of Bi2223 tapes with twist of filaments is lower, and we fabricated windings of this tape for use in superconducting traction transformer.
Hybrid AC-High Voltage DC Grid Stability and Controls
Yu, Jicheng
The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient
AC Calorimetric Design for Dynamic of Biological Materials
Shigeo Imaizumi
2006-01-01
We developed a new AC calorimeter for the measurement of dynamic specific heat capacity in liquids, including aqueous suspensions of biological materials. This method has several advantages. The first is that a high-resolution measurement of heat capacity, inmillidegrees, can be performed as a function of temperature, even with a very small sample. Therefore, AC calorimeter is a powerful tool to study critical behavior a tphase transition in biological materials. The second advantage is that ...
The learning styles of orthopedic residents, faculty, and applicants at an academic program.
Richard, Raveesh Daniel; Deegan, Brian Francis; Klena, Joel Christian
2014-01-01
To train surgeons effectively, it is important to understand how they are learning. The Kolb Learning Style Inventory (LSI) is based on the theory of experiential learning, which divides the learning cycle into 4 stages: active experimentation (AE), abstract conceptualization (AC), concrete experience, and reflective observation. The purpose of this investigation was to assess the learning styles of orthopedic residents, faculty, and applicants at an east-coast residency program. A total of 90 Kolb LSI, Version 3.1 surveys, and demographic questionnaires were distributed to all residency applicants, residents, and faculty at an academic program. Data collected included age, sex, type of medical school (MD or DO), foreign medical graduate status, and either year since college graduation, postgraduate year level (residents only), or years since completion of residency (faculty only). Seventy-one completed Kolb LSI surveys (14 residents, 14 faculty members, and 43 applicants) were recorded and analyzed for statistical significance. The most prevalent learning style among all participants was converging (53.5%), followed by accommodating (18.3%), diverging (18.3%), and assimilating (9.9%) (p = 0.13). The applicant and resident groups demonstrated a high tendency toward AE followed by AC. The faculty group demonstrated a high tendency toward AC followed by AE. None of the 24 subjects who were 26 years or under had assimilating learning styles, in significant contrast to the 12% of 27- to 30-year-olds and 18% of 31 and older group (p learning style involves problem solving and decision making, with the practical application of ideas and the use of hypothetical-deductive reasoning. Learning through AE decreased with age, whereas learning through AC increased. Copyright © 2014 Association of Program Directors in Surgery. Published by Elsevier Inc. All rights reserved.
Study of dielectric relaxation and AC conductivity of InP:S single crystal
El-Nahass, M. M.; Ali, H. A. M.; El-Shazly, E. A.
2012-07-01
The dielectric relaxation and AC conductivity of InP:S single crystal were studied in the frequency range from 100 to 5.25 × 105 Hz and in the temperature range from 296 to 455 K. The dependence of the dielectric constant (ɛ1) and the dielectric loss (ɛ2) on both frequency and temperature was investigated. Since no peak was observed on the dielectric loss, we used a method based on the electric modulus to evaluate the activation energy of the dielectric relaxation. Scaling of the electric modulus spectra showed that the charge transport dynamics is independent of temperature. The AC conductivity (σAC) was found to obey the power law: Aωs. Analysis of the AC conductivity data and the frequency exponent showed that the correlated barrier hopping (CBH) model is the dominant mechanism for the AC conduction. The variation of AC conductivity with temperature at different frequencies showed that σAC is a thermally activated process.
Self-field AC losses in Bi-2223 superconducting tapes
International Nuclear Information System (INIS)
Mueller, K. H.; Leslie, K.E.
1996-01-01
Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed
A spatial study of the mid-IR emission features in four Herbig Ae/Be stars
Boersma, C.; Peeters, E.; Martin-Hernandez, N. L.; van der Wolk, G.; Verhoeff, A. P.; Tielens, A. G. G. M.; Waters, L. B. F. M.; Pel, J. W.
Context. Infrared (IR) spectroscopy and imaging provide a prime tool to study the characteristics of polycyclic aromatic hydrocarbon (PAH) molecules and the mineralogy in regions of star formation. Herbig Ae/Be stars are known to have varying amounts of natal cloud material present in their
Ahmad, Nabihah; Rifen, A. Aminurdin M.; Helmy Abd Wahab, Mohd
2016-11-01
Automated Teller Machine (ATM) is an electronic banking outlet that allows bank customers to complete a banking transactions without the aid of any bank official or teller. Several problems are associated with the use of ATM card such card cloning, card damaging, card expiring, cast skimming, cost of issuance and maintenance and accessing customer account by third parties. The aim of this project is to give a freedom to the user by changing the card to biometric security system to access the bank account using Advanced Encryption Standard (AES) algorithm. The project is implemented using Field Programmable Gate Array (FPGA) DE2-115 board with Cyclone IV device, fingerprint scanner, and Multi-Touch Liquid Crystal Display (LCD) Second Edition (MTL2) using Very High Speed Integrated Circuit Hardware (VHSIC) Description Language (VHDL). This project used 128-bits AES for recommend the device with the throughput around 19.016Gbps and utilized around 520 slices. This design offers a secure banking transaction with a low rea and high performance and very suited for restricted space environments for small amounts of RAM or ROM where either encryption or decryption is performed.
AC susceptibility of thin Pb films in intermediate and mixed state
Energy Technology Data Exchange (ETDEWEB)
Janu, Zdenek, E-mail: janu@fzu.cz [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Svindrych, Zdenek [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Trunecek, Otakar [Charles University in Prague, Faculty of Mathematics and Physics, Ke Karlovu 3, CZ-121 16 Prague 2 (Czech Republic); Kus, Peter; Plecenik, Andrej [Komenius University in Bratislava, Faculty of Mathematics, Physics, and Informatics, Mlynska dolina, 842 48 Bratislava 4 (Slovakia)
2011-12-15
Thickness dependent transition in AC susceptibility between intermediate and mixed state in type-I superconducting films. The temperature induced crossover between reversible and irreversible behavior was observed in the thicker film. The temperature dependence of the AC susceptibility in mixed state follows prediction of model based on Bean critical state. The temperature dependence of the harmonics of the complex AC susceptibility in the intermediate state is explained. Thin films of type I superconductors of a thickness comparable or less than a flux penetration length behave like type II superconductors in a mixed state. With decreasing film thickness normal domains carrying a magnetic flux get smaller with smaller number of flux quanta per domain and finally transform into single quantum flux lines, i.e. quantum vortices similar to those found in type II superconductors. We give an evidence of this behavior from the measurements of the nonlinear response of a total magnetic moment to an applied AC magnetic field, directly from the temperature dependence of an AC susceptibility.
Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.
2010-11-01
AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.
Flexible AC transmission systems: the state of the art
Energy Technology Data Exchange (ETDEWEB)
Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division
1994-12-31
Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.
Operation of AC Adapters Visualized Using Light-Emitting Diodes
Regester, Jeffrey
2016-01-01
A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…
Human DNA polymerase delta double-mutant D316A;E318A interferes with DNA mismatch repair in vitro
DEFF Research Database (Denmark)
Liu, Dekang; Frederiksen, Jane H.; Liberti, Sascha Emilie
2017-01-01
DNA mismatch repair (MMR) is a highly-conserved DNA repair mechanism, whose primary role is to remove DNA replication errors preventing them from manifesting as mutations, thereby increasing the overall genome stability. Defects in MMR are associated with increased cancer risk in humans and other...... organisms. Here, we characterize the interaction between MMR and a proofreading-deficient allele of the human replicative DNA polymerase delta, PolδD316A;E318A, which has a higher capacity for strand displacement DNA synthesis than wild type Polδ. Human cell lines overexpressing PolδD316A;E318A display...
DEFF Research Database (Denmark)
von Schoubye, Nadia Lybøl; Frederiksen, Kristen; Kristiansen, Uffe
2018-01-01
Mental disorders such as schizophrenia are associated with impaired firing properties of fast spiking inhibitory interneurons (FSINs) causing reduced task-evoked gamma-oscillation in prefrontal cortex. The voltage-gated sodium channel NaV1.1 is highly expressed in PV-positive interneurons, but only...... at low levels in principal cells. Positive modulators of Nav1.1 channels are for this reason considered potential candidates for the treatment of cognitive disorders. Here we examined the effect of the novel positive modulator of voltage-gated sodium channels Lu AE98134. We found that Lu AE98134...... facilitated the sodium current mediated by NaV1.1 expressed in HEK cells by shifting its activation to more negative values, decreasing its inactivation kinetics and promoting a persistent inward current. In a slice preparation from the brain of adult mice, Lu AE98134 promoted the excitability of fast spiking...
Energy Technology Data Exchange (ETDEWEB)
Traversi, R.; Becagli, S. [Department of Chemistry “Ugo Schiff”, University of Florence, Via della Lastruccia 3, I-50019 Sesto F.no, Florence (Italy); Calzolai, G.; Chiari, M.; Giannoni, M. [Department of Physics and Astronomy, University of Florence and I.N.F.N., Florence, Via G. Sansone 1, I-50019 Sesto F.no, Florence (Italy); Lucarelli, F., E-mail: lucarelli@fi.infn.it [Department of Physics and Astronomy, University of Florence and I.N.F.N., Florence, Via G. Sansone 1, I-50019 Sesto F.no, Florence (Italy); Nava, S. [Department of Physics and Astronomy, University of Florence and I.N.F.N., Florence, Via G. Sansone 1, I-50019 Sesto F.no, Florence (Italy); Rugi, F.; Severi, M.; Udisti, R. [Department of Chemistry “Ugo Schiff”, University of Florence, Via della Lastruccia 3, I-50019 Sesto F.no, Florence (Italy)
2014-01-01
PIXE and ICP-AES techniques are largely used in atmospheric aerosol studies. Since PIXE is able to provide the total elemental concentrations, while ICP-AES results depend on the extraction conditions, parallel PIXE and ICP-AES measurements of Fe, Al, Cu, Pb, Mn, Cr, Ni, V, As on PM10 and PM2.5 samples were compared. Two extraction procedures were applied to samples from 5 sites at different anthropization level in Italy: a “weak” extraction (HNO{sub 3} at pH = 1.5) and a “strong” extraction (micro-wave oven in HNO{sub 3} and H{sub 2}O{sub 2} – following EU rules). The amount of the metal extracted in the different conditions resulted to be strongly dependent on the sampling site, on the main sources of the particle (crustal or anthropic) containing the metal and on the sampled size class.
A.C. losses in current-carrying superconductors
International Nuclear Information System (INIS)
Reuver, J.L. de.
1985-01-01
The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)
International Nuclear Information System (INIS)
Ahn, B.; Akasofu, S.; Kamide, Y.
1983-01-01
As a part of the joint efforts of operating six meridian chains of magnetometers during the IMS, magnetic records from 71 stations are used to deduce the distribution of electric fields and currents in the polar ionosphere for March 17, 18, and 19, 1978. As a continuation of this project, we have constructed hourly distribution maps of the Joule heat production rate and their sum over the entire polar region on the three days. For this purpose the conductivity distribution is inferred at each instant partially on the basis of an empirical method devised by Ahn et al. (1982). The particle energy injection rate is estimated similarly by using an empirical method. The data set thus obtained allows us to estimate also the global Joule heat production rate U/sub J/, the global particle energy injection rate U/sub A/ and the sum U/sub Gamma/ of the two quantities. It is found that three global quantities (watt) are related almost linearly to the AE(nT) and AL(nT) indices. Our present estimates give the following relationships: U/sub J/ = 2.3 times 10 8 x AE 8 U/sub A/ = 0.6 times 10 8 x AE 8 and U/sub I/ = 2.9 times 10 8 x AE: U/sub J/ = 3.0 times 10 8 x AL 8 U/sub A/ = 0.8 times 10 8 x AL, and U/sub I/ = 3.8 times 10 8 x AL
International Nuclear Information System (INIS)
Benson, R.F.; Bauer, P.; Brace, L.H.; Carlson, H.C.; Hagen, J.; Hanson, W.B.; Hoegy, W.R.; Torr, M.R.; Wickwar, V.B.
1977-01-01
The Atmosphere Exploere-C satellite (AE-C) is uniquely suited for correlative studies with ground-based stations because its on-board propulsion system enables a desired ground station overflight condition to be maintained for a period of several weeks. It also provides the first low-altitude (below 260 km) comparison of satellite and incoherent scatter electron and ion temperatures. More than 40 comparisons of remote and in situ measurements were made by using data from AE-C and four incoherent scatter stations (Arecibo, Chatanika, Millstone Hill, and St. Santin). The results indicate very good agreement between satellite and ground measurements of the ion temperature, the average satellite retarding potential analyzer temperatures differing from the average incoherent scatter temperatures by -2% at St. Santin, +3% at Millstone Hill, and +2% at Arecibo. The electron temperatures also agree well, the average satellite temperatures exceeding the average incoherent scatter temperatures by 3% at St. Santin, 2% at Arecibo, and 11% at Millstone Hill. Several temperature comparisons were made between AE-C and Chatanika. In spite of the highly variable ionosphere often encountered at this high-latitude location, good agreement was obtained between the in situ and remote measurements of electron and ion temperatures. Longitudinal variations are found to be very important in the comparisons of electron temperature in some locations. The agreement between the electron temperatures is considerably better than that found in some earlier comparisons involving satellities at higher altitudes
NDT in inspection-repairing of boiler AE-101 of fertilizers Plant-Talara-Peru
International Nuclear Information System (INIS)
Torres, F.
1988-01-01
Experiences got from the use of NDT in inspection-repairing of boiler AE-101 of fertilizers Plant-Talara is presented after failures by pipes breakage. Applying liquid penetrant testing and visual inspection it was possible to determine the seriousness of the equipment the use of metallographic copies, ultrasonic measurements and hardness gave us an idea of the actual condition of the equipment, allowing a safe performance
Scheuerlein, C
2001-01-01
Electron stimulated carbon adsorption at room temperature (RT) has been studied in the context of radiation induced surface modifications in the vacuum system of particle accelerators. The stimulated carbon adsorption was monitored by AES during continuous irradiation by 2.5 keV electrons and simultaneous exposure of the sample surface to CO, CO2 or CH4. The amount of adsorbed carbon was estimated by measuring the carbon Auger peak intensity as a function of the electron irradiation time. Investigated substrate materials are technical OFE copper and TiZrV non-evaporable getter (NEG) thin film coatings, which are saturated either in air or by CO exposure inside the Auger electron spectrometer. On the copper substrate electron induced carbon adsorption from gas phase CO and CO2 is below the detection limit of AES. During electron irradiation of the non-activated TiZrV getter thin films, electron stimulated carbon adsorption from gas phase molecules is detected when either CO or CO2 is injected, whereas the CH4 ...
Hello darkness my old friend: the fading of the nearby TDE ASASSN-14ae
Brown, Jonathan S.; Shappee, Benjamin J.; Holoien, T. W.-S.; Stanek, K. Z.; Kochanek, C. S.; Prieto, J. L.
2016-11-01
We present late-time optical spectroscopy taken with the Large Binocular Telescope's Multi-Object Double Spectrograph, an improved All-Sky Automated Survey for SuperNovae pre-discovery non-detection, and late-time Swift observations of the nearby (d = 193 Mpc, z = 0.0436) tidal disruption event (TDE) ASASSN-14ae. Our observations span from ˜20 d before to ˜750 d after discovery. The proximity of ASASSN-14ae allows us to study the optical evolution of the flare and the transition to a host-dominated state with exceptionally high precision. We measure very weak Hα emission 300 d after discovery (LH α ≃ 4 × 1039 erg s-1) and the most stringent upper limit to date on the Hα luminosity ˜750 d after discovery (LH α ≲ 1039 erg s-1), suggesting that the optical emission arising from a TDE can vanish on a time-scale as short as 1 yr. Our results have important implications for both spectroscopic detection of TDE candidates at late times, as well as the nature of TDE host galaxies themselves.
Investigation of reordered (001) Au surfaces by positive ion channeling spectroscopy, LEED and AES
International Nuclear Information System (INIS)
Appleton, B.R.; Noggle, T.S.; Miller, J.W.; Schow, O.E. III; Zehner, D.M.; Jenkins, L.H.; Barrett, J.H.
1974-01-01
As a consequence of the channeling phenomenon of positive ions in single crystals, the yield of ions Rutherford scattered from an oriented single crystal surface is dependent on the density of surface atoms exposed to the incident ion beam. Thus, the positive ion channeling spectroscopy (PICS) technique should provide a useful tool for studying reordered surfaces. This possibility was explored by examining the surfaces of epitaxially grown thin Au single crystals with the combined techniques of LEED-AES and PICS. The LEED and AES investigations showed that when the (001) surface was sputter cleaned in ultra-high vacuum, the normal (1 x 1) symmetry of the (001) surfaces reordered into a structure which gave a complex (5 x 20) LEED pattern. The yield and energy distributions of 1 MeV He ions scattered from the Au surfaces were used to determine the number of effective monolayers contributing to the normal and reordered surfaces. These combined measurements were used to characterize the nature of the reordered surface. The general applicability of the PICS technique for investigations of surface and near surface regions is discussed
Early function of the Abutilon mosaic virus AC2 gene as a replication brake.
Krenz, Björn; Deuschle, Kathrin; Deigner, Tobias; Unseld, Sigrid; Kepp, Gabi; Wege, Christina; Kleinow, Tatjana; Jeske, Holger
2015-04-01
The C2/AC2 genes of monopartite/bipartite geminiviruses of the genera Begomovirus and Curtovirus encode important pathogenicity factors with multiple functions described so far. A novel function of Abutilon mosaic virus (AbMV) AC2 as a replication brake is described, utilizing transgenic plants with dimeric inserts of DNA B or with a reporter construct to express green fluorescent protein (GFP). Their replicational release upon AbMV superinfection or the individual and combined expression of epitope-tagged AbMV AC1, AC2, and AC3 was studied. In addition, the effects were compared in the presence and in the absence of an unrelated tombusvirus suppressor of silencing (P19). The results show that AC2 suppresses replication reproducibly in all assays and that AC3 counteracts this effect. Examination of the topoisomer distribution of supercoiled DNA, which indicates changes in the viral minichromosome structure, did not support any influence of AC2 on transcriptional gene silencing and DNA methylation. The geminiviral AC2 protein has been detected here for the first time in plants. The experiments revealed an extremely low level of AC2, which was slightly increased if constructs with an intron and a hemagglutinin (HA) tag in addition to P19 expression were used. AbMV AC2 properties are discussed with reference to those of other geminiviruses with respect to charge, modification, and size in order to delimit possible reasons for the different behaviors. The (A)C2 genes encode a key pathogenicity factor of begomoviruses and curtoviruses in the plant virus family Geminiviridae. This factor has been implicated in the resistance breaking observed in agricultural cotton production. AC2 is a multifunctional protein involved in transcriptional control, gene silencing, and regulation of basal biosynthesis. Here, a new function of Abutilon mosaic virus AC2 in replication control is added as a feature of this protein in viral multiplication, providing a novel finding on
Nutritional and environmental properties of algal products used in healthy diet by INAA and ICP-AES
International Nuclear Information System (INIS)
Avino, P.; Lepore, L.; Carconi, P.L.; Moauro, A.
2000-01-01
Spirulina platensis alga sampled in the Caribbean Sea and seven other commercial algal products available on the Italian market of different origin and aspect, have been analyzed by instrumental neutron activation analysis (INAA) and inductively coupled plasma-atomic emission spectrometry (ICP-AES). By neutron irradiation and γ-ray spectrometry (INAA), as many as 20 elements could be measured instrumentally without any chemical treatment. Cu, Mg, Mn and Pb were determined after dissolution of the sample by ICP-AES. The cross-checking of the data, specifically by comparing those of Ca, Cr, Fe and Zn, obtained by the two techniques was found to be in good agreement. Special attention from analytical and nutritional point of view has been devoted to the toxic metals. The measurements have been carried out employing the reference algal material prepared by International Atomic Energy Agency (IAEA). (author)
Monolithic blue LED series arrays for high-voltage AC operation
Energy Technology Data Exchange (ETDEWEB)
Ao, Jin-Ping [Satellite Venture Business Laboratory, University of Tokushima, Tokushima 770-8506 (Japan); Sato, Hisao; Mizobuchi, Takashi; Morioka, Kenji; Kawano, Shunsuke; Muramoto, Yoshihiko; Sato, Daisuke; Sakai, Shiro [Nitride Semiconductor Co. Ltd., Naruto, Tokushima 771-0360 (Japan); Lee, Young-Bae; Ohno, Yasuo [Department of Electrical and Electronic Engineering, University of Tokushima, Tokushima 770-8506 (Japan)
2002-12-16
Design and fabrication of monolithic blue LED series arrays that can be operated under high ac voltage are described. Several LEDs, such as 3, 7, and 20, are connected in series and in parallel to meet ac operation. The chip size of a single device is 150 {mu}m x 120 {mu}m and the total size is 1.1 mm x 1 mm for a 40(20+20) LED array. Deep dry etching was performed as device isolation. Two-layer interconnection and air bridge are utilized to connect the devices in an array. The monolithic series array exhibit the expected operation function under dc and ac bias. The output power and forward voltage are almost proportional to LED numbers connected in series. On-wafer measurement shows that the output power is 40 mW for 40(20+20) LED array under ac 72 V. (Abstract Copyright [2002], Wiley Periodicals, Inc.)
pH sensing via bicarbonate-regulated ‘soluble’ adenylyl cyclase (sAC
Directory of Open Access Journals (Sweden)
Nawreen eRahman
2013-11-01
Full Text Available Soluble adenylyl cyclase (sAC is a source of the second messenger cyclic adenosine 3',5' monophosphate (cAMP. sAC is directly regulated by bicarbonate (HCO3- ions. In living cells, HCO3- ions are in nearly instantaneous equilibrium with carbon dioxide (CO2 and pH due to the ubiquitous presence of carbonic anhydrases. Numerous biological processes are regulated by CO2, HCO3-, and/or pH, and in a number of these, sAC has been shown to function as a physiological CO2/HCO3/pH sensor. In this review, we detail the known pH sensing functions of sAC, and we discuss two highly-studied, pH-dependent pathways in which sAC might play a role.
Normal form of particle motion under the influence of an ac dipole
Directory of Open Access Journals (Sweden)
R. Tomás
2002-05-01
Full Text Available ac dipoles in accelerators are used to excite coherent betatron oscillations at a drive frequency close to the tune. These beam oscillations may last arbitrarily long and, in principle, there is no significant emittance growth if the ac dipole is adiabatically turned on and off. Therefore the ac dipole seems to be an adequate tool for nonlinear diagnostics provided the particle motion is well described in the presence of the ac dipole and nonlinearities. Normal forms and Lie algebra are powerful tools to study the nonlinear content of an accelerator lattice. In this article a way to obtain the normal form of the Hamiltonian of an accelerator with an ac dipole is described. The particle motion to first order in the nonlinearities is derived using Lie algebra techniques. The dependence of the Hamiltonian terms on the longitudinal coordinate is studied showing that they vary differently depending on the ac dipole parameters. The relation is given between the lines of the Fourier spectrum of the turn-by-turn motion and the Hamiltonian terms.
Improved transistorized AC motor controller for battery powered urban electric passenger vehicles
Peak, S. C.
1982-01-01
An ac motor controller for an induction motor electric vehicle drive system was designed, fabricated, tested, evaluated, and cost analyzed. A vehicle performance analysis was done to establish the vehicle tractive effort-speed requirements. These requirements were then converted into a set of ac motor and ac controller requirements. The power inverter is a three-phase bridge using power Darlington transistors. The induction motor was optimized for use with an inverter power source. The drive system has a constant torque output to base motor speed and a constant horsepower output to maximum speed. A gear shifting transmission is not required. The ac controller was scaled from the base 20 hp (41 hp peak) at 108 volts dec to an expanded horsepower and battery voltage range. Motor reversal was accomplished by electronic reversal of the inverter phase sequence. The ac controller can also be used as a boost chopper battery charger. The drive system was tested on a dynamometer and results are presented. The current-controlled pulse width modulation control scheme yielded improved motor current waveforms. The ac controller favors a higher system voltage.
Directory of Open Access Journals (Sweden)
Vivek Kumar
2017-02-01
Full Text Available The indications of immune checkpoint inhibitors (ICIs are set to rise further with the approval of newer agent like atezolimumab for use in patients with advanced stage urothelial carcinoma. More frequent use of ICIs has improved our understanding of their unique side effects, which are known as immune-related adverse events (irAEs. The spectrum of irAEs has expanded beyond more common manifestations such as dermatological, gastrointestinal and endocrine effects to rarer presentations involving nervous, hematopoietic and urinary systems. There are new safety data accumulating on ICIs in patients with previously diagnosed autoimmune conditions. It is challenging for clinicians to continuously update their working knowledge to diagnose and manage these events successfully. If diagnosed timely, the majority of events are completely reversible, and temporary immunosuppression with glucocorticoids, infliximab or other agents is warranted only in the most severe grade illnesses. The same principles of management will possibly apply as newer anti- cytotoxic T lymphocytes-associated antigen 4 (CTLA-4 and programmed cell death protein 1 (PD-1/PD-L1 antibodies are introduced. The current focus of research is for prophylaxis and for biomarkers to predict the onset of these toxicities. In this review we summarize the irAEs of ICIs and emphasize their growing spectrum and their management algorithms, to update oncology practitioners.
Analysis of Input and Output Ripples of PWM AC Choppers
Directory of Open Access Journals (Sweden)
Pekik Argo Dahono
2008-11-01
Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.
Schrabback, T.; Erben, T.; Simon, P.; Miralles, J.-M.; Schneider, P.; Heymans, C.; Eifler, T.; Fosbury, R. A. E.; Freudling, W.; Hetterscheidt, M.; Hildebrandt, H.; Pirzkal, N.
2007-06-01
Context: This is the first paper of a series describing our measurement of weak lensing by large-scale structure, also termed “cosmic shear”, using archival observations from the Advanced Camera for Surveys (ACS) on board the Hubble Space Telescope (HST). Aims: In this work we present results from a pilot study testing the capabilities of the ACS for cosmic shear measurements with early parallel observations and presenting a re-analysis of HST/ACS data from the GEMS survey and the GOODS observations of the Chandra Deep Field South (CDFS). Methods: We describe the data reduction and, in particular, a new correction scheme for the time-dependent ACS point-spread-function (PSF) based on observations of stellar fields. This is currently the only technique which takes the full time variation of the PSF between individual ACS exposures into account. We estimate that our PSF correction scheme reduces the systematic contribution to the shear correlation functions due to PSF distortions to MUSIC sample, we determine a local single field estimate for the mass power spectrum normalisation σ8, CDFS=0.52+0.11-0.15 (stat) ± 0.07(sys) (68% confidence assuming Gaussian cosmic variance) at a fixed matter density Ω_m=0.3 for a ΛCDM cosmology marginalising over the uncertainty of the Hubble parameter and the redshift distribution. We interpret this exceptionally low estimate to be due to a local under-density of the foreground structures in the CDFS. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained from the data archives at the Space Telescope European Coordinating Facility and the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555.
Impact of an exercise program on acylcarnitines in obesity: a prospective controlled study
Directory of Open Access Journals (Sweden)
Rodríguez-Gutiérrez René
2012-05-01
Full Text Available Abstract Background Acylcarnitine (AC transport dysfunction into the mitochondrial matrix is one of the pathophysiological mechanisms of type 2 diabetes mellitus (DM. The effect of an aerobic exercise (AE program on this condition in obese subjects without DM is unclear. Methods A prospective, randomized, longitudinal, interventional study in a University Research Center involved a 10-week AE program in 32 women without DM and a body mass index (BMI greater than 27 kg/m2. (Cases n = 17; Controls n = 15. The primary objective was to evaluate the influence of a controlled AE program on beta-oxidation according to modifications in short, medium, and long-chain ACs. Secondary objectives were to define the behavior of amino acids, and the correlation between these modifications with metabolic and anthropometric markers. Results The proportion of dropouts was 17% and 6% in controls and cases, respectively. In cases there was a significant reduction in total carnitine (30.40 [95% CI 28.2 to 35.6] vs. (29.4 [CI 95% 25.1 to 31.7] p = 0.0008 and long-chain AC C14 (0.06 [95% CI 0.05 to 0.08] vs. (0.05 [95% CI 0.05 to 0.09] p = 0.005 and in C18 (0.31 [95% CI 0.27 to 0.45] vs. (0.28 [95% CI 0.22 to 0.32] p = 0.03. Free fatty acid levels remained without change during the study in both groups. Conclusion In conclusion, a controlled 10-week AE program improved beta-oxidation by reducing long-chain ACs. This finding highlights the importance that AE might have in avoiding or reverting lipotoxicity, and in consequence, improving insulin sensitivity and pancreatic beta cell functional reserve.
Pantallas acústicas submarinas de material compuesto multilaminar con matriz metálica
Gallego, V.; Laguna, M.; Vázquez, A. J.
1999-01-01
7 pp.-- PACS nr.: 43.30.Ky.-- Comunicación presentada en los siguientes congresos: XXX Jornadas Nacionales de Acústica – TecniAcústica 1999. Encuentro Ibérico de Acústica (Ávila, 20-22 Octubre 1999).
International Nuclear Information System (INIS)
Meyerhoff, R.W.
1977-01-01
A noval ac superconducting cable is described. It consists of a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface
Autonomous Operation of Hybrid Microgrid with AC and DC Sub-Grids
DEFF Research Database (Denmark)
Loh, Poh Chiang; Blaabjerg, Frede
2011-01-01
the power flow among all the sources distributed throughout the two types of sub-grids, which certainly is tougher than previous efforts developed for only either ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc...... sources, ac sources and interlinking converters. Suitable control and normalization schemes are therefore developed for controlling them with results presented for showing the overall performance of the hybrid microgrid.......This paper investigates on the active and reactive power sharing of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac sub-grids, interconnected by power electronic interfaces. The main challenge here is to manage...
A Floquet-Green's function approach to mesoscopic transport under ac bias
International Nuclear Information System (INIS)
Wu, B H; Cao, J C
2008-01-01
The current response of a mesoscopic system under a periodic ac bias is investigated by combining the Floquet theorem and the nonequilibrium Green's function method. The band structure of the lead under ac bias is fully taken into account by using appropriate self-energies in an enlarged Floquet space. Both the retarded and lesser Green's functions are obtained in the Floquet basis to account for the interference and interaction effects. In addition to the external ac bias, the time-varying Coulomb interaction, which is treated at the self-consistent Hartree-Fock level, provides another internal ac field. The numerical results show that the time-varying Coulomb field yields decoherence and reduces the ringing behavior of the current response to a harmonic bias