Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
n value and Jc distribution dependence of AC transport current losses in HTS conductors
International Nuclear Information System (INIS)
Ogawa, Jun; Sawai, Yusuke; Nakayama, Haruki; Tsukamoto, Osami; Miyagi, Daisuke
2004-01-01
Compared with LTS materials, HTS materials have some peculiarities affecting AC loss characteristics of the conductors. We measured the AC transport current losses in YBCO thin film coated conductors and a Bi2223/Ag sheathed tape. Comparing the measured data with analytical calculations, the dependence of the AC transport current losses on the n value and critical current density distributions are studied. It is shown that, considering the n values and J c distributions, the peculiarities in the HTS materials can be taken into consideration and the transport current losses in HTS conductors can be calculated by the same analytical method used for LTS
International Nuclear Information System (INIS)
Miyagi, D.; Amadutsumi, Y.; Takahashi, N.; Tsukamoto, O.
2007-01-01
AC transport current losses of coated conductors with ferromagnetic substrates are higher than the loss calculated by the Norris equation. In order to reduce the AC transport current loss we propose in this paper a structure of the coated conductor that has wider substrate than the SC (Superconducting) layer. The current distribution and AC loss of the proposed model are analyzed by means of FEM. The AC transport current loss is reduced due to the change of current density distribution near the edge of SC layer, consequent to the high value of magnetic permeability of the ferromagnetic substrate, that is wider than the SC layer
AC Transport Current Loss in a Coated Superconductor in the Bean Model
National Research Council Canada - National Science Library
Carr, Jr, W. J
2004-01-01
A new and straightforward calculation is made of the loss in a very thin superconducting strip of rectangular cross section carrying ac transport current in zero applied magnetic field, with a similar...
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.
2010-11-01
AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.
International Nuclear Information System (INIS)
Polak, M.; Jansak, L.
2000-01-01
We experimentally studied the effects of a single artificial defect and a linear array of artificial defects on I-V curves, critical currents and transport current ac losses of 55 filament untwisted Bi-2223/Ag tapes. The artificial defect was a small hole drilled into the tape. The reduction in the critical current measured on a 1 cm long section due to one hole of diameter 0.9 mm was 33% and that due to a linear array of seven similar holes was 62%. The slopes of the I-V curves, n, measured in this section were 33, 16 and 5.8 in the original sample, in the sample with one defect and the sample with seven defects, respectively. Both I c and the slope reduction were smaller if the distance between the potential taps was increased. The transport current ac losses at 50 Hz and I rms = 10 A in the sample with one defect measured in a 1 cm long section were practically the same as those in the original sample (4.1x10 -4 W m -1 ), but they increased by 83% in the sample with a linear array of seven defects. The measured increase in losses per unit length was the smaller, the larger the distance between the potential taps. A comparison between the measured and calculated losses revealed that a formal application of the Norris equations for loss calculations in samples with local defects leads to an overestimation of the ac losses. A procedure for the calculation of transport current losses in samples with local defects based on the Norris model is proposed and verified. (author)
Nijhuis, Arend; ten Kate, Herman H.J.
1994-01-01
AC losses in cables carrying DC as well as AC transport currents at different DC background fields up to 2T have been measured on three types of Nb3Sn subcables in a new test facility. In this facility it is possible to apply sinusoidal transverse AC fields up to dB/dt=5T/s and longitudinal AC
A simulation of a multifilamentary wire carrying a transport current in an AC applied field
International Nuclear Information System (INIS)
Rem, P.C.; Hartmann, R.A.; Dijkstra, D.; Van Beckum, F.P.H.; Van de Klundert, L.J.M.
1986-01-01
The problem of calculating the current distribution in a multi-filamentary wire subjected to a time-dependent field becomes difficult as soon as the non-linearity due to the saturation of layers of filaments can be neglected no more. Such a problem can be solved approximately if the shape of the boundaries between unsaturated regions can be prescribed on the basis of general considerations such as symmetry arguments. For cases involving both a transport current and an applied field, however, little is known about the boundaries and their time-dependence behaviour. For such cases a brute force numerical calculation may provide an answer. The results presented below were calculated for a combination of DC transport current and AC applied field
Energy Technology Data Exchange (ETDEWEB)
Liu, Qi [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China); Institute of Science, Information Engineering University, Zhengzhou 450001 (China); Zhang, Guomin, E-mail: gmzhang@mail.iee.ac.cn [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); Yang, Hua [Institute of Science, Information Engineering University, Zhengzhou 450001 (China); Li, Zhenming; Liu, Wei [China Electric Power Research Institute, Beijing 100192 (China); Jing, Liwei [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); Yu, Hui; Liu, Guole [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China)
2016-09-15
Highlights: • Quench behavior of Sr{sub 0.6}K{sub 0.4}Fe{sub 2}As{sub 2}/ Ag tape with AC transport current was reported for the first time. • The measurement are performed as a function of different temperature (20 K–30 K), transport current (AC and DC) and operating frequency (50 Hz–250 Hz). • The study is concentrated on the research of quench development, and the discussions of NZPV and MQE values. - Abstract: In applications, superconducting wires may carry AC or DC transport current. Thus, it is important to understand the behavior of normal zone propagation in conductors and magnets under different current conditions in order to develop an effective quench protection system. In this paper, quench behavior of Ag sheathed Sr{sub 0.6}K{sub 0.4}Fe{sub 2}As{sub 2} (Sr-122 in the family of iron-based superconductor) tapes with AC and DC transport current is reported. The measurements are performed as a function of different temperature (20 K–30 K), varying transport current and operating frequency (50 Hz–250 Hz). The focus of the research is the minimum quench energy (MQE), the normal zone propagation velocity (NZPV) and the comparison of the related results with AC and DC transport current.
A method for decreasing transport ac losses in multifilamentary and multistrip superconductors
Energy Technology Data Exchange (ETDEWEB)
Glowacki, B A [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom); IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Majoros, M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom)
2000-07-01
A new method is proposed for decreasing transport ac losses in multifilamentary superconductors by the decoupling of the filaments using a magnetic material in the form of thin layers surrounding the individual filaments. For a superconductor with an elliptical cross section, the magnetic material surrounding the filaments affects the local magnetic field distribution that both reduces the critical current of the filaments and induces the transport ac losses in the magnetic material. Even by taking into account any detrimental influences of the presence of the magnetic material around the filaments, the analysis of the experimental data supported by computer modelling confirmed that for a Bi2223 tape with 100 filaments individually covered by magnetic material, such as iron powder, the transport ac losses should be 65 times lower than for the same multifilamentary conductor without the magnetic coating on the filaments. With an increasing number of filaments, the ac loss decrease would be even larger. (author)
Energy Technology Data Exchange (ETDEWEB)
Fang, J [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Luo, X M [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Chen, D X [ICREA and Grup Electromagnetisme, Departament de Fisica, Universitat Autonoma Barcelona, 08193 Bellaterra (Spain); Alamgir, A K M [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Collings, E W [MSE, Ohio State University, Columbus, OH 43210 (United States); Lee, E [MSE, Ohio State University, Columbus, OH 43210 (United States); Sumption, M D [MSE, Ohio State University, Columbus, OH 43210 (United States); Fang, J G [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Yi, H P [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Song, X H [Innova Superconductor Technology Co., Ltd, 7 Rongchang Dongjie, Longsheng Industrial Park, Beijing Economic and Technological Development Area, 100176 (China); Guo, S Q [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Liu, M L [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Xin, Y [Innopower Superconductor Cable Co., Ltd, 7 Rongchang Dongjie, Longsheng Industrial Park, Beijing Economic and Technological Development Area, 100176 (China); Han, Z [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)
2004-10-01
On five Bi-2223/Ag tapes with different aspect ratios from 5 to 26, AC losses have been measured at 77 K while a parallel AC magnetic field or a perpendicular AC magnetic field or a longitudinal AC transport current is applied. It has been found that at any frequency the perpendicular magnetic losses per cycle increase, but the parallel magnetic losses per cycle and the transport losses per cycle decrease as the aspect ratio increases. These experimental results are in accord with theoretical results. Meanwhile, we investigated the geometry dependence of the decay time constant of coupling current and that of full penetration field.
International Nuclear Information System (INIS)
Fang, J; Luo, X M; Chen, D X; Alamgir, A K M; Collings, E W; Lee, E; Sumption, M D; Fang, J G; Yi, H P; Song, X H; Guo, S Q; Liu, M L; Xin, Y; Han, Z
2004-01-01
On five Bi-2223/Ag tapes with different aspect ratios from 5 to 26, AC losses have been measured at 77 K while a parallel AC magnetic field or a perpendicular AC magnetic field or a longitudinal AC transport current is applied. It has been found that at any frequency the perpendicular magnetic losses per cycle increase, but the parallel magnetic losses per cycle and the transport losses per cycle decrease as the aspect ratio increases. These experimental results are in accord with theoretical results. Meanwhile, we investigated the geometry dependence of the decay time constant of coupling current and that of full penetration field
Energy Technology Data Exchange (ETDEWEB)
Magnusson, N., E-mail: niklas.magnusson@sintef.no [SINTEF Energy Research, NO-7465 Trondheim (Norway); Abrahamsen, A.B. [DTU Wind Energy, Technical University of Denmark, DK-4000 Roskilde (Denmark); Liu, D. [Electrical Power Processing Group, TU Delft, Mekelweg 4, NL-2628 CD Delft (Netherlands); Runde, M. [SINTEF Energy Research, NO-7465 Trondheim (Norway); Polinder, H. [Electrical Power Processing Group, TU Delft, Mekelweg 4, NL-2628 CD Delft (Netherlands)
2014-11-15
Highlights: • A method for calculating hysteresis losses in the low AC – high DC magnetic field and transport current range has been shown. • The method can be used in the design of wind turbine generators for calculating the losses in the generator DC rotor. • First estimates indicate tolerable current ripple in the 0.1% range for a 4 T DC MgB{sub 2} generator rotor coil. - Abstract: MgB{sub 2} superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must be evaluated in the design of the generator to ensure a sufficient overall efficiency. A major loss component is the hysteresis losses in the superconductor itself. In the high DC – low AC current and magnetic field region experimental results still lack for MgB{sub 2} conductors. In this article we reason towards a simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting equations use the DC in-field critical current, the geometry of the superconductor and the magnitude of the AC magnetic field component as parameters. This simplified approach can be valuable in the design of MgB{sub 2} DC coils in the 1–4 T range with low AC magnetic field and current ripples.
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential
Frank, A.; Heller, R.; Goldacker, W.; Kling, A.; Schmidt, C.
2008-02-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability.
Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential
International Nuclear Information System (INIS)
Frank, A; Heller, R; Goldacker, W; Kling, A; Schmidt, C
2008-01-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability
AC losses in a type II superconductor strip with inhomogeneous critical current distribution
International Nuclear Information System (INIS)
Tsukamoto, Osami
2005-01-01
Analytical formulae derived by Brandt and Indenbom (1993 Phys. Rev. B 48 12893-906) and Norris (1970 J. Phys. D: Appl. Phys. 3 489-507) are often used to calculate the magnetization and AC transport current losses in HTS strip conductors, respectively. In these formulae, homogeneous distribution of critical sheet current density σ c in the strip is assumed. However, it is considered that σ c distributions are inhomogeneous in actual HTS strips and that the inhomogeneous σ c distributions cause deviations of the measured AC loss data of actual HTS strips from those formulae. A semi-analytical method to calculate AC transport current and magnetization losses is derived for a type II superconductor strip with inhomogeneous distribution of σ c in the direction of the strip width. The method is derived modifying the analysis of Brandt et al. The validity of the semi-analytical method is shown by comparing the results calculated by this method with those calculated by the Norris and Brandt formulae and by a different method of our previous work and also with experimental data. Moreover, it is shown that the deviation of the measured data from the Norris and Brandt models can be estimated by assuming proper σ c distributions
International Nuclear Information System (INIS)
Ainslie, Mark D.; Flack, Tim J.; Campbell, Archie M.
2012-01-01
Properties of stacks of HTS coated conductors with and without a magnetic substrate. Non-magnetic substrate model is consistent with existing methods. Presence of a magnetic substrate increases the total AC loss of the stack. Differences and similarities between certain tapes within stacks are explained. Ferromagnetic loss of substrate negligible in most cases except small currents/fields. In this paper, the authors investigate the electromagnetic properties of stacks of high temperature superconductor (HTS) coated conductors with a particular focus on calculating the total transport AC loss. The cross-section of superconducting cables and coils is often modeled as a two-dimensional stack of coated conductors, and these stacks can be used to estimate the AC loss of a practical device. This paper uses a symmetric two dimensional (2D) finite element model based on the H formulation, and a detailed investigation into the effects of a magnetic substrate on the transport AC loss of a stack is presented. The number of coated conductors in each stack is varied from 1 to 150, and three types of substrate are compared: non-magnetic weakly magnetic and strongly magnetic. The non-magnetic substrate model is comparable with results from existing models for the limiting cases of a single tape (Norris) and an infinite stack (Clem). The presence of a magnetic substrate increases the total AC loss of the stack, due to an increased localized magnetic flux density, and the stronger the magnetic material, the further the flux penetrates into the stack overall. The AC loss is calculated for certain tapes within the stack, and the differences and similarities between the losses throughout the stack are explained using the magnetic flux penetration and current density distributions in those tapes. The ferromagnetic loss of the substrate itself is found to be negligible in most cases, except for small magnitudes of current. Applying these findings to practical applications, where AC
Self-field AC losses and critical currents in multi-tube Ag-Bi-2223 conductors
Energy Technology Data Exchange (ETDEWEB)
Ciszek, M; Ashworth, S P; Campbell, A M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); James, M P; Glowacki, B A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom); Garre, R; Conti, S [Centro Ricerche Europa Metalli, Fornaci di Barga, LU (Italy)
1996-05-01
The purpose of this work was to investigate the influence of different technological treatments of silver sheathed Bi-2223 tapes on the critical current density and the AC transport losses. The tapes were produced using the 'tube-in-tube' technique, by including a silver rod in the centre of the superconducting powder during packing of the silver tube. The aim of the process is to increase the silver to superconductor surface area and thus also the alignment at the centre of the conductor ceramic core. AC transport losses were measured by means of an electrical method using sinusoidally varying currents in the frequency range 30-180 Hz. In this range the power losses are hysteretic. The measured variation in losses from those predicted by a critical state model is attributed to the complex geometry of superconducting regions existing in these tapes. (author)
AC/DC current ratio in a current superimposition variable flux reluctance machine
Kohara, Akira; Hirata, Katsuhiro; Niguchi, Noboru; Takahara, Kazuaki
2018-05-01
We have proposed a current superimposition variable flux reluctance machine for traction motors. The torque-speed characteristics of this machine can be controlled by increasing or decreasing the DC current. In this paper, we discuss an AC/DC current ratio in the current superimposition variable flux reluctance machine. The structure and control method are described, and the characteristics are computed using FEA in several AC/DC ratios.
Entropic transport of active particles driven by a transverse ac force
Energy Technology Data Exchange (ETDEWEB)
Wu, Jian-chun, E-mail: wjchun2010@163.com; Chen, Qun; Ai, Bao-quan, E-mail: aibq@scnu.edu.cn
2015-12-18
Transport of active particles is numerically investigated in a two-dimensional period channel. In the presence of a transverse ac force, the directed transport of active particles demonstrates striking behaviors. By adjusting the amplitude and the frequency of the transverse ac force, the average velocity will be influenced significantly and the direction of the transport can be reversed several times. Remarkably, it is also found that the direction of the transport varies with different self-propelled speeds. Therefore, particles with different self-propelled speeds will move to the different directions, which is able to separate particles of different self-propelled speeds. - Highlights: • A transverse ac force strongly influence the transport of active particles. • The direction of the transport can be reversed several times. • Active particles with different self-propelled speeds can be separated.
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
Transport ac loss in a rectangular thin strip with power-law E(J) relation
International Nuclear Information System (INIS)
Li, Shuo; Chen, Du-Xing; Fan, Yu; Fang, Jin
2015-01-01
Highlights: • Transport ac loss in a thin strip with power-law E(J) is systematically computed. • The scaled results can be accurately used for strips with any critical current and frequency. • Experiments may be unambiguously compared with modeling results at a critical frequency. - Abstract: Transport ac losses of a rectangular thin strip obeying relation E/E c =(J/J c ) n with a fixed critical current I c and n=5,10,20,30, and 40 are accurately computed at a fixed frequency f as functions of the current amplitude I m . The results may be interpolated and scaled to those at any values of I c ,f, and 5⩽n⩽40. Normalized in the same way as that in Norris’ analytical formula derived from the critical-state model and converting f to a critical frequency f c , the modeling results may be better compared with the Norris formula and experimental data. A complete set of calculated modeling data are given with necessary formulas to be easily used by experimentalists in any particular case
Transport ac loss studies of YBCO coated conductors with nickel alloy substrates
International Nuclear Information System (INIS)
Duckworth, R C; Thompson, J R; Gouge, M J; Lue, J W; Ijaduola, A O; Yu, D; Verebelyi, D T
2003-01-01
Transport alternating current (ac) loss measurements were performed on a series of rolling-assisted biaxially textured substrate (RABiTS) processed YBa 2 Cu 3 O x (YBCO) coated conductors at 77 K. While each sample possessed a 1 μm layer of YBCO and a 3 μm silver cap layer, two different nickel alloy substrates were used and their impact on the ac loss was examined. Both substrates possessed a 75 μm Ni-5 at%W base, but one substrate also had a 2 μm nickel overlayer as part of the buffer layer architecture. The ac losses, which were determined by thermal and electrical measurements, contained two dominant contributions: superconductive hysteresis in the YBCO and ferromagnetic hysteresis in the substrates. The superconductive component followed the Norris elliptic model for the substrate with the nickel overlayer and the Norris thin strip model for the substrate without the nickel overlayer. The substrates' ferromagnetic loss was determined separately through magnetization measurements, which showed that this loss contribution was independent of the presence of the nickel overlayer for effective ac currents less than 50 A. While the overall loss was lower for the thin-strip-like conductor with no nickel overlayer, further research is necessary to strengthen this connection
Transport ac losses in Bi-2223 multifilamentary tapes - conductor materials aspect
Energy Technology Data Exchange (ETDEWEB)
Glowacki, B A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge BC2 3QZ (United Kingdom); Majoros, M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Institute of Electrical Engineering, SAS, Bratislava (Slovakia)
2000-05-01
Transport ac losses in technical superconductors based on Bi-2223 tape material are influenced by many parameters. The major factors that define the ac performance of such conductors are the following: the size and number of filaments, their geometrical arrangement in the cross-section of the conductor, the twist pitch length, the resistivity of the matrix, the presence of oxide barriers around the filaments and deformation procedures such as sequential pressing or rolling followed by appropriate thermal treatment. In the present paper the above aspects are addressed from the viewpoint of the materials science of technical conductor design. Transport ac losses at power frequencies in different types of Bi-2223 conductor are presented and analysed. The results of conductor design analysis with respect to the coexistence of the superconductor with other materials in the conductor structure are presented. New concepts for minimization of the transport ac losses are discussed in detail. (author)
Superconductive AC current limiter
International Nuclear Information System (INIS)
Bekhaled, M.
1987-01-01
This patent describes an AC current limiter for a power transport line including a power supply circuit and feeding a load circuit via an overload circuit-breaker member. The limiter comprises a transformer having a primary winding connected in series between the power supply circuit and the load circuit and at least one secondary winding of superconductor material contained in a cryogenic enclosure and short-circuited on itself. The leakage reactance of the transformer as seen from the primary winding is low, and the resistance of the at least one secondary winding when in the non-superconducting state and as seen from the primary is much greater than the nominal impedance of the transformer. The improvement whereby the at least one secondary winding of the transformer comprises an active winding in association with a set of auxiliary windings. The set of auxiliary windings is constituted by an even number of series-connected auxiliary windings wound in opposite directions, with the total number of turns in one direction being equal to the total number of turns in the opposite direction, and with the thermal capacity of the secondary winding as a whole being sufficiently high to limit the expansion thereof to a value which remains small during the time it takes the circuit-breaking member to operate
Complex study of transport AC loss in various 2G HTS racetrack coils
Energy Technology Data Exchange (ETDEWEB)
Chen, Yiran, E-mail: yc315@cam.ac.uk [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Zhang, Min; Chudy, Michal; Matsuda, Koichi; Coombs, Tim [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom)
2013-04-15
Highlights: ► Comparing transport AC losses of two types of 2G HTS racetrack coils. ► The magnetic substrate in the MAG RABITS coil is the main difference. ► Experimental data agree well with simulation results. ► The transport AC loss in the MAG RABITS coil is 36% higher than that in the IBAD coil. ► It is better to keep all the substrate non-magnetic. -- Abstract: HTS racetrack coils are becoming important elements of an emerging number of superconducting devices such as generators or motors. In these devices the issue of AC loss is crucial, as performance and cooling power are derived from this quantity. This paper presents a comparative study of transport AC loss in two different types of 2G HTS racetrack coils. In this study, both experimental measurements and computer simulation approaches were employed. All the experiments were performed using classical AC electrical method. The finite-element computer model was used to estimate electromagnetic properties and calculate transport AC loss. The main difference between the characterized coils is covered inside tape architectures. While one coil uses tape based on RABITS magnetic substrate, the second coil uses a non-magnetic tape. Ferromagnetic loss caused by a magnetic substrate is an important issue involved in the total AC loss. As a result, the coil with the magnetic substrate surprised with high AC loss and rather low performance.
Low field critical currents and ac losses of thin film niobium--tin superconductors
International Nuclear Information System (INIS)
Howard, R.E.
1977-01-01
The results of a study of the low field critical current and ac loss properties of niobium-tin thin films and layered composites fabricated by electron-beam coevaporation are presented. Particular emphasis is placed upon determining the suitability of this material for use as a conductor in a superconducting power transmission line. Chapter I contains a summary of this work and its major results together with an introduction to the scientific and engineering concepts associated with a superconducting power transmission line. Chapter II is a discussion of the physics of current transport and the associated loss mechanisms in a type-II superconductor. Chapter III gives the details of the electron-beam coevaporation technique developed to fabricate the samples for this study. Also discussed in this chapter are the effects of the evaporation conditions on the growth morphology of the niobium-tin films. Chapter IV presents the details of the experimental techniques developed to measure the ac loss and critical current in these samples as a function of temperature. Chapter V shows the dependence of the critical current of these films and composites on temperature, magnetic field, and on the number of artificially introduced pinning centers in the layered composites. Experimental results are also presented concerning the stability of these conductors against flux jumps. Chapter VI is a discussion of the ac losses in these samples. Detailed comparisons are made between the measured loss and the predictions of the critical state model
Reducing AC-Winding Losses in High-Current High-Power Inductors
DEFF Research Database (Denmark)
Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.
2009-01-01
Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper ...
International Nuclear Information System (INIS)
Ainslie, Mark D; Yuan Weijia; Flack, Timothy J; Coombs, Timothy A; Rodriguez-Zermeno, Victor M; Hong Zhiyong
2011-01-01
AC loss can be a significant problem for any applications that utilize or produce an AC current or magnetic field, such as an electric machine. The authors investigate the electromagnetic properties of high temperature superconductors with a particular focus on the AC loss in superconducting coils made from YBCO coated conductors for use in an all-superconducting electric machine. This paper presents an improved 2D finite element model for the cross-section of such coils, based on the H formulation. The model is used to calculate the transport AC loss of a racetrack-shaped coil using constant and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC Superconductivity Group's all-superconducting permanent magnet synchronous motor design. To validate the modeling results, the transport AC loss of a stator coil is measured using an electrical method based on inductive compensation by means of a variable mutual inductance. Finally, the implications of the findings on the performance of the motor are discussed.
Energy Technology Data Exchange (ETDEWEB)
Ainslie, Mark D; Yuan Weijia; Flack, Timothy J; Coombs, Timothy A [Department of Engineering, University of Cambridge, 9 J J Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Rodriguez-Zermeno, Victor M [Department of Mathematics, Technical University of Denmark, Kongens Lyngby 2800 (Denmark); Hong Zhiyong, E-mail: mda36@cam.ac.uk [School of Electronic, Information and Electrical Engineering, Shanghai Jiao Tong University, Shanghai (China)
2011-04-15
AC loss can be a significant problem for any applications that utilize or produce an AC current or magnetic field, such as an electric machine. The authors investigate the electromagnetic properties of high temperature superconductors with a particular focus on the AC loss in superconducting coils made from YBCO coated conductors for use in an all-superconducting electric machine. This paper presents an improved 2D finite element model for the cross-section of such coils, based on the H formulation. The model is used to calculate the transport AC loss of a racetrack-shaped coil using constant and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC Superconductivity Group's all-superconducting permanent magnet synchronous motor design. To validate the modeling results, the transport AC loss of a stator coil is measured using an electrical method based on inductive compensation by means of a variable mutual inductance. Finally, the implications of the findings on the performance of the motor are discussed.
International Nuclear Information System (INIS)
Alamgir, A.K.M.; Gu, C.; Han, Z.
2006-01-01
An approach of realizing high performance HTS coil comprised of ferromagnetic material-coated BSCCO tape is proposed. The concept of influencing critical current and ac loss is based on the magnetic shielding effect resulting in redirection of self-field flux-lines. In the previous article, ac performance of Ni-coated tape was demonstrated where the Ni-coating was introduced at the edge-regime of the finished tape in order to redirect the perpendicular component of self-field lines. In order to investigate the shielding effect on ac performance in HTS coil, a two-turn pancake coil comprised of Ni-coated Bi-2223/Ag tape is demonstrated in the present article. About 6.4% of critical current was enhanced and 30% of transport current ac loss was reduced by means of 40 μm thick and 0.3 mm long (from the edge toward center of the tape) Ni-coating. This result suggests that additional ferromagnetic loss could be compensated well by the shielding effect of the partial Ni-coating. The degree of enhancement in critical current as well as ferromagnetic impact on ac losses depend on the volume and geometry of ferromagnetic coating introduced. Therefore, it is very important to control the parameter of ferromagnetic coating of the tape in order to balance the critical current and ac loss for optimum coil performance
Energy Technology Data Exchange (ETDEWEB)
Alamgir, A.K.M. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)]. E-mail: alam643@hotmail.com; Gu, C. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Han, Z. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)
2006-07-01
An approach of realizing high performance HTS coil comprised of ferromagnetic material-coated BSCCO tape is proposed. The concept of influencing critical current and ac loss is based on the magnetic shielding effect resulting in redirection of self-field flux-lines. In the previous article, ac performance of Ni-coated tape was demonstrated where the Ni-coating was introduced at the edge-regime of the finished tape in order to redirect the perpendicular component of self-field lines. In order to investigate the shielding effect on ac performance in HTS coil, a two-turn pancake coil comprised of Ni-coated Bi-2223/Ag tape is demonstrated in the present article. About 6.4% of critical current was enhanced and 30% of transport current ac loss was reduced by means of 40 {mu}m thick and 0.3 mm long (from the edge toward center of the tape) Ni-coating. This result suggests that additional ferromagnetic loss could be compensated well by the shielding effect of the partial Ni-coating. The degree of enhancement in critical current as well as ferromagnetic impact on ac losses depend on the volume and geometry of ferromagnetic coating introduced. Therefore, it is very important to control the parameter of ferromagnetic coating of the tape in order to balance the critical current and ac loss for optimum coil performance.
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
A.C. losses in current-carrying superconductors
International Nuclear Information System (INIS)
Reuver, J.L. de.
1985-01-01
The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)
Transport, shot noise, and topology in AC-driven dimer arrays
Niklas, Michael; Benito, Mónica; Kohler, Sigmund; Platero, Gloria
2016-11-01
We analyze an AC-driven dimer chain connected to a strongly biased electron source and drain. It turns out that the resulting transport exhibits fingerprints of topology. They are particularly visible in the driving-induced current suppression and the Fano factor. Thus, shot noise measurements provide a topological phase diagram as a function of the driving parameters. The observed phenomena can be explained physically by a mapping to an effective time-independent Hamiltonian and the emergence of edge states. Moreover, by considering quantum dissipation, we determine the requirements for the coherence properties in a possible experimental realization. For the computation of the zero-frequency noise, we develop an efficient method based on matrix-continued fractions.
Modeling A.C. Electronic Transport through a Two-Dimensional Quantum Point Contact
International Nuclear Information System (INIS)
Aronov, I.E.; Beletskii, N.N.; Berman, G.P.; Campbell, D.K.; Doolen, G.D.; Dudiy, S.V.
1998-01-01
We present the results on the a.c. transport of electrons moving through a two-dimensional (2D) semiconductor quantum point contact (QPC). We concentrate our attention on the characteristic properties of the high frequency admittance (ωapproximately0 - 50 GHz), and on the oscillations of the admittance in the vicinity of the separatrix (when a channel opens or closes), in presence of the relaxation effects. The experimental verification of such oscillations in the admittance would be a strong confirmation of the semi-classical approach to the a.c. transport in a QPC, in the separatrix region
A Floquet-Green's function approach to mesoscopic transport under ac bias
International Nuclear Information System (INIS)
Wu, B H; Cao, J C
2008-01-01
The current response of a mesoscopic system under a periodic ac bias is investigated by combining the Floquet theorem and the nonequilibrium Green's function method. The band structure of the lead under ac bias is fully taken into account by using appropriate self-energies in an enlarged Floquet space. Both the retarded and lesser Green's functions are obtained in the Floquet basis to account for the interference and interaction effects. In addition to the external ac bias, the time-varying Coulomb interaction, which is treated at the self-consistent Hartree-Fock level, provides another internal ac field. The numerical results show that the time-varying Coulomb field yields decoherence and reduces the ringing behavior of the current response to a harmonic bias
Alternating-current transport losses of melt-cast processed Bi-2212 bulk superconductor bars
International Nuclear Information System (INIS)
Tsukamoto, T; Inada, R; Inagaki, N; Andoh, H; Sugiura, T; Oota, A
2003-01-01
Using a melt-casting method, we have fabricated two pieces of Bi-2212 bulk superconductor bar with square and rectangular cross-sections, and we have investigated the alternating-current (ac) transport self-field losses at 77 K. Despite the main contribution of hysteresis loss of the superconductor, there is some difference in the loss behaviour between these two samples. To elucidate the origin, we make numerical calculations on the ac transport self-field losses as a function of current amplitude I 0 below the critical current I c . At a fixed I 0 , the calculated values using the uniform J c distribution and the actual cross-sectional geometry are much higher than the experimental data for the sample with a square cross-section 7.5 x 7.5 mm 2 , while there is good agreement between the calculation and the experiment for the sample with a rectangular cross-section 4.5 x 13.6 mm 2 . The discrepancy appearing in the sample with a square cross-section is ascribed to the actual J c distribution, which is confirmed by critical current measurements when scraping off the sample. The local J c value decreases significantly in going from the surface to the interior of the sample. This suppresses the extension of the flux-penetration region to the interior under ac current transmission and lowers the loss generation compared with the calculated results obtained by the uniform J c distribution
International Nuclear Information System (INIS)
Tomioka, A.; Otonari, T.; Ogata, T.; Iwakuma, M.; Okamoto, H.; Hayashi, H.; Iijima, Y.; Saito, T.; Gosho, Y.; Tanabe, K.; Izumi, T.; Shiohara, Y.
2011-01-01
The single-layer coils with a diameter of 250 mm and 12 turns were manufactured with YBCO tapes with a CuNi- or Cu-Tape. The AC over-current tests were carried out in subcooled liquid nitrogen at 66 K and 74 K to develop power transformers with current limiting function. The AC over-current was two to seven times larger than the I c of conductor and it was reduced to the same level of I c . The I c of model coils did not degrade. The test results showed the possibility of YBCO superconducting transformers with current limiting function. We are developing elemental technology for 66 kV/6.9 kV 20 MVA-class YBCO power transformer. The YBCO transformer is considered to have a possibility to stabilize the power system by improving function of fault current limiting. Current limiting behavior functions over critical current flows. There is a possibility that superconducting characteristic may be damaged due to increase in temperature of YBCO tapes. Therefore, we have taken a measure to combine YBCO tape with CuNi tape or Cu Tape. We manufactured model coils using these conductors and conducted the AC over-current tests. The test current was two to seven times larger than the I c of conductor and it was damped with time from its maximum value according to the generation of conductor resistance. We verified the effectiveness of current limiting characteristics. In these tests, the I c of model coil did not degrade. We consider this conductor to be able to withstand AC over-current with the function of current limiting.
Predicting AC loss in practical superconductors
International Nuclear Information System (INIS)
Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P
2006-01-01
Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time
Accounting for Dark Current Accumulated during Readout of Hubble's ACS/WFC Detectors
Ryon, Jenna E.; Grogin, Norman A.; Coe, Dan A.; ACS Team
2018-06-01
We investigate the properties of excess dark current accumulated during the 100-second full-frame readout of the Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) detectors. This excess dark current, called "readout dark", gives rise to ambient background gradients and hot columns in each ACS/WFC image. While readout dark signal is removed from science images during the bias correction step in CALACS, the additional noise from the readout dark is currently not taken into account. We develop a method to estimate the readout dark noise properties in ACS/WFC observations. We update the error (ERR) extensions of superbias images to include the appropriate noise from the ambient readout dark gradient and stable hot columns. In recent data, this amounts to about 5 e-/pixel added variance in the rows farthest from the WFC serial registers, and about 7 to 30 e-/pixel added variance along the stable hot columns. We also flag unstable hot columns in the superbias data quality (DQ) extensions. The new reference file pipeline for ACS/WFC implements these updates to our superbias creation process.
Interlink Converter with Linear Quadratic Regulator Based Current Control for Hybrid AC/DC Microgrid
Directory of Open Access Journals (Sweden)
Dwi Riana Aryani
2017-11-01
Full Text Available A hybrid alternate current/direct current (AC/DC microgrid consists of an AC subgrid and a DC subgrid, and the subgrids are connected through the interlink bidirectional AC/DC converter. In the stand-alone operation mode, it is desirable that the interlink bidirectional AC/DC converter manages proportional power sharing between the subgrids by transferring power from the under-loaded subgrid to the over-loaded one. In terms of system security, the interlink bidirectional AC/DC converter takes an important role, so proper control strategies need to be established. In addition, it is assumed that a battery energy storage system is installed in one subgrid, and the coordinated control of interlink bidirectional AC/DC converter and battery energy storage system converter is required so that the power sharing scheme between subgrids becomes more efficient. For the purpose of designing a tracking controller for the power sharing by interlink bidirectional AC/DC converter in a hybrid AC/DC microgrid, a droop control method generates a power reference for interlink bidirectional AC/DC converter based on the deviation of the system frequency and voltages first and then interlink bidirectional AC/DC converter needs to transfer the power reference to the over-loaded subgrid. For efficiency of this power transferring, a linear quadratic regulator with exponential weighting for the current regulation of interlink bidirectional AC/DC converter is designed in such a way that the resulting microgrid can operate robustly against various uncertainties and the power sharing is carried out quickly. Simulation results show that the proposed interlink bidirectional AC/DC converter control strategy provides robust and efficient power sharing scheme between the subgrids without deteriorating the secure system operation.
AC power losses in Bi-2223/Ag HTS tapes
International Nuclear Information System (INIS)
Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.
1998-01-01
Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour
Magneto-optical measurements on high-temperature superconductors influenced by AC-fields
International Nuclear Information System (INIS)
Che'Rose, Simon
2007-01-01
In this work magneto-optical measurements on YBa 2 Cu 3 O 7-x and MgB 2 thin films were done. For YBCO the influence of AC-pulses on the flux and current density of a thin film with transport current was investigated. For MgB 2 the influence of AC-fields on the homogenous and dendritic flux penetration was researched. (orig.)
Measurement of AC losses in a racetrack superconducting coil made from YBCO coated conductor
DEFF Research Database (Denmark)
Seiler, Eugen; Abrahamsen, Asger Bech; Kovac, Jan
2012-01-01
to reinforce it. The AC loss is measured versus the transport current Ia with the coil immersed in liquid nitrogen. Measurements at frequencies 21 Hz, 36 Hz and 72 Hz are compared. The AC losses follow I2 a dependence at low current amplitudes and I3 a at high amplitudes. After cutting the inner steel frame...
DC Vs AC - War Of Currents For Future Power Systems A HVDC Technology Overview
Directory of Open Access Journals (Sweden)
Anil K. Rai
2015-08-01
Full Text Available DC vs AC discussion began in 1880s with development of first commercial power transmission in Wall Street New York. Later when AC technology came into notice by efforts of inventor and researcher Sir Nicola Tesla soon the advantages of AC transmission and AC devices overtook the DC technology. It was hoped that DC technology had lost battle of currents. Today with researches going on FACTS devices and bulk power transmission HVDC has again gained a reputation in power sector. Solution of this centuries old debate is to develop HVDC systems that assists HVAC systems for better performance stability and control
International comparison of AC-DC current transfer standards
Heine, G.; Garcocz, M.; Waldmann, W.
2017-01-01
The measurements of the international comparison of ac-dc current transfer standards identified as EURAMET.EM-K12 started in June 2012 and were completed in December 2014. Twenty NMIs in the EURAMET region and one NMI in the AFRIMET region took part: BEV (Austria), CMI (Czech Republic), PTB (Germany), METAS (Switzerland), JV (Norway), UME (Turkey), GUM (Poland), IPQ (Portugal), CEM (Spain), INRIM (Italy), SP (Sweden), DANIAmet-MI-Trescal (Denmark), BIM (Bulgaria), MKEH (Hungary), SIQ (Slovenia), LNE (France), NSAI NML (Ireland), VSL (The Netherlands), NPL (United Kingdom), Metrosert (Estonia), NIS (Egypt). The comparison was proposed to link the National Metrology Institutes organised in EURAMET to the key comparison CCEM-K12. The ac-dc current transfer difference of each travelling standard had been measured at its nominal current 10 mA and 5 A at the following frequencies: 10 Hz, 55 Hz, 1 kHz, 10 kHz, 20 kHz, 50 kHz, 100 kHz. The test points were selected to link the results with the equivalent CCEM Key Comparison (CCEM-K12), through five NMIs participating in both EURAMET and CCEM key comparisons (PTB, JV, NPL, SP and BEV). The report shows the degree of equivalence in the EURAMET region and also the degree of equivalence with the corresponding CCEM reference value. Main text To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCEM, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).
Current Control of Grid Converters Connected with Series AC Capacitor
DEFF Research Database (Denmark)
Wang, Xiongfei; Blaabjerg, Frede; Loh, Poh Chiang
2015-01-01
The series ac capacitor has recently been used with the transformerless grid-connected converters in the distribution power grids. The capacitive characteristic of the resulting series LC filter restricts the use of conventional synchronous integral or stationary resonant current controllers. Thus...... this paper proposes a fourth-order resonant controller in the stationary frame, which guarantees a zero steady-state current tracking error for the grid converters with series LC filter. This method is then implemented in a three-phase experimental system for verification, where the current harmonics below...... the LC filter resonance frequency are effectively eliminated. Experimental results confirm the validity of the proposed current control scheme....
International Nuclear Information System (INIS)
Pe, T.; McDonald, J.; Clem, J.R.
1995-01-01
The voltage V ab measured between two voltage taps a and b during magnetic flux transport in a type-II superconductor carrying current I is the sum of two contributions, the line integral from a to b of the electric field along an arbitrary path C s through the superconductor and a term proportional to the time rate of change of magnetic flux through the area bounded by the path C s and the measuring circuit leads. When the current I(t) is oscillating with time t, the apparent ac loss (the time average of the product IV ab ) depends upon the measuring circuit used. Only when the measuring-circuit leads are brought out far from the surface does the apparent power dissipation approach the real (or true) ac loss associated with the length of sample probed. Calculations showing comparisons between the apparent and real ac losses in a flat strip of rectangular cross section will be presented, showing the behavior as a function of the measuring-circuit dimensions. Corresponding calculations also are presented for a sample of elliptical cross section
Study of plasma equilibrium during the AC current reversal phase in STOR-M
International Nuclear Information System (INIS)
Xiao, C.
2002-01-01
Alternating current (AC) tokamak operation and equilibrium studies have been performed on the STOR-M tokamak. The recent experiments have achieved consistent smooth current reversal through the implementation of a hybrid digital-analog position controller and by careful density control. In order to study the plasma equilibrium during the current reversal phase with negligible rotational transform, a segmented limiter with four isolated conducting plates has been installed. The plates can be connected outside the vacuum vessel, which allows measurements of currents flowing between limiter plates. When the current reversal is smooth with zero dwell time, the hydrogen line emission level and electron density remain finite, indicating a finite particle confinement. The current from the top to the bottom limiter plate is also finite and its direction is consistent with that of the grad-B drift. The observation suggests that the limiter and other conducting structures surrounding the plasmas plays the role, during the current reversal phase of AC tokamak operation, to short out the charge separation arising from the grad-B drift and to maintain a finite particle confinement. (author)
DEFF Research Database (Denmark)
Li, Xiao-Fen; Grivel, Jean-Claude; Abrahamsen, Asger B.
2012-01-01
We have numerically proved that the dependence of AC susceptibility χ of a E(J) power law superconducting thin disc on many parameters can be reduced to one penetration parameter h, with E the electric field and J the current density. Based on this result, we propose a way of measuring the critical...... current density Jc of superconducting thin films by AC susceptibility. Compared with the normally used method based on the peak of the imaginary part, our method uses a much larger range of the AC susceptibility curve, thus allowing determination of the temperature (T) dependence of Jc from a normally...
AC magnetic transport on heterogeneous ferromagnetic wires and tubes
International Nuclear Information System (INIS)
Sinnecker, J.P.; Pirota, K.R.; Knobel, M.; Kraus, L.
2002-01-01
The AC current density radial distribution is calculated on heterogeneous composite materials with cylindrical geometry. The composites have an inner core and thin outer shell that can be either from the same material (homogenous material like simple wires) or from different materials with different physical properties. The case in which a non-magnetic inner core is surrounded by a magnetic layer, like electrodeposited wires, is mainly studied. The effect of frequency and applied magnetic field is simulated. The current density distribution as a function of frequency and applied field, as well as the total current over the inner core and outer shells are calculated. The results agree substantially well with the experimentally observed data for simple electrodeposited wires
Study of the electric Held in HTS tape caused by perpendicular AC magnetic field
International Nuclear Information System (INIS)
Roiberg, V; Kopansky, F.
2004-01-01
Full Text: In a previous work we studied the influence of AC magnetic fields on voltage-currents (V-I) characteristics of high temperature superconducting (HTS) multi filament BSCC0-2223 tapes. It was found that AC magnetic fields perpendicular to the ab plane (the wide surface of the tape) cause a linear decrease of the critical current (IC) with amplitude of the AC magnetic field. The degradation of IC in .AC field was explained by the geometrical model according to which the transport current floe: is confined to the central zone of the tape where .AC field does not penetrate. For deeper understanding of the observed phenomena we carried out a study of the time dependence of the electric field during the cycle of AC field. At the same time we expanded the frequency range to low frequencies down to 1 Hz. The main results of the work are as following. 1. The time modulation of the electric field E in the HTS tape carrying transport DC current has the double frequency relating to AC magnetic field. 2. In field amplitudes less than 70 G the electric field modulation decreases with increasing frequency in opposite to its well-pronounced increase in higher AC field amplitudes. Alcove 70 G, the electric field increases with increasing the frequency of the external magnetic field. The wave forms of the electric field are different in both amplitudes ranges. 3. E-I curves of the tape in low amplitudes are frequency independent and coincide with E-l curves in AC field with intensity equal to the AC field amplitude. 4. In high AC field amplitudes, a strong dependence of the E-I curves on frequency is observed in the frequency range of 1-40 Hz and no dependence is observed in higher frequencies. Our results suggest that a combination of the geometrical model with flux creep concepts is necessary for a better understanding of the electric field behavior in our measurement conditions
Pumping $ac$ Josephson current in the Single Molecular Magnets by spin nutation
Abdollahipour, B.; Abouie, J.; Rostami, A. A.
2012-01-01
We demonstrate that an {\\it ac} Josephson current is pumped through the Single Molecular Magnets (SMM) by the spin nutation. The spin nutation is generated by applying a time dependent magnetic field to the SMM. We obtain the flowing charge current through the junction by working in the tunneling limit and employing Green's function technique. At the resonance conditions some discontinuities and divergencies are appeared in the normal and Josephson currents, respectively. Such discontinuities...
Measurement of AC losses in superconducting tapes by reproduction of thermometric dynamic response
Energy Technology Data Exchange (ETDEWEB)
Ligneris, Benoit des; Aubin, Marcel; Cave, Julian
2003-04-15
We have developed a dynamic response thermometric method for the measurement of AC losses in high T{sub c} superconductors. This method is based on the comparison of a temperature response caused by a known dissipation in the sample with that produced by the AC losses. By passing a DC current and measuring the DC voltage and corresponding temperature response the sample can be used as its own power dissipation reference. The advantages of this method are the short measurement duration time and the possibility to vary many experimental conditions: for example, AC and DC transport currents and AC, DC and rotating applied magnetic fields. In this article we present the basic method using variable short pulses of constant DC current for calibration and similarly of constant amplitude AC current to create the losses. The losses are obtained by numerical modelling and comparison of the thermometric dynamic response in the two above conditions. Finally, we present some experimental results for a Bi2223 superconducting tape at 50 Hz and 77 K.
Transcranial alternating current stimulation (tACS
Directory of Open Access Journals (Sweden)
Andrea eAntal
2013-06-01
Full Text Available Transcranial alternating current stimulation (tACS seems likely to open a new era of the field of noninvasive electrical stimulation of the human brain by directly interfering with cortical rhythms. It is expected to synchronize (by one single resonance frequency or desynchronize (e.g. by the application of several frequencies cortical oscillations. If applied long enough it may cause neuroplastic effects. In the theta range it may improve cognition when applied in phase. Alpha rhythms could improve motor performance, whereas beta intrusion may deteriorate them. TACS with both alpha and beta frequencies has a high likelihood to induce retinal phosphenes. Gamma intrusion can possibly interfere with attention. Stimulation in the ripple range induces intensity dependent inhibition or excitation in the motor cortex most likely by entrainment of neuronal networks, whereas stimulation in the low kHz range induces excitation by neuronal membrane interference. TACS in the 200 kHz range may have a potential in oncology.
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
ac loss and dc critical current densities of Nb3Sn tapes by the solid state diffusion process
International Nuclear Information System (INIS)
Suenaga, M.; Klamut, C.; Bussiere, J.F.
1976-01-01
The effects of metallurgical processing on 60 Hz ac losses and dc critical currents in Nb 3 Sn tapes fabricated by the solid state diffusion technique were investigated. An addition of Al to the Cu--Sn alloy for the matrix resulted in large reduction in the ac losses of Nb 3 Sn tapes, but the highest linear critical current densities were observed in Nb 3 Sn tapes produced with a Nb-1 wt percent Zr core in a Cu-13 wt percent Sn matrix. Values of the losses and the critical currents in these tapes can meet the present requirements for the ac superconducting power cables
Compensation methods applied in current control schemes for large AC drive systems
DEFF Research Database (Denmark)
Rus, D. C.; Preda, N. S.; Teodorescu, Remus
2012-01-01
The paper deals with modified PI current control structures for large AC drive systems which use surface mounted permanent magnet synchronous machines or squirrel-cage induction motors supplied with voltage source inverters. In order to reduce the power losses caused by high frequency switching...
Methods to reduce AC losses in HTS coated conductors with magnetic substrates
Energy Technology Data Exchange (ETDEWEB)
Tsukamoto, O. [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan)], E-mail: osami-t@ynu.ac.jp; Sekizawa, S.; Alamgir, A.K.M. [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan); Miyagi, D. [Okayama University, 1-1, Tsushima-Naka, 1-Chome, Okayama 700-8530 (Japan)
2007-10-01
HTS coated conductors (CCs) have high potentials as low-cost and long length conductors. However, a question remains as to what influence the magnetic property of the substrates has on the AC losses. In this paper, the influence of magnetic property of substrates on the AC losses in HTS CCs is studied. Based on the study methods to reduce the AC transport current losses and magnetization losses in CCs with magnetic substrates are investigated. It is shown that the losses can be reduced to the same level of those in CCs with non-magnetic substrates.
Methods to reduce AC losses in HTS coated conductors with magnetic substrates
International Nuclear Information System (INIS)
Tsukamoto, O.; Sekizawa, S.; Alamgir, A.K.M.; Miyagi, D.
2007-01-01
HTS coated conductors (CCs) have high potentials as low-cost and long length conductors. However, a question remains as to what influence the magnetic property of the substrates has on the AC losses. In this paper, the influence of magnetic property of substrates on the AC losses in HTS CCs is studied. Based on the study methods to reduce the AC transport current losses and magnetization losses in CCs with magnetic substrates are investigated. It is shown that the losses can be reduced to the same level of those in CCs with non-magnetic substrates
Self-field ac losses in biaxially aligned Y endash Ba endash Cu endash O tape conductors
International Nuclear Information System (INIS)
Iijima, Y.; Hosaka, M.; Sadakata, N.; Saitoh, T.; Kohno, O.; Takeda, K.
1997-01-01
Self-field ac losses were measured by the conventional ac four-probe method in biaxially aligned Y endash Ba endash Cu endash O tapes using polycrystalline Hastelloy tapes with textured yttria-stabilized-zirconia buffer layers. The ac losses increased in proportion to the fourth power of transport current in the high J c sample, and agreed well with Norris close-quote equation for thin strip conductors. However, the low J c sample had rather higher losses than Norris close-quote prediction, suggesting excessive magnetic flux penetration caused by percolated current paths. The results confirmed Norris close-quote prediction of the low ac losses for thin strip conductors, and indicated the importance of removing percolated structures of current paths to avoid higher ac losses than the theoretical predictions based on uniform conductors. copyright 1997 American Institute of Physics
Finite element modelling of electric currents in AC submerged arc furnaces
CSIR Research Space (South Africa)
Mc Dougall, I
2007-01-01
Full Text Available and the power ratings is not a hindrance. 2. MATHEMATICAL FORMULATION As the frequency of the current is low, the quasi-static form of Maxwell’s equations is solved. (1) (2) (3) (4) where E denotes the electric field intensity, H the magnetic field... of Electric Currents in AC Submerged Arc Furnaces 637 REFERENCES [1] Bermudez, A., Muniz, M.C., Pena, F. , Bullon, J., “ Numerical Computation of the Electromagnetic Field in the Electrodes of a Three-Phase Arc Furnace”, Int. Jnl for Numerical Methods...
Darmann, Francis Anthony
2013-10-08
A fault current limiter (FCL) includes a series of high permeability posts for collectively define a core for the FCL. A DC coil, for the purposes of saturating a portion of the high permeability posts, surrounds the complete structure outside of an enclosure in the form of a vessel. The vessel contains a dielectric insulation medium. AC coils, for transporting AC current, are wound on insulating formers and electrically interconnected to each other in a manner such that the senses of the magnetic field produced by each AC coil in the corresponding high permeability core are opposing. There are insulation barriers between phases to improve dielectric withstand properties of the dielectric medium.
Kvitkovic, J.; Hatwar, R.; Pamidi, S. V.; Fleshler, S.; Thieme, C.
2015-12-01
The temperature dependence of the critical current and AC losses were measured on American Superconductor Corporation's (AMSC) second generation high temperature superconducting (2G HTS) wire produced by Rolling Assisted Biaxially Textured Substrate (RABiTS) and Metal Organic Deposition (MOD) process. Wires manufactured with two types of substrates were characterized. The magnetic substrate with composition Ni5a%W exhibits a magnetic signature and has non-negligible AC losses in AC power applications. A new nonmagnetic substrate with an alloy composition Ni9a%W has been developed by AMSC to address the AC losses in 2G HTS. The data presented show that the performance of the new conductor is identical to the conductor with magnetic substrate in terms of critical current density. The data on AC losses demonstrate the absence of ferromagnetic loss component in the new conductor and significantly reduced AC losses at low to moderate values of I/Ic. The reduced losses will translate into reduced capital costs and lower operating costs of superconducting electrical devices for AC applications.
AC losses in horizontally parallel HTS tapes for possible wireless power transfer applications
Shen, Boyang; Geng, Jianzhao; Zhang, Xiuchang; Fu, Lin; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Gawith, James; Coombs, T. A.
2017-12-01
This paper presents the concept of using horizontally parallel HTS tapes with AC loss study, and the investigation on possible wireless power transfer (WPT) applications. An example of three parallel HTS tapes was proposed, whose AC loss study was carried out both from experiment using electrical method; and simulation using 2D H-formulation on the FEM platform of COMSOL Multiphysics. The electromagnetic induction around the three parallel tapes was monitored using COMSOL simulation. The electromagnetic induction and AC losses generated by a conventional three turn coil was simulated as well, and then compared to the case of three parallel tapes with the same AC transport current. The analysis demonstrates that HTS parallel tapes could be potentially used into wireless power transfer systems, which could have lower total AC losses than conventional HTS coils.
MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR
Directory of Open Access Journals (Sweden)
S. YU. Buryak
2014-03-01
Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes
Complex state variable- and disturbance observer-based current controllers for AC drives
DEFF Research Database (Denmark)
Dal, Mehmet; Teodorescu, Remus; Blaabjerg, Frede
2013-01-01
In vector-controlled AC drives, the design of current controller is usually based on a machine model defined in synchronous frame coordinate, where the drive performance may be degraded by both the variation of the machine parameters and the cross-coupling between the d- and q-axes components...... of the stator current. In order to improve the current control performance an alternative current control strategy was proposed previously aiming to avoid the undesired cross-coupling and non-linearities between the state variables. These effects are assumed as disturbances arisen in the closed-loop path...... of the parameter and the cross-coupling effect. Moreover, it provides a better performance, smooth and low noisy operation with respect to the complex variable controller....
Energy Technology Data Exchange (ETDEWEB)
Che' Rose, Simon
2007-01-15
In this work magneto-optical measurements on YBa{sub 2}Cu{sub 3}O{sub 7-x} and MgB{sub 2} thin films were done. For YBCO the influence of AC-pulses on the flux and current density of a thin film with transport current was investigated. For MgB{sub 2} the influence of AC-fields on the homogenous and dendritic flux penetration was researched. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Litzenberger, Wayne; Lava, Val
1994-08-01
References are contained for HVDC systems, converter stations and components, overhead transmission lines, cable transmission, system design and operations, simulation of high voltage direct current systems, high-voltage direct current installations, and flexible AC transmission system (FACTS).
DEFF Research Database (Denmark)
Magnusson, N.; Abrahamsen, Asger Bech; Liu, Dawei
2014-01-01
MgB2 superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must...... a simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting...
Characteristics of alternating current hopping conductivity in DNA sequences
Institute of Scientific and Technical Information of China (English)
Ma Song-Shan; Xu Hui; Wang Huan-You; Guo Rui
2009-01-01
This paper presents a model to describe alternating current (AC) conductivity of DNA sequences,in which DNA is considered as a one-dimensional (1D) disordered system,and electrons transport via hopping between localized states.It finds that AC conductivity in DNA sequences increases as the frequency of the external electric field rises,and it takes the form of σac(ω)~ω2 ln2(1/ω).Also AC conductivity of DNA sequences increases with the increase of temperature,this phenomenon presents characteristics of weak temperature-dependence.Meanwhile,the AC conductivity in an off diagonally correlated case is much larger than that in the uncorrelated case of the Anderson limit in low temperatures,which indicates that the off-diagonal correlations in DNA sequences have a great effect on the AC conductivity,while at high temperature the off-diagonal correlations no longer play a vital role in electric transport. In addition,the proportion of nucleotide pairs p also plays an important role in AC electron transport of DNA sequences.For p<0.5,the conductivity of DNA sequence decreases with the increase of p,while for p > 0.5,the conductivity increases with the increase of p.
Directory of Open Access Journals (Sweden)
Toralf eNeuling
2012-09-01
Full Text Available Transcranial direct current stimulation (tDCS has been applied in numerous scientific studies over the past decade. However, the possibility to apply tDCS in therapy of neuropsychiatric disorders is still debated. While transcranial magnetic stimulation (TMS has been approved for treatment of major depression in the United States by the Food and Drug Administration (FDA, tDCS is not as widely accepted. One of the criticisms against tDCS is the lack of spatial specificity. Focality is limited by the electrode size (35 cm2 are commonly used and the bipolar arrangement. However, a current flow through the head directly from anode to cathode is an outdated view. Finite element (FE models have recently been used to predict the exact current flow during tDCS. These simulations have demonstrated that the current flow depends on tissue shape and conductivity. Toface the challenge to predict the location, magnitude and direction of the current flow induced by tDCS and transcranial alternating current stimulation (tACS, we used a refined realistic FE modeling approach. With respect to the literature on clinical tDCS and tACS, we analyzed two common setups for the location of the stimulation electrodes which target the frontal lobe and the occipital lobe, respectively. We compared lateral and medial electrode configuration with regard to theirusability. We were able to demonstrate that the lateral configurations yielded more focused stimulation areas as well as higher current intensities in the target areas. The high resolution of our simulation allows one to combine the modeled current flow with the knowledge of neuronal orientation to predict the consequences of tDCS and tACS. Our results not only offer a basis for a deeper understanding of the stimulation sites currently in use for clinical applications but also offer a better interpretation of observed effects.
Finite-element analysis and comparison of the AC loss performance of BSCCO and YBCO conductors
International Nuclear Information System (INIS)
Stavrev, Svetlomir; Grilli, Francesco; Dutoit, Bertrand; Ashworth, Stephen
2006-01-01
The AC loss performance of two BSCCO and two YBCO conductors of different geometry, characterized by the same self-field critical current of 150 A, is analysed and compared quantitatively. The comparison is made using the finite-element method with a nonlinear B-dependent E-J relation. A new shell-region model is utilised for the simulations of thin YBCO strips. Different AC working conditions are simulated: self-field, applied external field, and combined transport current and external perpendicular field application. Magnetic field and current density profiles are investigated in order to illustrate the reasons for the loss difference in the conductors. Depending on the application, the advantages of using BSCCO or YBCO conductors with specific geometry are outlined
Unifying Concept of Serotonin Transporter-associated Currents*
Schicker, Klaus; Uzelac, Zeljko; Gesmonde, Joan; Bulling, Simon; Stockner, Thomas; Freissmuth, Michael; Boehm, Stefan; Rudnick, Gary; Sitte, Harald H.; Sandtner, Walter
2012-01-01
Serotonin (5-HT) uptake by the human serotonin transporter (hSERT) is driven by ion gradients. The stoichiometry of transported 5-HT and ions is predicted to result in electroneutral charge movement. However, hSERT mediates a current when challenged with 5-HT. This discrepancy can be accounted for by an uncoupled ion flux. Here, we investigated the mechanistic basis of the uncoupled currents and its relation to the conformational cycle of hSERT. Our observations support the conclusion that the conducting state underlying the uncoupled ion flux is in equilibrium with an inward facing state of the transporter with K+ bound. We identified conditions associated with accumulation of the transporter in inward facing conformations. Manipulations that increased the abundance of inward facing states resulted in enhanced steady-state currents. We present a comprehensive kinetic model of the transport cycle, which recapitulates salient features of the recorded currents. This study provides a framework for exploring transporter-associated currents. PMID:22072712
Unifying concept of serotonin transporter-associated currents.
Schicker, Klaus; Uzelac, Zeljko; Gesmonde, Joan; Bulling, Simon; Stockner, Thomas; Freissmuth, Michael; Boehm, Stefan; Rudnick, Gary; Sitte, Harald H; Sandtner, Walter
2012-01-02
Serotonin (5-HT) uptake by the human serotonin transporter (hSERT) is driven by ion gradients. The stoichiometry of transported 5-HT and ions is predicted to result in electroneutral charge movement. However, hSERT mediates a current when challenged with 5-HT. This discrepancy can be accounted for by an uncoupled ion flux. Here, we investigated the mechanistic basis of the uncoupled currents and its relation to the conformational cycle of hSERT. Our observations support the conclusion that the conducting state underlying the uncoupled ion flux is in equilibrium with an inward facing state of the transporter with K+ bound. We identified conditions associated with accumulation of the transporter in inward facing conformations. Manipulations that increased the abundance of inward facing states resulted in enhanced steady-state currents. We present a comprehensive kinetic model of the transport cycle, which recapitulates salient features of the recorded currents. This study provides a framework for exploring transporter-associated currents.
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
International Nuclear Information System (INIS)
Cha, Y.S.; Niemann, R.C.; Hull, J.R.; Youngdahl, C.A.; Lanagan, M.T.; Nakade, M.; Hara, T.
1995-06-01
Liquid helium boil-off experiments are conducted to determine the heat leakage rate of a pair of BSCCO 2223 high-temperature superconductor current leads made by sinter forging. The experiments are carried out in both DC and AC conditions and with and without an intermediate heat intercept. Current ranges are from 0-500 A for DC tests and 0-1,000 A rms for AC tests. The leads are self-cooled. Results show that magnetic hysteresis (AC) losses for both the BSCCO leads and the low-temperature superconductor current jumper are small for the current range. It is shown that significant reduction in heat leakage rate (liquid helium boil-off rate) is realized by using the BSCCO superconductor leads. At 100 A, the heat leakage rate of the BSCCO/copper binary lead is approximately 29% of that of the conventional copper lead. Further reduction in liquid helium boil-off rate can be achieved by using an intermediate heat intercept. For example, at 500 K, the heat leakage rate of the BSCCO/copper binary lead is only 7% of that of the conventional copper lead when an intermediate heat intercept is used
A Robust Suboptimal Current Control of an Interlink Converter for a Hybrid AC/DC Microgrid
Directory of Open Access Journals (Sweden)
Ismi Rosyiana Fitri
2018-05-01
Full Text Available A hybrid AC/DC microgrid is established with the aim of exploiting numerous types of renewable energy to meet the needs of different loads. The microgrid is decomposed by AC DC sub-grids which are connected by an interlink converter (IC. To maintain the security and reliability of the microgrid, an automatic controller for the interlink converter is needed. In this paper, we propose a Linear Matrix Inequalities (LMI-based current control method for the interlink converter. As the main features here, the interlink converter permits bidirectional power exchange between both sub-grids when a power–demand imbalance occurs in one sub-grid regardless of the converter system parameters. Simulations with various filter parameters are performed using the Matlab/Simulink software to validate the effectiveness of the proposed controller. In comparison with the existing Linear Quadratic Regulator (LQR-based current control, the proposed method is more robust against unknown system parameters and high load perturbation.
AC losses in superconductors: a multi-scale approach for the design of high current cables
International Nuclear Information System (INIS)
Escamez, Guillaume
2016-01-01
The work reported in this PhD deals with AC losses in superconducting material for large scale applications such as cables or magnets. Numerical models involving FEM or integral methods have been developed to solve the time transient electromagnetic distributions of field and current densities with the peculiarity of the superconducting constitutive E-J equation. Two main conductors have been investigated. First, REBCO superconductors for applications operating at 77 K are studied and a new architecture of conductor (round wires) for 3 kA cables. Secondly, for very high current cables, 3-D simulations on MgB_2 wires are built and solved using FEM modeling. The following chapter introduced new development used for the calculation of AC losses in DC cables with ripples. The thesis ends with the use of the developed numerical model on a practical example in the european BEST-PATHS project: a 10 kA MgB_2 demonstrator [fr
Characteristics of alternating current hopping conductivity in DNA sequences
International Nuclear Information System (INIS)
Song-Shan, Ma; Hui, Xu; Huan-You, Wang; Rui, Guo
2009-01-01
This paper presents a model to describe alternating current (AC) conductivity of DNA sequences, in which DNA is considered as a one-dimensional (1D) disordered system, and electrons transport via hopping between localized states. It finds that AC conductivity in DNA sequences increases as the frequency of the external electric field rises, and it takes the form of ø ac (ω) ∼ ω 2 ln 2 (1/ω). Also AC conductivity of DNA sequences increases with the increase of temperature, this phenomenon presents characteristics of weak temperature-dependence. Meanwhile, the AC conductivity in an off-diagonally correlated case is much larger than that in the uncorrelated case of the Anderson limit in low temperatures, which indicates that the off-diagonal correlations in DNA sequences have a great effect on the AC conductivity, while at high temperature the off-diagonal correlations no longer play a vital role in electric transport. In addition, the proportion of nucleotide pairs p also plays an important role in AC electron transport of DNA sequences. For p < 0.5, the conductivity of DNA sequence decreases with the increase of p, while for p ≥ 0.5, the conductivity increases with the increase of p. (cross-disciplinary physics and related areas of science and technology)
Fractional Modeling of the AC Large-Signal Frequency Response in Magnetoresistive Current Sensors
Directory of Open Access Journals (Sweden)
Sergio Iván Ravelo Arias
2013-12-01
Full Text Available Fractional calculus is considered when derivatives and integrals of non-integer order are applied over a specific function. In the electrical and electronic domain, the transfer function dependence of a fractional filter not only by the filter order n, but additionally, of the fractional order α is an example of a great number of systems where its input-output behavior could be more exactly modeled by a fractional behavior. Following this aim, the present work shows the experimental ac large-signal frequency response of a family of electrical current sensors based in different spintronic conduction mechanisms. Using an ac characterization set-up the sensor transimpedance function is obtained considering it as the relationship between sensor output voltage and input sensing current,[PLEASE CHECK FORMULA IN THE PDF]. The study has been extended to various magnetoresistance sensors based in different technologies like anisotropic magnetoresistance (AMR, giant magnetoresistance (GMR, spin-valve (GMR-SV and tunnel magnetoresistance (TMR. The resulting modeling shows two predominant behaviors, the low-pass and the inverse low-pass with fractional index different from the classical integer response. The TMR technology with internal magnetization offers the best dynamic and sensitivity properties opening the way to develop actual industrial applications.
Calculation of AC losses in large HTS stacks and coils
DEFF Research Database (Denmark)
Zermeno, Victor; Abrahamsen, Asger Bech; Mijatovic, Nenad
2012-01-01
In this work, we present a homogenization method to model a stack of HTS tapes under AC applied transport current or magnetic field. The idea is to find an anisotropic bulk equivalent for the stack of tapes, where the internal alternating structures of insulating, metallic, superconducting...... allowing for overcritical current densities to be considered. The method presented here allowed for a computational speedup factor of up to 2 orders of magnitude when compared to full 2-D simulations taking into account the actual structure of the stacks without compromising accuracy....
Experimental Study on the Influence of AC Stray Current on the Cathodic Protection of Buried Pipe
Directory of Open Access Journals (Sweden)
Qingmiao Ding
2016-01-01
Full Text Available The size of the damaged area of the coating and its position on the pipeline impacted the cathodic protection potential, and there was a damaged area of the greatest impact value. When damaged area was 300 mm2, the IR drop was the largest, and this situation could easily lead to inadequate protection; when the parallel spacing between pipeline and interference source was unchanged, the measured value curves of cathodic protection potential presented “U” shaped trend with the increasing stray current interference intensity. Under certain parallel spacing between pipeline and interference source, high alternating stray current intensity would cause serious negative offsets, so that the overprotection of the pipeline occurred, and make the coating crack; there was a parallel threshold length. When less than the threshold, the pipe-ground potential increases rapidly with the parallel length increasing. In order to judge whether a pipeline was interference by AC stray current and the risk of stray current corrosion, we should make a comprehensive analysis of the cathodic protection energizing potential, the switch-off potential, AC pipe-soil potential, IR drops, and so on.
A MEMS AC current sensor for residential and commercial electricity end-use monitoring
International Nuclear Information System (INIS)
Leland, E S; Wright, P K; White, R M
2009-01-01
This paper presents a novel prototype MEMS sensor for alternating current designed for monitoring electricity end-use in residential and commercial environments. This new current sensor design is comprised of a piezoelectric MEMS cantilever with a permanent magnet mounted on the cantilever's free end. When placed near a wire carrying AC current, the magnet is driven sinusoidally, producing a voltage in the cantilever proportional to the current being measured. Analytical models were developed to predict the applicable magnetic forces and piezoelectric voltage output in order to guide the design of a sensor prototype. This paper also details the fabrication process for this sensor design. Released piezoelectric MEMS cantilevers have been fabricated using a four-mask process and aluminum nitride as the active piezoelectric material. Dispenser-printed microscale composite permanent magnets have been integrated, resulting in the first MEMS-scale prototypes of this current sensor design
International Nuclear Information System (INIS)
Matsushita, Teruo; Yamafuji, Kaoru; Sakamoto, Nobuyoshi.
1977-01-01
In case of applying superconductors to electric machinery or high intensity field magnets for fusion reactors, the superconductors are generally expected to be sensible to small field fluctuation besides DC magnetic field. The behavior of superconductors in DC magnetic field superimposed with small AC magnetic field has been investigated often experimentally, and the result has been obtained that the critical current at which DC flow voltage begins to appear extremely decreased or disappeared. Some theoretical investigations have been carried out on this phenomenon so far, however, their application has been limited to the region where frequency is sufficiently low or which is close to the critical magnetic field. Purpose of this report is to deal with the phenomenon in more unified way by analyzing the behavior of magnetic flux lines in a superconductor under a superimposed small AC field using the criticalstate model including viscous force. In order to solve the fundamental equation in this report, first the solution has been obtained in the quasi-static state neglecting viscous force, then about the cases that current density J is not more than Jc and J is larger than Jc, concerning the deviation from the quasi-static limit by employing successive approximation. Current-voltage characteristics have been determined by utilizing the above results. This method seems to be most promising at present except the case of extremely high frequency. (Wakatsuki, Y.)
Khair, Ummul; Jabbar Lubis, Abdul; Agustha, Indra; Dharmawati; Zulfin, M.
2017-12-01
The current electricity needs is very primary, all objects including electronics require power, it encourages people not to be able to save electricity so the theft of electric power would be done. The use of ACS712 current sensor as the sensor with arduino uno would find out the power consumption continuously and prevent the theft of electricity because of the use of electricity which has been determined by PLN and the people fetl that it is not enough for every house, so the author made a tool for prevention of theft of electric power by using the arduino uno, buzzer, ACS712 current sensor, lcd, and relay then the power usage can be controlled according to the use to prevent the occurrence of theft of electricity so the use can be seen directly on the lcd 16x2and GSM modem to give information to employees of PLN so that it can reduceelectrical theft by the public.
DEFF Research Database (Denmark)
Wei, Baoze; Guerrero, Josep M.; Quintero, Juan Carlos Vasquez
2017-01-01
This paper presents a theoretical study with experimental validation of a circulating-current suppression method for parallel operation of three-phase voltage source inverters (VSI), which may be suitable for modular parallel uninterruptible power supply systems or hybrid AC/DC microgrid applicat......This paper presents a theoretical study with experimental validation of a circulating-current suppression method for parallel operation of three-phase voltage source inverters (VSI), which may be suitable for modular parallel uninterruptible power supply systems or hybrid AC/DC microgrid......, and added into the conventional droop plus virtual impedance control. In the control architecture, the reference voltages of the inverters are generated by the primary control loop which consists of a droop control and a virtual impedance. The secondary control is used to compensate the voltage drop...
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
Analysis of the ac SQUID with low inductance and low critical current
DEFF Research Database (Denmark)
Sørensen, O. H.
1976-01-01
The properties of the ac SQUID magnetometer has been analyzed. The results are valid in the low-inductance low-critical-current regime, where the Lri0 producted is belowthe value at which the relation between the enclosed and externally applied magnetic dc flux becomes reentrant. The effects...... of the screening current circulating in the SQUID ring as well as of the SQUID-ring time constant, tau-Lr/R9 are taken into account. Here LR IS THE SQUID-ring inductance, and R is the shunt resistance in the shunted junction model assumed to describe the weak link. It is shown that for finite values of omegatau...... constriuctively with the result that the optimal response occurs at a definite and finite value of omegatau. If omegatau is increased beyond this optimal value the weak link behavior is dominated by the Ohmic current channel implying that only if the shunt conductance contains a term depending...
Directory of Open Access Journals (Sweden)
Rui Li
2016-12-01
Full Text Available The AC voltage control of a DC/DC converter based on the modular multilevel converter (MMC is considered under normal operation and during a local DC fault. By actively setting the AC voltage according to the two DC voltages of the DC/DC converter, the modulation index can be near unity, and the DC voltage is effectively utilized to output higher AC voltage. This significantly decreases submodule (SM capacitance and conduction losses of the DC/DC converter, yielding reduced capital cost, volume, and higher efficiency. Additionally, the AC voltage is limited in the controllable range of both the MMCs in the DC/DC converter; thus, over-modulation and uncontrolled currents are actively avoided. The AC voltage control of the DC/DC converter during local DC faults, i.e., standby operation, is also proposed, where only the MMC connected on the faulty cable is blocked, while the other MMC remains operational with zero AC voltage output. Thus, the capacitor voltages can be regulated at the rated value and the decrease of the SM capacitor voltages after the blocking of the DC/DC converter is avoided. Moreover, the fault can still be isolated as quickly as the conventional approach, where both MMCs are blocked and the DC/DC converter is not exposed to the risk of overcurrent. The proposed AC voltage control strategy is assessed in a three-terminal high-voltage direct current (HVDC system incorporating a DC/DC converter, and the simulation results confirm its feasibility.
21 CFR 880.5500 - AC-powered patient lift.
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)
International Nuclear Information System (INIS)
Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.
2007-01-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured
Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)
Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.
2007-10-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured.
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
Transport simulations TFTR: Theoretically-based transport models and current scaling
International Nuclear Information System (INIS)
Redi, M.H.; Cummings, J.C.; Bush, C.E.; Fredrickson, E.; Grek, B.; Hahm, T.S.; Hill, K.W.; Johnson, D.W.; Mansfield, D.K.; Park, H.; Scott, S.D.; Stratton, B.C.; Synakowski, E.J.; Tang, W.M.; Taylor, G.
1991-12-01
In order to study the microscopic physics underlying observed L-mode current scaling, 1-1/2-d BALDUR has been used to simulate density and temperature profiles for high and low current, neutral beam heated discharges on TFTR with several semi-empirical, theoretically-based models previously compared for TFTR, including several versions of trapped electron drift wave driven transport. Experiments at TFTR, JET and D3-D show that I p scaling of τ E does not arise from edge modes as previously thought, and is most likely to arise from nonlocal processes or from the I p -dependence of local plasma core transport. Consistent with this, it is found that strong current scaling does not arise from any of several edge models of resistive ballooning. Simulations with the profile consistent drift wave model and with a new model for toroidal collisionless trapped electron mode core transport in a multimode formalism, lead to strong current scaling of τ E for the L-mode cases on TFTR. None of the theoretically-based models succeeded in simulating the measured temperature and density profiles for both high and low current experiments
Guo, Zhaojiang; Kang, Shi; Zhu, Xun; Xia, Jixing; Wu, Qingjun; Wang, Shaoli; Xie, Wen; Zhang, Youjun
2015-04-01
Biopesticides or transgenic crops based on Cry toxins from the soil bacterium Bacillus thuringiensis (Bt) effectively control agricultural insect pests. The sustainable use of Bt biopesticides and Bt crops is threatened, however, by the development of Cry resistance in the target pests. The diamondback moth, Plutella xylostella (L.), is the first pest that developed resistance to a Bt biopesticide in the field, and a recent study has shown that the resistance of P. xylostella to Cry1Ac is caused by a mutation in an ATP-binding cassette (ABC) transporter gene (ABCC2). In this study, we report that down-regulation of a novel ABC transporter gene from ABCG subfamily (Pxwhite) is associated with Cry1Ac resistance in P. xylostella. The full-length cDNA sequence of Pxwhite was cloned and analyzed. Spatial-temporal expression detection revealed that Pxwhite was expressed in all tissues and developmental stages, and highest expressed in Malpighian tubule tissue and in egg stage. Sequence variation analysis of Pxwhite indicated the absence of constant non-synonymous mutations between susceptible and resistant strains, whereas midgut transcript analysis showed that Pxwhite was remarkably reduced in all resistant strains and further reduced when larvae of the moderately resistant SZ-R strain were subjected to selection with Cry1Ac toxin. Furthermore, RNA interference (RNAi)-mediated suppression of Pxwhite gene expression significantly reduced larval susceptibility to Cry1Ac toxin, and genetic linkage analysis confirmed that down-regulation of Pxwhite gene is tightly linked to Cry1Ac resistance in P. xylostella. To our knowledge, this is the first report indicating that Pxwhite gene is involved in Cry1Ac resistance in P. xylostella. Copyright © 2015 Elsevier Ltd. All rights reserved.
Nguyen, Doan Ngoc
Alternating current (AC) loss and current carrying capacity are two of the most crucial considerations in large-scale power applications of high temperature superconducting (HTS) conductors. AC losses result in an increased thermal load for cooling machines, and thus increased operating costs. Furthermore, AC losses can stimulate quenching phenomena or at least decrease the stability margin for superconducting devices. Thus, understanding AC losses is essential for the development of HTS AC applications. The main focus of this dissertation is to make reliable total AC loss measurements and interpret the experimental results in a theoretical framework. With a specially designed magnet, advanced total AC loss measurement system in liquid nitrogen (77 K) has been successfully built. Both calorimetric and electromagnetic methods were employed to confirm the validity of the measured results and to have a more thorough understanding of AC loss in HTS conductors. The measurement is capable of measuring total AC loss in HTS tapes over a wide range of frequency and amplitude of transport current and magnetic field. An accurate phase control technique allows measurement of total AC loss with any phase difference between the transport current and magnetic field by calorimetric method. In addition, a novel total AC loss measurement system with variable temperatures from 30 K to 100 K was successfully built and tested. Understanding the dependence of AC losses on temperature will enable optimization of the operating temperature and design of HTS devices. As a part of the dissertation, numerical calculations using Brandt's model were developed to study electrodynamics and total AC loss in HTS conductors. In the calculations, the superconducting electrical behavior is assumed to follow a power-law model. In general, the practical properties of conductors, including field-dependence of critical current density Jc, n-value and non-uniform distribution of Jc, can be accounted for in
ACS sampling system: design, implementation, and performance evaluation
Di Marcantonio, Paolo; Cirami, Roberto; Chiozzi, Gianluca
2004-09-01
By means of ACS (ALMA Common Software) framework we designed and implemented a sampling system which allows sampling of every Characteristic Component Property with a specific, user-defined, sustained frequency limited only by the hardware. Collected data are sent to various clients (one or more Java plotting widgets, a dedicated GUI or a COTS application) using the ACS/CORBA Notification Channel. The data transport is optimized: samples are cached locally and sent in packets with a lower and user-defined frequency to keep network load under control. Simultaneous sampling of the Properties of different Components is also possible. Together with the design and implementation issues we present the performance of the sampling system evaluated on two different platforms: on a VME based system using VxWorks RTOS (currently adopted by ALMA) and on a PC/104+ embedded platform using Red Hat 9 Linux operating system. The PC/104+ solution offers, as an alternative, a low cost PC compatible hardware environment with free and open operating system.
Nonlinear AC susceptibility, surface and bulk shielding
van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.
1996-02-01
We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.
International Nuclear Information System (INIS)
Kim, S.B.; Uwani, Y.; Joo, J.H.; Kawamoto, R.; Jo, Y.S.
2011-01-01
The electric device applications of a high temperature superconducting (HTS) bulk magnet, having stable levitation and suspension properties according to their strong flux pinning force, have been proposed and developed. We have been investigating a three-dimensional (3-D) superconducting actuator using HTS bulks to develop a non-contract transportation device which moves freely in space. It is certain for our proposed 3-D superconducting actuator to be useful as a transporter used in a clean room where silicon wafers, which do not like mechanical contact and dust, are manufactured. The proposed actuator consists of the trapped HTS bulk as a mover and two-dimensionally arranged electromagnets as a stator. Up to now, the electromagnets consisted with iron core and copper coil were used as a stator, and each electromagnet was individually controlled using DC power supplies. In our previous work, the unstable movement characteristics of HTS bulk were observed under the DC operation, and the AC electromagnets driven with AC controlled current was proposed to solve these problems. In general, the trapped magnetic field in HTS bulk was decayed by a time-varying external magnetic field. Thus, it needs to optimize the shapes of AC electromagnets and operating patterns, the decay properties of the trapped magnetic field in the HTS bulk mover by the AC magnetic field should be cleared. In this paper, the influences of the frequency, the overall operating time, the strength of magnetization field and drive current against the decay of trapped magnetic field were experimentally studied using the fabricated AC electromagnets.
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
Energy Technology Data Exchange (ETDEWEB)
Yuan Weijia; Campbell, A M; Hong, Z; Ainslie, M D; Coombs, T A, E-mail: wy215@cam.ac.u [Electronic, Power and Energy Conversion Group, Electrical Engineering Division, Engineering Department, University of Cambridge, Cambridge CB3 0FA (United Kingdom)
2010-08-15
A model is presented for calculating the AC losses, magnetic field/current density distribution and critical currents of a circular superconducting pancake coil. The assumption is that the magnetic flux lines will lie parallel to the wide faces of tapes in the unpenetrated area of the coil. Instead of using an infinitely long stack to approximate the circular coil, this paper gives an exact circular coil model using elliptic integrals. A new efficient numerical method is introduced to yield more accurate and fast computation. The computation results are in good agreement with the assumptions. For a small value of the coil radius, there is an asymmetry along the coil radius direction. As the coil radius increases, this asymmetry will gradually decrease, and the AC losses and penetration depth will increase, but the critical current will decrease. We find that if the internal radius is equal to the winding thickness, the infinitely long stack approximation overestimates the loss by 10% and even if the internal radius is reduced to zero, the error is still only 60%. The infinitely long stack approximation is therefore adequate for most practical purposes. In addition, the comparison result shows that the infinitely long stack approximation saves computation time significantly.
21 CFR 880.5510 - Non-AC-powered patient lift.
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is a hydraulic, battery, or mechanically powered device, either fixed or mobile, used to lift and transport a...
Hybrid superconducting a.c. current limiter extrapolation 63 kV-1 250 A
Tixador, P.; Levêque, J.; Brunet, Y.; Pham, V. D.
1994-04-01
Following the developement of a.c. superconducting wires a.c. current superconducting limiters have emerged. These limiters limit the fault currents nearly instantaneously, without detection nor order giver and may be suitable for high voltages. They are based on the natural transition from the superconducting state to the normal resistive state by overstepping the critical current of a superconducting coil which limits or triggers the limitation. Our limiter device consists essentially of two copper windings coupled through a saturable magnetic circuit and of a non inductively wound superconducting coil with a reduced current compared to the line current. This design allows a simple superconducting cable and reduced cryogenic losses but the dielectric stresses are high during faults. A small model (150 V/50 A) has experimentally validated our design. An industrial scale current limiter is designed and the comparisons between this design and other superconducting current limiters are given. Les courants de court-circuit sur les grands réseaux électriques ne cessent d'augmenter. Dans ce contexte sont apparus les limiteurs supraconducteurs de courant suite au développement des brins supraconducteurs alternatifs. Ces limiteurs peuvent limiter les courants de défaut presque instantanément, sans détection de défaut ni donneur d'ordre et ils sont extrapolables aux hautes tensions. Ils sont fondés sur la transition naturelle de l'état supraconducteur à l'état normal très résistif par dépassement du courant critique d'un enroulement supraconducteur qui limite ou déclenche la limitation. Notre limiteur est composé de deux enroulements en cuivre couplés par un circuit magnétique saturable et d'une bobine supraconductrice à courant réduit par rapport au courant de la ligne. Cette conception permet un câble supraconducteur simple et des pertes cryogéniques réduites mais les contraintes diélectriques en régime de défaut sont importantes. Une maquette
Efficacy of low level electric current (A-C) for controlling quagga mussles in the Welland Canal
Energy Technology Data Exchange (ETDEWEB)
Fears, C. [Delta Applied Technology, Inc., Pittsburgh, PA (United States); Mackie, G.L. [Water Systems Analysts, Guelph, Ontario (Canada)
1995-06-01
The efficacy of systems (for which patents are pending) which use low-voltage A-C currents for preventing settlement and attachment by zebra mussels were tested with steel rods and plates placed near the intake of a pulp and paper plant in the Welland Canal at Thorold, Ontario. Six racks made of 16 ft. (4.9 m), 2x4s (5.1 x 10.2 cm) were placed into the Welland Canal on August 5, 1994. One rack had 1/8th in (3.2 mm) diam x 12 in (30.5 cm) long steel rods, each separated by 2 in (5.1 cm) attached to pressure treated wood and concrete blocks and an A-C current of 16 v (or 8 v/in); rack 2 had steel rods of the same configuration but 12 v (or 6 v/in) was applied; rack 3 was identical to these but no current was applied and was used as a rod control. The remaining three racks had steel plates, each plate being 3 in (7.6 cm) wide X 24 in (61 cm) long X 1/4 in (6.4 mm) thick and separated by 2 in (5.1 cm); one had 12 v applied (or 6 v/in), another had 16 v applied (or 8 v/in), and the third had no current and was used as a plate control. The racks were placed on the upstream and downstream side of the intake at a depth of about 7 ft (2.1 m) where the mussels populations were heaviest (as determined by SCUBA diving). All mussels were quagga mussels (Dreissena bugensis). The racks were pulled in mid November after settlement was complete and the results showed: (1) complete prevention of settlement of both new recruits and translocators at 8 volts/in with steel rods on both wood and concrete surfaces and with steel plate trash bars; (2) partial prevention of settlement at 6 volts/in with steel rods on both wood and concrete surfaces and steel plates; and (3) that, at current kilowatt hr rates, total efficacy at 8 volts/in would cost approximately $10.80/day/1000 sq ft using rods to protect concrete walls and about $16.32/day/1000 sq ft to protect 3 in wide x 1/4 in thick trash bars. These costs can be reduced even further with pulse dosed AC currents.
Directory of Open Access Journals (Sweden)
Linda J Gahan
2010-12-01
Full Text Available Transgenic crops producing insecticidal toxins from Bacillus thuringiensis (Bt are commercially successful in reducing pest damage, yet knowledge of resistance mechanisms that threaten their sustainability is incomplete. Insect resistance to the pore-forming Cry1Ac toxin is correlated with the loss of high-affinity, irreversible binding to the mid-gut membrane, but the genetic factors responsible for this change have been elusive. Mutations in a 12-cadherin-domain protein confer some Cry1Ac resistance but do not block this toxin binding in in vitro assays. We sought to identify mutations in other genes that might be responsible for the loss of binding. We employed a map-based cloning approach using a series of backcrosses with 1,060 progeny to identify a resistance gene in the cotton pest Heliothis virescens that segregated independently from the cadherin mutation. We found an inactivating mutation of the ABC transporter ABCC2 that is genetically linked to Cry1Ac resistance and is correlated with loss of Cry1Ac binding to membrane vesicles. ABC proteins are integral membrane proteins with many functions, including export of toxic molecules from the cell, but have not been implicated in the mode of action of Bt toxins before. The reduction in toxin binding due to the inactivating mutation suggests that ABCC2 is involved in membrane integration of the toxin pore. Our findings suggest that ABC proteins may play a key role in the mode of action of Bt toxins and that ABC protein mutations can confer high levels of resistance that could threaten the continued utilization of Bt-expressing crops. However, such mutations may impose a physiological cost on resistant insects, by reducing export of other toxins such as plant secondary compounds from the cell. This weakness could be exploited to manage this mechanism of Bt resistance in the field.
Gahan, Linda J; Pauchet, Yannick; Vogel, Heiko; Heckel, David G
2010-12-16
Transgenic crops producing insecticidal toxins from Bacillus thuringiensis (Bt) are commercially successful in reducing pest damage, yet knowledge of resistance mechanisms that threaten their sustainability is incomplete. Insect resistance to the pore-forming Cry1Ac toxin is correlated with the loss of high-affinity, irreversible binding to the mid-gut membrane, but the genetic factors responsible for this change have been elusive. Mutations in a 12-cadherin-domain protein confer some Cry1Ac resistance but do not block this toxin binding in in vitro assays. We sought to identify mutations in other genes that might be responsible for the loss of binding. We employed a map-based cloning approach using a series of backcrosses with 1,060 progeny to identify a resistance gene in the cotton pest Heliothis virescens that segregated independently from the cadherin mutation. We found an inactivating mutation of the ABC transporter ABCC2 that is genetically linked to Cry1Ac resistance and is correlated with loss of Cry1Ac binding to membrane vesicles. ABC proteins are integral membrane proteins with many functions, including export of toxic molecules from the cell, but have not been implicated in the mode of action of Bt toxins before. The reduction in toxin binding due to the inactivating mutation suggests that ABCC2 is involved in membrane integration of the toxin pore. Our findings suggest that ABC proteins may play a key role in the mode of action of Bt toxins and that ABC protein mutations can confer high levels of resistance that could threaten the continued utilization of Bt-expressing crops. However, such mutations may impose a physiological cost on resistant insects, by reducing export of other toxins such as plant secondary compounds from the cell. This weakness could be exploited to manage this mechanism of Bt resistance in the field.
El-Shabaan, M. M.
2018-02-01
Impedance spectroscopy and alternating-current (AC) conductivity (σ AC) studies of bulk 3-amino-7-(dimethylamino)-2-methyl-hydrochloride (neutral red, NR) have been carried out over the temperature (T) range from 303 K to 383 K and frequency (f) range from 0.5 kHz to 5 MHz. Dielectric data were analyzed using the complex impedance (Z *) and complex electric modulus (M *) for bulk NR at various temperatures. The impedance loss peaks were found to shift towards high frequencies, indicating an increase in the relaxation time (τ 0) and loss in the material, with increasing temperature. For each temperature, a single depressed semicircle was observed at high frequencies, originating from the bulk transport, and a spike in the low-frequency region, resulting from the electrode effect. Fitting of these curves yielded an equivalent circuit containing a parallel combination of a resistance R and constant-phase element (CPE) Q. The carrier transport in bulk NR is governed by the correlated barrier hopping (CBH) mechanism, some parameters of which, such as the maximum barrier height (W M), charge density (N), and hopping distance (r), were determined as functions of both temperature and frequency. The frequency dependence of σ AC at different temperatures indicated that the conduction in bulk NR is a thermally activated process. The σ AC value at different frequencies increased linearly with temperature.
The effect of non-inductive current drive on tokamak transport
International Nuclear Information System (INIS)
Helander, P; Akers, R J; Valovic, M; Peysson, Y
2005-01-01
Non-inductive current drive causes cross-field neoclassical transport in a tokamak, in much the same way that the toroidal electric field used to drive the plasma current produces the so-called Ware pinch. This transport can be either inwards or outwards, depending on the current drive mechanism, and can be either larger or smaller than the analogous Ware pinch. A Green's function formalism is used to calculate the transport produced by wave-driven currents, which is found to be inwards for electron-cyclotron and lower-hybrid current drive. Its magnitude is proportional to the collisionality of the current-carrying electrons and therefore smaller than the Ware pinch when the resonant electrons are suprathermal. In contrast, neutral-beam current drive produces outward particle transport when the beams are injected in the same toroidal direction as the plasma current, and inward particle transport otherwise. This transport is somewhat larger than the corresponding Ware pinch. Together, they may explain an observation made on several tokamaks over the years, most recently on MAST, that density profiles tend to be more peaked during counter-injection
Directory of Open Access Journals (Sweden)
Tal eSela
2012-02-01
Full Text Available The process of evaluating risks and benefits involves a complex neural network that includes the dorsolateral prefrontal cortex (DLPFC. It has been proposed that in conflict and reward situations, theta-band (4–8 Hz oscillatory activity in the frontal cortex may reflect an electrophysiological mechanism for coordinating neural networks monitoring behavior, as well as facilitating task-specific adaptive changes. The goal of the present study was to investigate the hypothesis that theta-band oscillatory balance between right and left frontal and prefrontal regions, with a predominance role to the right hemisphere, is crucial for regulatory control during decision-making under risk. In order to explore this hypothesis, we used transcranial Alternating Current Stimulation (tACS, a novel technique that provides the opportunity to explore the functional role of neuronal oscillatory activities and to establish a causal link between specific oscillations and functional lateralization in risky decision-making situations. For this aim, healthy participants were randomly allocated to one of three stimulation groups (LH stimulation / RH stimulation / Sham stimulation, with active AC stimulation delivered in a frequency-dependent manner (at 6.5 Hz; 1mA peak to-peak. During the AC stimulation, participants performed the Balloon Analog Risk Task. This experiment revealed that participants receiving LH stimulation displayed riskier decision-making style compared to sham and RH stimulation groups. However, there was no difference in decision-making behaviors between sham and RH stimulation groups. The current study extends the notion that DLPFC activity is critical for adaptive decision-making in the context of risk-taking and emphasis the role of theta-band oscillatory activity during risky decision-making situations.
AC losses in (Bi,Pb) 2Sr 2Ca 2Cu 3O x tapes
D'Anna, G.; Indenbom, M. V.; André, M.-O.; Benoit, W.; Grivel, J.-C.; Hensel, B.; Flükiger, R.
1994-05-01
A double peak structure is observed in the AC losses of (Bi,Pb) 2Sr 2Ca 2Cu 3O x silver-sheathed tapes using a torsion-pendulum oscillator. The low-temperature peak is associated to the intragrain flux expulsion, while the high-temperature peak results from a macroscopic current path around the whole sample due to a well-coupled fraction of the grains. The flux pinning by the dislocations forming small-angle grain boundaries is suggested to control the transport current.
DEFF Research Database (Denmark)
Däumling, Manfred; Olsen, Søren Krüger; Rasmussen, Carsten
1998-01-01
be recorded using, for example, a digital oscilloscope. The amplitude decay of the periodic voltage or current accurately reflects the power loss in the system. It consists of two components-an ohmic purely exponential one (from leads, contacts, etc.), and a nonexponential component originating from......A simple way to obtain true ac losses with a resonant circuit containing a superconductor, using the decay of the circuit current, is described. For the measurement a capacitor is short circuited with a superconducting cable. Energy in the circuit is provided by either charging up the capacitors...... with a certain voltage, or letting a de flow in the superconductor. When the oscillations are started-either by opening a switch in case a de is flowing or by closing a switch to connect the charged capacitors with the superconductor-the current (via a Rogowski coil) or the voltage on the capacitor can...
Synaptically evoked glutamate transporter currents in Spinal Dorsal Horn Astrocytes
Directory of Open Access Journals (Sweden)
Dougherty Patrick M
2009-07-01
Full Text Available Abstract Background Removing and sequestering synaptically released glutamate from the extracellular space is carried out by specific plasma membrane transporters that are primarily located in astrocytes. Glial glutamate transporter function can be monitored by recording the currents that are produced by co-transportation of Na+ ions with the uptake of glutamate. The goal of this study was to characterize glutamate transporter function in astrocytes of the spinal cord dorsal horn in real time by recording synaptically evoked glutamate transporter currents. Results Whole-cell patch clamp recordings were obtained from astrocytes in the spinal substantia gelatinosa (SG area in spinal slices of young adult rats. Glutamate transporter currents were evoked in these cells by electrical stimulation at the spinal dorsal root entry zone in the presence of bicuculline, strychnine, DNQX and D-AP5. Transporter currents were abolished when synaptic transmission was blocked by TTX or Cd2+. Pharmacological studies identified two subtypes of glutamate transporters in spinal astrocytes, GLAST and GLT-1. Glutamate transporter currents were graded with stimulus intensity, reaching peak responses at 4 to 5 times activation threshold, but were reduced following low-frequency (0.1 – 1 Hz repetitive stimulation. Conclusion These results suggest that glutamate transporters of spinal astrocytes could be activated by synaptic activation, and recording glutamate transporter currents may provide a means of examining the real time physiological responses of glial cells in spinal sensory processing, sensitization, hyperalgesia and chronic pain.
Energy Technology Data Exchange (ETDEWEB)
Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College
1991-04-30
This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
Methods, systems and apparatus for controlling operation of two alternating current (AC) machines
Gallegos-Lopez, Gabriel [Torrance, CA; Nagashima, James M [Cerritos, CA; Perisic, Milun [Torrance, CA; Hiti, Silva [Redondo Beach, CA
2012-02-14
A system is provided for controlling two AC machines. The system comprises a DC input voltage source that provides a DC input voltage, a voltage boost command control module (VBCCM), a five-phase PWM inverter module coupled to the two AC machines, and a boost converter coupled to the inverter module and the DC input voltage source. The boost converter is designed to supply a new DC input voltage to the inverter module having a value that is greater than or equal to a value of the DC input voltage. The VBCCM generates a boost command signal (BCS) based on modulation indexes from the two AC machines. The BCS controls the boost converter such that the boost converter generates the new DC input voltage in response to the BCS. When the two AC machines require additional voltage that exceeds the DC input voltage required to meet a combined target mechanical power required by the two AC machines, the BCS controls the boost converter to drive the new DC input voltage generated by the boost converter to a value greater than the DC input voltage.
Computer simulation of transport driven current in tokamaks
International Nuclear Information System (INIS)
Nunan, W.J.; Dawson, J.M.
1993-01-01
Plasma transport phenomena can drive large currents parallel to an externally applied magnetic field. The Bootstrap Current Theory accounts for the effect of Banana diffusion on toroidal current, but the effect is not confined to that transport regime. The authors' 2 1/2-D, electromagnetic, particle simulations have demonstrated that Maxwellian plasmas in static toroidal and vertical fields spontaneously develop significant toroidal current, even in the absence of the open-quotes seed currentclose quotes which the Bootstrap Theory requires. Other simulations, in both toroidal and straight cylindrical geometries, and without any externally imposed electric field, show that if the plasma column is centrally fueled, and if the particle diffusion coefficient exceeds the magnetic diffusion coefficient (as is true in most tokamaks) then the toroidal current grows steadily. The simulations indicate that such fueling, coupled with central heating due to fusion reactions may drive all of the tokamak's toroidal current. The Bootstrap and dynamo mechanisms do not drive toroidal current where the poloidal magnetic field is zero. The simulations, as well as initial theoretical work, indicate that in tokamak plasmas, various processes naturally transport current from the outer regions of the plasma to the magnetic axis. The mechanisms which cause this effective electron viscosity include conventional binary collisions, wave emission and reabsorption, and also convection associated with rvec E x rvec B vortex motion. The simulations also exhibit preferential loss of particles carrying current opposing the bulk plasma current. This preferential loss generates current even at the magnetic axis. If these self-seeding mechanisms function in experiments as they do in the simulations, then transport driven current would eliminate the need for any external current drive in tokamaks, except simple ohmic heating for initial generation of the plasma
International Nuclear Information System (INIS)
Zav'yalov, D. V.; Kryuchkov, S. V.
2008-01-01
The current flowing along a cylindrical quantum wire with a superlattice in the case of the simultaneous application of dc and ac fields is calculated. It is assumed that the wire contains impurity centers, whose ionization results in the generation of nonequilibrium carriers in the conduction band. It is found that the dependence of the steady component of the current on the ac-field frequency is a step-like function. It is shown that the distance between steps depends on the conduction miniband width and the transverse quantum confinement parameters and is independent of the impurity-level depth.
Quasienergy spectrum and tunneling current in ac-driven triple quantum dot shuttles
Energy Technology Data Exchange (ETDEWEB)
Villavicencio, J [Facultad de Ciencias, Universidad Autonoma de Baja California, Ensenada (Mexico); Maldonado, I [Centro de Investigacion Cientifica y de Educacion Superior de Ensenada (Mexico); Cota, E [Centro de Nanociencias y Nanotecnologia, Universidad Nacional Autonoma de Mexico, Ensenada (Mexico); Platero, G, E-mail: villavics@uabc.edu.mx [Instituto de Ciencia de Materiales de Madrid (CSIC), Cantoblanco, 28049 Madrid (Spain)
2011-02-15
The dynamics of electrons in ac-driven double quantum dots have been extensively analyzed by means of Floquet theory. In these systems, coherent destruction of tunneling has been shown to occur for certain ac field parameters. In this work we analyze, by means of Floquet theory, the electron dynamics of a triple quantum dot in series attached to electric contacts, where the central dot position oscillates. In particular, we analyze the quasienergy spectrum of this ac-driven nanoelectromechanical system as a function of the intensity and frequency of the ac field and of external dc voltages. For strong driving fields, we derive, by means of perturbation theory, analytical expressions for the quasienergies of the driven oscillator system. From this analysis, we discuss the conditions for coherent destruction of tunneling (CDT) to occur as a function of detuning and field parameters. For zero detuning, and from the invariance of the Floquet Hamiltonian under a generalized parity transformation, we find analytical expressions describing the symmetry properties of the Fourier components of the Floquet states under such a transformation. By using these expressions, we show that in the vicinity of the CDT condition, the quasienergy spectrum exhibits exact crossings which can be characterized by the parity properties of the corresponding eigenvectors.
SNS AC Power Distribution and Reliability of AC Power Supply
Holik, Paul S
2005-01-01
The SNS Project has 45MW of installed power. A design description under the Construction Design and Maintenance (CDM) with regard to regulations (OSHA, NFPA, NEC), reliability issues and maintenance of the AC power distribution system are herewith presented. The SNS Project has 45MW of installed power. The Accelerator Systems are Front End (FE)and LINAC KLYSTRON Building (LK), Central Helium Liquefier (CHL), High Energy Beam Transport (HEBT), Accumulator Ring and Ring to Target Beam Transport (RTBT) Support Buildings have 30MW installed power. FELK has 16MW installed, majority of which is klystron and magnet power supply system. CHL, supporting the super conducting portion of the accelerator has 7MW installed power and the RING Systems (HEBT, RING and RTBT) have also 7MW installed power.*
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
DEFF Research Database (Denmark)
Olesen, Laurits Højgaard; Bruus, Henrik; Ajdari, A.
2006-01-01
therefore extend the latter theories to account for three experimentally relevant effects: (i) vertical confinement of the pumping channel, (ii) Faradaic currents from electrochemical reactions at the electrodes, and (iii) nonlinear surface capacitance of the Debye layer. We report here that these effects......Recent experiments have demonstrated that ac electrokinetic micropumps permit integrable, local, and fast pumping (velocities similar to mm/s) with low driving voltage of a few volts only. However, they also displayed many quantitative and qualitative discrepancies with existing theories. We...
Accelerated sea level rise and Florida Current transport
Directory of Open Access Journals (Sweden)
J. Park
2015-07-01
Full Text Available The Florida Current is the headwater of the Gulf Stream and is a component of the North Atlantic western boundary current from which a geostrophic balance between sea surface height and mass transport directly influence coastal sea levels along the Florida Straits. A linear regression of daily Florida Current transport estimates does not find a significant change in transport over the last decade; however, a nonlinear trend extracted from empirical mode decomposition (EMD suggests a 3 Sv decline in mean transport. This decline is consistent with observed tide gauge records in Florida Bay and the straits exhibiting an acceleration of mean sea level (MSL rise over the decade. It is not known whether this recent change represents natural variability or the onset of the anticipated secular decline in Atlantic meridional overturning circulation (AMOC; nonetheless, such changes have direct impacts on the sensitive ecological systems of the Everglades as well as the climate of western Europe and eastern North America.
International Nuclear Information System (INIS)
Nayak, P.K.; Ravi, S. . sravi@iitg.ernet.in
2008-01-01
We have prepared a series of compounds (La 1-x Y x ) 2 Ba 2 CaCu 5 O 2 for x = 0 to 0.5 by adding a CaCuO 2 layer to the parent compound La 2 Ba 2 Cu 4 O 2 and by doping Y in place of La. These materials are also prepared by adding 5 wt% of Ag to enhance the intergranular coupling and critical current density. X-ray diffraction measurements show that all the samples are essentially in single phase form and the patterns could be refined using P4/mmm space group in tetragonal cell. The typical lattice parameters are found to be a = b 3.856 A, c = 11.576 A for x = 0.5 sample. Temperature variations of dc electrical resistivity measured on the above samples show that they exhibit superconductivity with T c ranging from 60 to 75 K. Temperature and ac field amplitude variation of ac susceptibility have been measured on the above samples. The field variation of ac susceptibility data has been analyzed by using Bean critical state model. Using both temperature and field variations of ac susceptibility data, the material dependent parameters, such as critical current density as a function of temperature and effective volume fraction grains have been estimated. The Ag doped samples show relatively large critical current density compared to pure samples due to improved intergranular coupling. (author)
Waintal, Xavier; Gaury, Benoit; Weston, Joseph
With single coherent electron sources and electronic interferometers now available in the lab, the time resolved dynamics of electrons can now be probed directly. I will discuss how a fast raise of voltage propagates inside an electronic interferometer and leads to an oscillating current of well controled frequency. This phenomena is the normal counterpart to the AC josephson effect. I will also briefly advertize our software for computing quantum transport properties, Kwant (http://kwant-project.org) and its time-dependent extension T-Kwant.
Nontrivial ac spin response in the effective Luttinger model
International Nuclear Information System (INIS)
Hu Liangbin; Zhong Jiansong; Hu Kaige
2006-01-01
Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before
International Nuclear Information System (INIS)
Fumagalli, L; Ferrari, G; Sampietro, M; Casuso, I; MartInez, E; Samitier, J; Gomila, G
2006-01-01
Nanoscale capacitance imaging with attofarad resolution (∼1 aF) of a nano-structured oxide thin film, using ac current sensing atomic force microscopy, is reported. Capacitance images are shown to follow the topographic profile of the oxide closely, with nanometre vertical resolution. A comparison between experimental data and theoretical models shows that the capacitance variations observed in the measurements can be mainly associated with the capacitance probed by the tip apex and not with positional changes of stray capacitance contributions. Capacitance versus distance measurements further support this conclusion. The application of this technique to the characterization of samples with non-voltage-dependent capacitance, such as very thin dielectric films, self-assembled monolayers and biological membranes, can provide new insight into the dielectric properties at the nanoscale
Energy Technology Data Exchange (ETDEWEB)
Fumagalli, L [Dipartimento di Elettronica e Informazione, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 (Italy); Ferrari, G [Dipartimento di Elettronica e Informazione, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 (Italy); Sampietro, M [Dipartimento di Elettronica e Informazione, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 (Italy); Casuso, I [Departament d' Electronica, Universitat de Barcelona, C/MartIi Franques 1, 08028 Barcelona (Spain); MartInez, E [Plataforma de Nanotecnologia, Parc Cientific de Barcelona, C/ Josep Samitier 1-5, 08028-Barcelona (Spain); Samitier, J [Departament d' Electronica, Universitat de Barcelona, C/MartIi Franques 1, 08028 Barcelona (Spain); Gomila, G [Departament d' Electronica, Universitat de Barcelona, C/MartIi Franques 1, 08028 Barcelona (Spain)
2006-09-28
Nanoscale capacitance imaging with attofarad resolution ({approx}1 aF) of a nano-structured oxide thin film, using ac current sensing atomic force microscopy, is reported. Capacitance images are shown to follow the topographic profile of the oxide closely, with nanometre vertical resolution. A comparison between experimental data and theoretical models shows that the capacitance variations observed in the measurements can be mainly associated with the capacitance probed by the tip apex and not with positional changes of stray capacitance contributions. Capacitance versus distance measurements further support this conclusion. The application of this technique to the characterization of samples with non-voltage-dependent capacitance, such as very thin dielectric films, self-assembled monolayers and biological membranes, can provide new insight into the dielectric properties at the nanoscale.
Magneto-optical imaging of transport current densities in superconductors
International Nuclear Information System (INIS)
Crabtree, G.W.; Welp, U.; Gunter, D.O.; Zhong, W.; Balachandran, U.; Haldar, P.; Sokolowski, R.S.; Vlasko-Vlasov, V.K.; Nikitenko, V.I.
1995-01-01
Direct imaging of the paths of transport currents in superconductors creates many new possibilities for exploring the basic features of vortex pinning mechanisms and for improving the performance of superconducting materials. A technique for imaging the path and magnitude of the transport current density flowing in superconductors is described. Results are given for a 37-filament BSCCO 2223 powder-in-tube wire, showing a highly inhomogeneous current path within the filaments
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
2012-06-27
... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Advisory Circular (AC) 150/5345-53D... Advisory Circular (AC) 150/5345-53D, Airport Lighting Equipment Certification Program, is being circulated... on a separate document and not embedded in the draft AC. Additionally, please provide justification...
Operation of AC Adapters Visualized Using Light-Emitting Diodes
Regester, Jeffrey
2016-01-01
A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…
Critical current measurements of high Tc superconductors in a scanning low temperature cryostat
International Nuclear Information System (INIS)
Telschow, K.L.; O'Brien, T.K.
1991-01-01
Maintaining uniformity of properties over long distances is one of the fabrication problems encountered with the new high T c superconductors. Uniform properties are crucial in long tapes or wires with high critical current since local nonuniformities can limit the current carrying capacity of the whole piece. Transport critical currents in high T c superconductors are conventionally measured with the contact 4-point probe DC current-voltage technique. This technique requires contact with the sample and and spatially averages over the region between the two voltage contacts. Two techniques have been used to infer the critical state model. The first uses the net magnetization of a suitably shaped sample in an external magnetic field. The second combines a DC magnetic field with AC induced currents to infer spatial flux profiles. The AC magnetization technique offers an advantage in that it is noncontacting; however, it also averages the measurement over a large area and requires that the sample be shaped and positioned such that it exhibits zero demagnetizing factor. This paper describes a measurement technique and a scanning cryostat assembly that are capable of determining local critical current in a tape or wire with high resolution and without any direct sample electrical contact. A small compensated coil was used to induce AC currents in slab-shaped samples. The coil was situated near the surface on one side of the slab. With this method, the AC probe can be used as a noncontacting dissipation probe, replacing the voltage probe in the 4-point contact method, when an externally driven transport current is used, or by itself as a local critical state generator and dissipation detector. The results are shown to be meaningful even when the internal magnetic field is not uniform due to shape demagnetizing effects. 10 refs., 5 figs
Directory of Open Access Journals (Sweden)
Alisa Berger
2018-04-01
Full Text Available Motor control is associated with synchronized oscillatory activity at alpha (8–12 Hz and beta (12–30 Hz frequencies in a cerebello-thalamo-cortical network. Previous studies demonstrated that transcranial alternating current stimulation (tACS is capable of entraining ongoing oscillatory activity while also modulating motor control. However, the modulatory effects of tACS on both motor control and its underlying electro- and neurophysiological mechanisms remain ambiguous. Thus, the purpose of this study was to contribute to gathering neurophysiological knowledge regarding tACS effects by investigating the after-effects of 10 Hz tACS and 20 Hz tACS at parietal brain areas on bimanual coordination and its concurrent oscillatory and hemodynamic activity. Twenty-four right-handed healthy volunteers (12 females aged between 18 and 30 (M = 22.35 ± 3.62 participated in the study and performed a coordination task requiring bimanual movements. Concurrent to bimanual motor training, participants received either 10 Hz tACS, 20 Hz tACS or a sham stimulation over the parietal cortex (at P3/P4 electrode positions for 20 min via small gel electrodes (3,14 cm2 Ag/AgCl, amperage = 1 mA. Before and three time-points after tACS (immediately, 30 min and 1 day, bimanual coordination performance was assessed. Oscillatory activities were measured by electroencephalography (EEG and hemodynamic changes were examined using functional near-infrared spectroscopy (fNIRS. Improvements of bimanual coordination performance were not differently between groups, thus, no tACS-specific effect on bimanual coordination performance emerged. However, physiological measures during the task revealed significant increases in parietal alpha activity immediately following 10 Hz tACS and 20 Hz tACS which were accompanied by significant decreases of Hboxy concentration in the right hemispheric motor cortex compared to the sham group. Based on the physiological responses, we conclude that
Berger, Alisa; Pixa, Nils H; Steinberg, Fabian; Doppelmayr, Michael
2018-01-01
Motor control is associated with synchronized oscillatory activity at alpha (8-12 Hz) and beta (12-30 Hz) frequencies in a cerebello-thalamo-cortical network. Previous studies demonstrated that transcranial alternating current stimulation (tACS) is capable of entraining ongoing oscillatory activity while also modulating motor control. However, the modulatory effects of tACS on both motor control and its underlying electro- and neurophysiological mechanisms remain ambiguous. Thus, the purpose of this study was to contribute to gathering neurophysiological knowledge regarding tACS effects by investigating the after-effects of 10 Hz tACS and 20 Hz tACS at parietal brain areas on bimanual coordination and its concurrent oscillatory and hemodynamic activity. Twenty-four right-handed healthy volunteers (12 females) aged between 18 and 30 ( M = 22.35 ± 3.62) participated in the study and performed a coordination task requiring bimanual movements. Concurrent to bimanual motor training, participants received either 10 Hz tACS, 20 Hz tACS or a sham stimulation over the parietal cortex (at P3/P4 electrode positions) for 20 min via small gel electrodes (3,14 cm 2 Ag/AgCl, amperage = 1 mA). Before and three time-points after tACS (immediately, 30 min and 1 day), bimanual coordination performance was assessed. Oscillatory activities were measured by electroencephalography (EEG) and hemodynamic changes were examined using functional near-infrared spectroscopy (fNIRS). Improvements of bimanual coordination performance were not differently between groups, thus, no tACS-specific effect on bimanual coordination performance emerged. However, physiological measures during the task revealed significant increases in parietal alpha activity immediately following 10 Hz tACS and 20 Hz tACS which were accompanied by significant decreases of Hboxy concentration in the right hemispheric motor cortex compared to the sham group. Based on the physiological responses, we conclude that tACS
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
International Nuclear Information System (INIS)
Tsukamoto, Osami; Li, Z
2007-01-01
The influence of uniaxial tensile stress-strain on the AC loss characteristics of multifilamentary Bi2223/Ag sheathed tape wires was investigated. The uniaxial tensile stress-strain was applied to the sample wire in liquid nitrogen at atmospheric pressure, and the AC losses (transport, magnetization and total losses) were measured by an electric method. Two kinds of wire, oxide-dispersion strengthened Ag-alloy sheathed and Ag-alloy sheathed wires, were tested. The stress-strain curves of the tested wires were divided in three regions, i.e. elastic deformation, continuous plastic deformation and serrated-like plastic deformation regions, though the ranges of those regions were different for different kinds of wire. In the elastic and continuous plastic regions, the stress-strain curve was smooth and continuous, and in the serrated-like plastic region, the curve was rough. In the serrated-like plastic region, the wires kept elongating, while increase of the tensile stress was suspended. Dependences of the critical currents on the stress-strain were generally as follows. While decreases of the wire critical currents were in the range of less than 4% of the original values of the no-stress condition, the critical currents of the wires were reversible, that is, the critical currents recovered the original values at zero stress when the stress were released, regardless of whether the wires were in the elastic or continuous plastic region. In the continuous plastic region, the critical currents decreased up to 10%-15% of the original values and the critical currents were irreversible when the degradations of the critical currents exceeded about 4%. In the serrated-like plastic regions, the critical currents were more severely degraded. The AC loss characteristics of the wires are different in those regions. In the elastic and continuous plastic regions, the absolute values of AC losses were dependent on the stress-strain. However, the dependences of those normalized
High current beam transport with multiple beam arrays
International Nuclear Information System (INIS)
Kim, C.H.
1985-05-01
Highlights of recent experimental and theoretical research progress on the high current beam transport of single and multiple beams by the Heavy Ion Fusion Accelerator Research (HIFAR) group at the Lawrence Berkeley Laboratory (LBL) are presented. In the single beam transport experiment (SBTE), stability boundaries and the emittance growth of a space charge dominated beam in a long quadrupole transport channel were measured and compared with theory and computer simulations. Also, a multiple beam ion induction linac (MBE-4) is being constructed at LBL which will permit study of multiple beam transport arrays, and acceleration and bunch length compression of individually focused beamlets. Various design considerations of MBE-4 regarding scaling laws, nonlinear effects, misalignments, and transverse and longitudinal space charge effects are summarized. Some aspects of longitudinal beam dynamics including schemes to generate the accelerating voltage waveforms and to amplify beam current are also discussed
Power Controllability of Three-phase Converter with Unbalanced AC Source
DEFF Research Database (Denmark)
Ma, Ke; Chen, Wenjie; Liserre, Marco
2015-01-01
Three-phase DC-AC power converters suffer from power oscillation and overcurrent problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... currents. In this work a new series of control strategies which utilize the zerosequence components are proposed to enhance the power control ability under this adverse condition. It is concluded that by introducing proper zero sequence current controls and corresponding circuit configurations, the power...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC voltage....
A direct power conversion topology for grid integrations of hybrid AC/DC resources
DEFF Research Database (Denmark)
Liu, Xiong; Loh, Poh Chiang; Wang, Peng
2012-01-01
and modulation schemes are proposed to extract the commanded current from the input ac/dc sources to the grid and guarantee high quality ac/dc inputs and ac output current waveforms with unity power factors. The proposed modulation scheme for sinusoidal outputs of the VMC is mathematically proved...
High-current beam transport in electrostatic accelerator tubes
International Nuclear Information System (INIS)
Ramian, G.; Elais, L.
1987-01-01
The UCSB Free Electron Laser (FEL) has successfully demonstrated the use of a commercial 6 megavolt electrostatic accelerator as a high current beam source in a recirculating configuration. The accelerator, manufactured by National Electrostatics Corp. (NEC), Middleton WI, uses two standard high gradient accelerator tubes. Suppression of ion multiplication was accomplished by NEC with apertures and a shaped electrostatic field. This field shaping has fortuitously provided a periodically reversing radial field component with sufficient focusing strength to transport electron beams of up to 3 Amps current. Present two-stage FEL work requires a 20 Amp beam and proposed very high voltage FEL designs require currents as high as 100 Amps. A plan to permit transport of such high current beams by the addition of solenoidal focussing elements is described
System and method for determining stator winding resistance in an AC motor
Lu, Bin [Kenosha, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Theisen, Peter J [West Bend, WI
2011-05-31
A system and method for determining stator winding resistance in an AC motor is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of an AC motor. The circuit includes at least one contactor and at least one switch to control current flow and terminal voltages in the AC motor. The system also includes a controller connected to the circuit and configured to modify a switching time of the at least one switch to create a DC component in an output of the system corresponding to an input to the AC motor and determine a stator winding resistance of the AC motor based on the injected DC component of the voltage and current.
Two coupled Josephson junctions: dc voltage controlled by biharmonic current
International Nuclear Information System (INIS)
Machura, L; Spiechowicz, J; Kostur, M; Łuczka, J
2012-01-01
We study transport properties of two Josephson junctions coupled by an external shunt resistance. One of the junctions (say, the first) is driven by an unbiased ac current consisting of two harmonics. The device can rectify the ac current yielding a dc voltage across the first junction. For some values of coupling strength, controlled by an external shunt resistance, a dc voltage across the second junction can be generated. By variation of system parameters such as the relative phase or frequency of two harmonics, one can conveniently manipulate both voltages with high efficiency, e.g. changing the dc voltages across the first and second junctions from positive to negative values and vice versa. (paper)
Power Controllability of Three-phase Converter with Unbalanced AC Source
DEFF Research Database (Denmark)
Ma, Ke; Liserre, Marco; Blaabjerg, Frede
2013-01-01
Three-phase DC-AC power converters suffer from power oscillation and overcurrentt problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... currents. In this work a new series of control strategies which utilize the zero-sequence components are proposed to enhance the power control ability under this adverse conditions. It is concluded that by introducing proper zero sequence current controls and corresponding circuit configurations, the power...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC sources....
Measurement of ac electrical characteristics of SSC dipole magnets at Brookhaven
International Nuclear Information System (INIS)
Smedley, K.
1992-04-01
The SSC collider is designed to have circumference of 87 km. The superconducting magnets along the collider ring are grouped into ten sectors. Each sector, a string of average length of 8.7 km,m is powered by one power source located near the center of the sector. Because of the alternating-current (ac) electrical characteristics of the magnets, the power supply ripple currents and transients form a time and space distribution in the magnet string which affects particle motions. Additionally, since the power supply load is a magnet string, the current regulation loop design is highly dependent upon the ac electrical characteristics of the magnets. A means is needed to accurately determine the ac electrical characteristics of the superconducting magnets. The ac characteristics of magnets will be used to predict the ripple distribution of the long string of superconducting magnets. Magnet ac characteristics can also provide necessary information for the regulation loop design. This paper presents a method for measuring the ac characteristics of superconducting magnets. Two collider dipole magnets, one superconducting and one at room temperature, were tested at Brookhaven National Lab
Directory of Open Access Journals (Sweden)
Vanessa eKrause
2016-01-01
Full Text Available The primary motor cortex (M1 contributes to the acquisition and early consolidation of a motor sequence. Although the relevance of M1 excitability for motor learning has been supported, the significance of M1 oscillations remains an open issue. This study aims at investigating to what extent retrieval of a newly learned motor sequence can be differentially affected by motor-cortical transcranial alternating (tACS and direct current stimulation (tDCS. Alpha (10 Hz, beta (20 Hz or sham tACS was applied in 36 right-handers. Anodal or cathodal tDCS was applied in 30 right-handers. Participants learned an eight-digit serial reaction time task (SRTT; sequential vs. random with the right hand. Stimulation was applied to the left M1 after SRTT acquisition at rest for ten minutes. Reaction times were analyzed at baseline, end of acquisition, retrieval immediately after stimulation and reacquisition after eight further sequence repetitions.Reaction times during retrieval were significantly faster following 20 Hz tACS as compared to 10 Hz and sham tACS indicating a facilitation of early consolidation. TDCS yielded faster reaction times, too, independent of polarity. No significant differences between 20 Hz tACS and tDCS effects on retrieval were found suggesting that 20 Hz effects might be associated with altered motor-cortical excitability. Based on the behavioural modulation yielded by tACS and tDCS one might speculate that altered motor-cortical beta oscillations support early motor consolidation possibly associated with neuroplastic reorganization.
Polaron effects on the dc- and ac-tunneling characteristics of molecular Josephson junctions
Wu, B. H.; Cao, J. C.; Timm, C.
2012-07-01
We study the interplay of polaronic effect and superconductivity in transport through molecular Josephson junctions. The tunneling rates of electrons are dominated by vibronic replicas of the superconducting gap, which show up as prominent features in the differential conductance for the dc and ac current. For relatively large molecule-lead coupling, a features that appears when the Josephson frequency matches the vibron frequency can be identified with an over-the-gap structure observed by Marchenkov [Nat. Nanotech. 1748-338710.1038/nnano.2007.2182, 481 (2007)]. However, we are more concerned with the weak-coupling limit, where resonant tunneling through the molecular level dominates. We find that certain features involving both Andreev reflection and vibron emission show an unusual shift of the bias voltage V at their maximum with the gate voltage Vg as V˜(2/3)Vg. Moreover, due to the polaronic effect, the ac Josephson current shows a phase shift of π when the bias eV is increased by one vibronic energy quantum ℏωv. This distinctive even-odd effect is explained in terms of the different sign of the coupling to vibrons of electrons and of Andreev-reflected holes.
Low ac loss geometries in YBCO coated conductors and impact on conductor stability
Energy Technology Data Exchange (ETDEWEB)
Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.
A current view of serotonin transporters [version 1; referees: 3 approved
Directory of Open Access Journals (Sweden)
Louis J. De Felice
2016-07-01
Full Text Available Serotonin transporters (SERTs are largely recognized for one aspect of their function—to transport serotonin back into the presynaptic terminal after its release. Another aspect of their function, however, may be to generate currents large enough to have physiological consequences. The standard model for electrogenic transport is the alternating access model, in which serotonin is transported with a fixed ratio of co-transported ions resulting in net charge per cycle. The alternating access model, however, cannot account for all the observed currents through SERT or other monoamine transporters. Furthermore, SERT agonists like ecstasy or antagonists like fluoxetine generate or suppress currents that the standard model cannot support. Here we survey evidence for a channel mode of transport in which transmitters and ions move through a pore. Available structures for dopamine and serotonin transporters, however, provide no evidence for a pore conformation, raising questions of whether the proposed channel mode actually exists or whether the structural data are perhaps missing a transient open state.
Current trends in nuclear material transportation
International Nuclear Information System (INIS)
Ravenscroft, Norman; Oshinowo, Franchone
1997-01-01
The business of radioactive material transportation has evolved considerably in the past 40 years. Current practices reflect extensive international experience in handling radioactive cargo within a mature and tested regulatory framework. Nevertheless, new developments continue to have an impact on how shipments of nuclear material are planned and carried out. Entities involved in the transport of radioactive materials must keep abreast of these developments and work together to find innovative solutions to ensure that safe, smooth transport activities may continue. Several recent trends in the regulatory environment and political atmosphere require attention. There are four key trends that we'll be examining today: 1) the reduction in the pool of available commercial carriers; 2) routing restrictions; 3) package validation issues; and 4) increasing political sensitivities. Careful planning and cooperative measures are necessary to alleviate problems in each of these areas. (author)
Neoclassical bootstrap current and transport in optimized stellarator configurations
International Nuclear Information System (INIS)
Maassberg, H.; Lotz, W.; Nuehrenberg, J.
1993-01-01
The neoclassical bootstrap current properties of optimized stellarators are analyzed in the relevant mean-free-path regimes and compared with the neoclassical transport properties. Two methods---global Monte Carlo simulation [Phys. Fluids 31, 2984 (1988)], and local analysis with the drift kinetic equation solver code [Phys. Fluids B 1, 563 (1989)]---are employed and good agreement is obtained. Full consistency with the elimination of the bootstrap current and favorable neoclassical transport are found
Analysis of Input and Output Ripples of PWM AC Choppers
Directory of Open Access Journals (Sweden)
Pekik Argo Dahono
2008-11-01
Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.
Plasma flow between equipotential electrodes in an ion current transport mode
International Nuclear Information System (INIS)
Zimin, A.M.; Morozov, A.I.
1995-01-01
The paper deals with calculation of parameters in accelerator channel and near electrodes, when realizing ion current transport mode. Model on the basis of two-dimensional two-liquid nondissipative magnetohydrodynamics was formulated, and its solution for isomagnetic flow in smooth channel approximation was conducted. Change of parameters near anode surface was considered in detail. It is shown that regular joining of flow with equipotential electrodes without large near-electrode jumps is performed during ion current transport. Current distribution along accelerator length was calculated when determining ion intake through anode surface due to inertial-drift emission. It is shown that this mechanism can provide rather high current density in ion current transport. 10 refs.; 6 figs
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation
Reitan, D. K.
1973-01-01
Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.
Flame spread over inclined electrical wires with AC electric fields
Lim, Seung J.; Park, Sun H.; Park, Jeong; Fujita, Osamu; Keel, Sang I.; Chung, Suk-Ho
2017-01-01
Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field
Combined kinetic and transport modeling of radiofrequency current drive
International Nuclear Information System (INIS)
Dumont, R.; Giruzzi, G.; Barbato, E.
2000-07-01
A numerical model for predictive simulations of radiofrequency current drive in magnetically confined plasmas is developed. It includes the minimum requirements for a self consistent description of such regimes, i.e., a 3-D ,kinetic equation for the electron distribution function, 1-D heat and current transport equations, and resonant coupling between velocity space and configuration space dynamics, through suitable wave propagation equations. The model finds its full application in predictive studies of complex current profile control scenarios in tokamaks, aiming at the establishment of internal transport barriers by the simultaneous use of various radiofrequency current drive methods. The basic properties of this non-linear numerical system are investigated and illustrated by simulations applied to reversed magnetic shear regimes obtained by Lower Hybrid and Electron Cyclotron current drive for parameters typical of the Tore Supra tokamak. (authors)
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
Study of dielectric relaxation and AC conductivity of InP:S single crystal
El-Nahass, M. M.; Ali, H. A. M.; El-Shazly, E. A.
2012-07-01
The dielectric relaxation and AC conductivity of InP:S single crystal were studied in the frequency range from 100 to 5.25 × 105 Hz and in the temperature range from 296 to 455 K. The dependence of the dielectric constant (ɛ1) and the dielectric loss (ɛ2) on both frequency and temperature was investigated. Since no peak was observed on the dielectric loss, we used a method based on the electric modulus to evaluate the activation energy of the dielectric relaxation. Scaling of the electric modulus spectra showed that the charge transport dynamics is independent of temperature. The AC conductivity (σAC) was found to obey the power law: Aωs. Analysis of the AC conductivity data and the frequency exponent showed that the correlated barrier hopping (CBH) model is the dominant mechanism for the AC conduction. The variation of AC conductivity with temperature at different frequencies showed that σAC is a thermally activated process.
Directory of Open Access Journals (Sweden)
Eriko Kage-Nakadai
Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.
Current conserving theory at the operator level
Yuan, Jiangtao; Wang, Yin; Wang, Jian
The basic assumption of quantum transport in mesoscopic systems is that the total charge inside the scattering region is zero. This means that the potential deep inside reservoirs is effectively screened and therefore the electric field at interface of scattering region is zero. Thus the current conservation condition can be satisfied automatically which is an important condition in mesoscopic transport. So far the current conserving ac theory is well developed by considering the displacement current which is due to Coulomb interaction if we just focus on the average current. However, the frequency dependent shot noise does not satisfy the conservation condition since we do not consider the current conservation at the operator level. In this work, we formulate a generalized current conserving theory at the operator level using non-equilibrium Green's function theory which could be applied to both average current and frequency dependent shot noise. A displacement operator is derived for the first time so that the frequency dependent correlation of displacement currents could be investigated. Moreover, the equilibrium shot noise is investigated and a generalized fluctuation-dissipation relationship is presented.
International Nuclear Information System (INIS)
Romanovskii, V.; Watanabe, K.; Awaji, S.
2013-01-01
Highlights: •Overloaded AC states are investigated to understand the mechanisms of there formation. •There exist characteristic time windows defining the existence of stable overloaded AC states. •Limiting values of the electric field, current and temperature are higher than the quench ones. -- Abstract: The macroscopic thermal and electrodynamical phenomena occurring in high-T c superconductors during overloaded AC states are theoretically investigated to understand the basic physical mechanisms, which are characteristic for the stable formation of the operating modes when the peak current exceeds the critical current of a superconductor during AC modes. It is shown that there exist characteristic time windows defining the existence of stable overloaded AC states. They identify the stability boundary of the overloaded AC states. Therefore, there is the maximum allowable value of a peak current of stable overloaded AC regimes at the given charging rate, cooling conditions and properties of a superconductor and a matrix. The results obtained prove that the limiting peak current is higher than the corresponding quench current defining the stability margin of DC states. It monotonically increases with the charging rate. Besides, in the stable overloaded AC states, the peak values of the electric field and temperature may be also noticeably higher than the corresponding quench values. They depend on the peak current and charging rate at the given cooling conditions. As a result, high-T c superconducting tapes can stably work under intensive AC modes without instability onset when the peak of applied currents may significantly exceed not only the critical current but also the corresponding values of DC-quench currents
DEFF Research Database (Denmark)
Liu, W.; Lund, H.; Mathiesen, B.V.
2013-01-01
in China. With this purpose in mind, a Chinese transport model has been created and three current transport strategies which are high speed railway (HSR), urban rail transit (URT) and electric vehicle (EV) were evaluated together with a reference transport system in 2020. As conservative results, 13...
Stretched exponential relaxation and ac universality in disordered dielectrics
DEFF Research Database (Denmark)
Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens
2007-01-01
This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are stretc......This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues...
Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.
Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong
2018-05-01
Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
a.c. conductance study of polycrystal C60
International Nuclear Information System (INIS)
Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin
1995-01-01
The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))
Calculation of single phase AC and monopolar DC hybrid corona effects
International Nuclear Information System (INIS)
Zhao, T.; Sebo, S.A.; Kasten, D.G.
1996-01-01
Operating a hybrid HVac and HVdc line is an option for increasing the efficiency of power transmission and overcoming the difficulties in obtaining a new right-of-way. This paper proposes a new calculation method for the study of hybrid line corona. The proposed method can be used to calculate dc corona losses and corona currents in dc or ac conductors for single phase ac and monopolar dc hybrid lines. Profiles of electric field strength and ion current density at ground level can be estimated. The effects of the presence of an energized ac conductor on dc conductor corona and dc voltage on ac conductor corona are included in the method. Full-scale and reduced-scale experiments were utilized to investigate the hybrid line corona effects. Verification of the proposed calculation method is given
Macrofilament simulation of high current beam transport
International Nuclear Information System (INIS)
Hayden, R.J.; Jakobson, M.J.
1985-01-01
Macrofilament simulation of high current beam transport through a series of solenoids has been used to investigate the sensitivity of such calculations to the initial beam distribution and to the number of filaments used in the simulation. The transport line was tuned to approximately 105 0 phase advance per cell at zero current with a tune depression of 65 0 due to the space charge. Input distributions with the filaments randomly uniform throughout a four dimensional ellipsoid and K-V input distributions have been studied. The behavior of the emittance is similar to that published for quadrupoles with like tune depression. The emittance demonstrated little growth in the first twelve solenoids, a rapid rate of growth for the next twenty, and a subsequent slow rate of growth. A few hundred filaments were sufficient to show the character of the instability. The number of filaments utilized is an order of magnitude fewer than has been utilized previously for similar instabilities. The previously published curves for simulations with less than a thousand particles show a rather constant emittance growth. If the solenoid transport line magnetic field is increased a few percent, emittance growth curves are obtained not unlike those curves. Collision growth effects are less important than indicated in the previously published results for quadrupoles
High current beam transport experiments at GSI
International Nuclear Information System (INIS)
Klabunde, J.; Schonlein, A.; Spadtke, P.
1985-01-01
The status of the high current ion beam transport experiment is reported. 190 keV Ar 1+ ions were injected into six periods of a magnetic quadrupole channel. Since the pulse length is > 0.5 ms partial space charge neutralization occurs. In our experiments, the behavior of unneutralized and partially space charge compensated beams is compared. With an unneutralized beam, emittance growth has been measured for high intensities even in case of the zero-current phase advance sigma 0 0 . This initial emittance growth at high tune depression we attribute to the homogenization effect of the space charge density. An analytical formula based on this assumption describes the emittance growth very well. Furthermore the predicted envelope instabilities for sigma 0 > 90 0 were observed even after 6 periods. In agreement with the theory, unstable beam transport was also experimentally found if a beam with different emittances in the two transverse phase planes was injected into the transport channel. Although the space charge force is reduced for a partially neutralized beam a deterioration of the beam quality was measured in a certain range of beam parameters. Only in the range where an unneutralized beam shows the initial emittance growth, the partial neutralization reduces this effect, otherwise the partially neutralized beam is more unstable
Self-field AC losses in Bi-2223 superconducting tapes
International Nuclear Information System (INIS)
Mueller, K. H.; Leslie, K.E.
1996-01-01
Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed
Iwakuma, M; Funaki, K
2002-01-01
The ac loss properties of two-strand parallel conductors composed of superconducting multifilamentary strands were theoretically investigated. The constituent strands generally need to be insulated and transposed for the sake of uniform current distribution and low ac loss. In case the transposition points deviate from the optimum ones, shielding current is induced according to the interlinkage magnetic flux of the twisted loop enclosed by the insulated strands and the contact resistances at the terminals. It produces an additional ac loss. Supposing a simple situation where a two-strand parallel conductor with one-point transposition is exposed to a uniform ac magnetic field, the basic equations for the magnetic field were proposed and the theoretical expressions of the additional ac losses derived. As a result, the following features were shown. The additional ac loss in the non-saturation case, where the induced shielding current is less than the critical current of a strand, is proportional to the square ...
Transport current dependence of the hysteresis loss in silver sheathed BSCOO-2212 conductors
Hemmes, Herman K.; Woudstra, Martin J.; ten Kate, Herman H.J.; Tenbrink, Johannes
1994-01-01
A technique is described to study the critical current density and penetration fieldassociated with the transport current in a silver sheathed BSCCO conductor. A transport current flowing in a conductor in a varying magnetic field will only influence magnetisation currents that are in competition
Critical conducting networks in disordered solids: ac universality from topological arguments
DEFF Research Database (Denmark)
Milovanov, A.V.; Juul Rasmussen, Jens
2001-01-01
This paper advocates an unconventional description of charge transport processes in disordered solids, which brings together the ideas of fractal geometry, percolation theory, and topology of manifolds. We demonstrate that the basic features of ac conductivity in disordered materials as seen...... in various experiments are reproduced with remarkable accuracy by the conduction properties of percolating fractal networks near the threshold of percolation. The universal character of ac conductivity in three embedding dimensions is discussed in connection with the available experimental data. An important...
Flexible AC transmission systems: the state of the art
Energy Technology Data Exchange (ETDEWEB)
Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division
1994-12-31
Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.
Efficiency of LH current drive in tokamaks featuring an internal transport barrier
International Nuclear Information System (INIS)
Oliveira, C I de; Ziebell, L F; Rosa, P R da S
2005-01-01
In this paper, we study the effects of the occurrence of radial transport of particles in a tokamak on the efficiency of the current drive by lower hybrid (LH) waves, in the presence of an internal transport barrier. The results are obtained by numerical solution of the Fokker-Planck equation which rules the evolution of the electron distribution function. We assume that the radial transport of particles can be due to magnetic or electrostatic fluctuations. In both cases the efficiency of the current drive is shown to increase with the increase of the fluctuations that originate the transport. The dependence of the current drive efficiency on the depth and position of the barrier is also investigated
Hybrid immersed interface-immersed boundary methods for AC dielectrophoresis
International Nuclear Information System (INIS)
Hossan, Mohammad Robiul; Dillon, Robert; Dutta, Prashanta
2014-01-01
Dielectrophoresis, a nonlinear electrokinetic transport mechanism, has become popular in many engineering applications including manipulation, characterization and actuation of biomaterials, particles and biological cells. In this paper, we present a hybrid immersed interface–immersed boundary method to study AC dielectrophoresis where an algorithm is developed to solve the complex Poisson equation using a real variable formulation. An immersed interface method is employed to obtain the AC electric field in a fluid media with suspended particles and an immersed boundary method is used for the fluid equations and particle transport. The convergence of the proposed algorithm as well as validation of the hybrid scheme with experimental results is presented. In this paper, the Maxwell stress tensor is used to calculate the dielectrophoretic force acting on particles by considering the physical effect of particles in the computational domain. Thus, this study eliminates the approximations used in point dipole methods for calculating dielectrophoretic force. A comparative study between Maxwell stress tensor and point dipole methods for computing dielectrophoretic forces are presented. The hybrid method is used to investigate the physics of dielectrophoresis in microfluidic devices using an AC electric field. The numerical results show that with proper design and appropriate selection of applied potential and frequency, global electric field minima can be obtained to facilitate multiple particle trapping by exploiting the mechanism of negative dielectrophoresis. Our numerical results also show that electrically neutral particles form a chain parallel to the applied electric field irrespective of their initial orientation when an AC electric field is applied. This proposed hybrid numerical scheme will help to better understand dielectrophoresis and to design and optimize microfluidic devices
Improved transistorized AC motor controller for battery powered urban electric passenger vehicles
Peak, S. C.
1982-01-01
An ac motor controller for an induction motor electric vehicle drive system was designed, fabricated, tested, evaluated, and cost analyzed. A vehicle performance analysis was done to establish the vehicle tractive effort-speed requirements. These requirements were then converted into a set of ac motor and ac controller requirements. The power inverter is a three-phase bridge using power Darlington transistors. The induction motor was optimized for use with an inverter power source. The drive system has a constant torque output to base motor speed and a constant horsepower output to maximum speed. A gear shifting transmission is not required. The ac controller was scaled from the base 20 hp (41 hp peak) at 108 volts dec to an expanded horsepower and battery voltage range. Motor reversal was accomplished by electronic reversal of the inverter phase sequence. The ac controller can also be used as a boost chopper battery charger. The drive system was tested on a dynamometer and results are presented. The current-controlled pulse width modulation control scheme yielded improved motor current waveforms. The ac controller favors a higher system voltage.
Modeling the current distribution in HTS tapes with transport current and applied magnetic field
Yazawa, T.; Yazawa, Takashi; Rabbers, J.J.; Chevtchenko, O.A.; ten Haken, Bernard; ten Kate, Herman H.J.; Maeda, Hideaki
1999-01-01
A numerical model is developed for the current distribution in a high temperature superconducting (HTS) tape, (Bi,Pb)2Sr2 Ca2Cu3Ox-Ag, subjected to a combination of a transport current and an applied magnetic field. This analysis is based on a two-dimensional formulation of Maxwell's equations in
Control of a resonant d.c.-link converter for a.c. motor drives
Directory of Open Access Journals (Sweden)
Astrid Petterteig
1992-10-01
Full Text Available This paper presents the control of the resonant d.c.-link converter for a.c. motor drives. This is a low loss converter with higher efficiency than a conventional PWM converter, but it requires complex control. It needs a special control of the resonant d.c.-link voltage in addition to the discrete control of the a.c. side currents. Simulations show how the control of the a.c. currents, the modulation principle, influences the overall performance of the converter.
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
Innovations in electrophoretic deposition: Alternating current and pulsed direct current methods
International Nuclear Information System (INIS)
Chávez-Valdez, Alejandra; Boccaccini, Aldo R.
2012-01-01
This review summarizes emerging developments in the field of alternating current (AC) and pulsed direct current (DC) electrophoretic deposition (EPD) in aqueous or organic media. Numerous applications of AC-EPD are discussed including two major groups of investigations: (i) AC-EPD to suppress water hydrolysis at high voltages in inorganic (ceramic) coatings and (ii) AC-EPD for deposition of biological entities. The deposition, purification and manipulation of carbon nanotubes and nanoparticles by AC-EPD to form specific arrays, for development of sensors and other electronic devices and the application of AC-EPD as method for separation of particles according to their shape or size are also presented. Other applications reviewed relate to the fabrication by AC-EPD of toxic gas sensors from oxides and superconducting layers. The main materials being examined by AC-EPD are inorganic, including carbon nanotubes, TiO 2 nanoparticles, Al 2 O 3 , Si, SnO 2 , ZnO and WO 3 and biological entities, e.g. bacteria cells. For pulsed EPD, the applications reviewed are divided in pulsed current and pulsed voltage EPD. Among the applications of pulsed EPD, the formation of thick films from aqueous suspensions without water decomposition, the fabrication of multilayer and composite materials and the size-selective deposition of ceramic nanoparticles are the most important investigated to date, based on the quality of the coatings and deposits obtained and their relevance for applications.
RF Current Drive in Internal Transport Barrier
Energy Technology Data Exchange (ETDEWEB)
Peysson, Y.; Basiuk, V.; Huysmans, G. [Association EURATOM-CEA, CEA/DSM/DRFC, CEA-Cadarache, 13 - St Paul-lez-Durance (France); Decker, J.; Bers, A.; Ram, A.K. [Plasma Science and Fusion Center, Massachusetts Institute of Technology, Cambridge, MA (United States)
2005-07-01
The current drive problem in regimes with internal transport barrier is addressed using a fast solver of the electron drift kinetic equation which may be used for arbitrary tokamak plasma magnetic equilibrium and any type of electron radio-frequency wave. Parametric studies are performed for the Lower Hybrid and Electron Cyclotron waves. (authors)
AC losses and stability on large cable-in-conduit superconductors
Bruzzone, Pierluigi
1998-12-01
The cable-in-conduit superconductors are preferred for applications where the AC losses and stability are a major concern, e.g., fusion magnets and SMES. A review of coupling currents loss results for both NbTi and Nb 3Sn cable-in-conduit conductors (CICC) is presented and the AC loss relevant features are listed, with special emphasis for the role of the interstrand resistance and strand coating. The transient stability approach for CICCs is discussed and the analytical models are quoted as well as the relevant experimental database. The likely spectrum of transient disturbance in CICC is reviewed and the need to account for interstrand current sharing in the design is outlined. Eventually a practical criterion for the interstrand resistance is proposed to link the stability and AC loss design.
Concentration polarization: Electrodeposition and transport phenomena at overlimiting current
DEFF Research Database (Denmark)
Nielsen, Christoffer Peder
a numerical sharp-interface model describing the electrode growth. This model differs from the established phase-field models, in that it is applicable at overlimiting current and implements electrode reactions in a consistent way. Comparison of the sharp-interface model to the results of the stability...... methods. The initial study concerns a fundamental problem in the study of concentration polarization at overlimiting current, namely the emergence of an extended space-charge region near the ion-selective interface. Based on the so-called quasi-uniform charge density assumption (QCD), we develop...... this coupled chemical and transport effect using two simple models of the reaction kinetics. The principal investigations are performed using numerical simulations, but in addition we derive an analytical model for the transport in the system. The analytical model reveals an important link between the current...
Current neutralization in ballistic transport of light ion beams
International Nuclear Information System (INIS)
Hubbard, R.F.; Slinker, S.P.; Lampe, M.; Joyce, G.; Ottinger, P.
1992-01-01
Intense light ion beams are being considered as drivers to ignite fusion targets in the Laboratory Microfusion Facility (LMF). Ballistic transport of these beams from the diode to the target is possible only if the beam current is almost completely neutralized by plasma currents. This paper summarizes related work on relativistic electron beam and heavy ion beam propagation and describes a simple simulation model (DYNAPROP) which has been modified to treat light ion beam propagation. DYNAPROP uses an envelope equation to treat beam dynamics and uses rate equations to describe plasma and conductivity generation. The model has been applied both to the high current, 30 MeV Li +3 beams for LMF as well as low current, 1.2 MeV proton beams which are currently being studied on GAMBLE B at the Naval Research Laboratory. The predicted ratio of net currents to beam current is ∼0.1--0.2 for the GAMBLE experiment and ∼0.01 for LMF. The implications of these results for LMF and the GAMBLE experiments art discussed in some detail. The simple resistive model in DYNAPROP has well-known limitations in the 1 torr regime which arise primarily from the neglect of plasma electron transport. Alternative methods for treating the plasma response are discussed
AC measurements on uranium doped high temperature superconductors
International Nuclear Information System (INIS)
Eisterer, M.
1999-11-01
The subject of this thesis is the influence of fission tracks on the superconducting properties of melt textured Y-123. The critical current densities, the irreversibility lines and the transition temperature were determined by means of ac measurements. The corresponding ac techniques are explored in detail. Deviations of the ac signal from the expectations according to the Bean model were explained by the dependence of the shielding currents on the electric field. This explanation is supported by the influence of the ac amplitude and frequency on the critical current density but also by a comparison of the obtained data with other experimental techniques. Y-123 has to be doped with uranium in order to induce fission tracks. Uranium forms normal conducting clusters, which are nearly spherical, with a diameter of about 300 nm. Fission of uranium-235 by thermal neutrons creates two high energy ions with a total energy of about 160 MeV. Each of these fission products induces a linear defect with a diameter of about 10 nm. The length of one fission track is 2-4 μm. At 77 K the critical current density is enhanced by the pinning action of the uranium clusters, compared to undoped samples. With decreasing temperature this influence becomes negligible. The critical current densities are strongly enhanced due to the irradiation. At low magnetic fields we find extremely high values for melt textured materials, e.g. 2.5x10 9 Am -2 at 77 K and 0.25 T or 6x10 10 Am -2 at 5 K. Since the critical current was found to be inverse proportional to the square root of the applied magnetic field it decreases rapidly as the field increases. This behavior is predicted by simple theoretical considerations, but is only valid at low temperatures as well as in low magnetic fields at high temperatures. At high fields the critical current drops more rapidly. The irreversibility lines are only slightly changed by this irradiation technique. Only a small shift to higher fields and temperatures
Superconducting three element synchronous ac machine
International Nuclear Information System (INIS)
Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.
1975-01-01
There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition
AC Loss Analysis of MgB2-Based Fully Superconducting Machines
Feddersen, M.; Haran, K. S.; Berg, F.
2017-12-01
Superconducting electric machines have shown potential for significant increase in power density, making them attractive for size and weight sensitive applications such as offshore wind generation, marine propulsion, and hybrid-electric aircraft propulsion. Superconductors exhibit no loss under dc conditions, though ac current and field produce considerable losses due to hysteresis, eddy currents, and coupling mechanisms. For this reason, many present machines are designed to be partially superconducting, meaning that the dc field components are superconducting while the ac armature coils are conventional conductors. Fully superconducting designs can provide increases in power density with significantly higher armature current; however, a good estimate of ac losses is required to determine the feasibility under the machines intended operating conditions. This paper aims to characterize the expected losses in a fully superconducting machine targeted towards aircraft, based on an actively-shielded, partially superconducting machine from prior work. Various factors are examined such as magnet strength, operating frequency, and machine load to produce a model for the loss in the superconducting components of the machine. This model is then used to optimize the design of the machine for minimal ac loss while maximizing power density. Important observations from the study are discussed.
Drug-induced GABA transporter currents enhance GABA release to induce opioid withdrawal behaviors.
Bagley, Elena E; Hacker, Jennifer; Chefer, Vladimir I; Mallet, Christophe; McNally, Gavan P; Chieng, Billy C H; Perroud, Julie; Shippenberg, Toni S; Christie, MacDonald J
2011-10-30
Neurotransmitter transporters can affect neuronal excitability indirectly via modulation of neurotransmitter concentrations or directly via transporter currents. A physiological or pathophysiological role for transporter currents has not been described. We found that GABA transporter 1 (GAT-1) cation currents directly increased GABAergic neuronal excitability and synaptic GABA release in the periaqueductal gray (PAG) during opioid withdrawal in rodents. In contrast, GAT-1 did not indirectly alter GABA receptor responses via modulation of extracellular GABA concentrations. Notably, we found that GAT-1-induced increases in GABAergic activity contributed to many PAG-mediated signs of opioid withdrawal. Together, these data support the hypothesis that GAT-1 activity directly produces opioid withdrawal signs through direct hyperexcitation of GABAergic PAG neurons and nerve terminals, which presumably enhances GABAergic inhibition of PAG output neurons. These data provide, to the best of our knowledge, the first evidence that dysregulation of a neurotransmitter transporter current is important for the maladaptive plasticity that underlies opiate withdrawal.
AC Conductivity and Dielectric Properties of Borotellurite Glass
Taha, T. A.; Azab, A. A.
2016-10-01
Borotellurite glasses with formula 60B2O3-10ZnO-(30 - x)NaF- xTeO2 ( x = 0 mol.%, 5 mol.%, 10 mol.%, and 15 mol.%) have been synthesized by thermal melting. X-ray diffraction (XRD) analysis confirmed that the glasses were amorphous. The glass density ( ρ) was determined by the Archimedes method at room temperature. The density ( ρ) and molar volume ( V m) were found to increase with increasing TeO2 content. The direct-current (DC) conductivity was measured in the temperature range from 473 K to 623 K, in which the electrical activation energy of ionic conduction increased from 0.27 eV to 0.48 eV with increasing TeO2 content from 0 mol.% to 15 mol.%. The dielectric parameters and alternating-current (AC) conductivity ( σ ac) were investigated in the frequency range from 1 kHz to 1 MHz and temperature range from 300 K to 633 K. The AC conductivity and dielectric constant decreased with increasing TeO2 content from 0 mol.% to 15 mol.%.
ac propulsion system for an electric vehicle
Geppert, S.
1980-01-01
It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte
International Nuclear Information System (INIS)
García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.
2016-01-01
The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.
A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation
Directory of Open Access Journals (Sweden)
Cuidong Xu
2015-09-01
Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.
Transport current anisotropy in oriented grained bulk YBa2Cu3Ox superconductor
International Nuclear Information System (INIS)
Selvamanickam, V.; Salama, K.
1990-01-01
The anisotropy in transport current density has been studied on bulk YBa 2 Cu 3 O x superconductor. The transport current density measurements were performed on oriented grained YBa 2 Cu 3 O x superconductor with the current aligned at different angles to the a endash b plane. The angular dependence of J c shows a rapid drop when the transport current is misaligned from the a endash b plane at small angles and then a slow decrease at higher angles. An anisotropy ratio of about 25 is observed at 77 K and zero field between the J c along a endash b plane and that perpendicular to the plane
On transport and the bootstrap current in toroidal plasmas
International Nuclear Information System (INIS)
Connor, J.W.; Taylor, J.B.
1987-01-01
The recently reported observation of the bootstrap current in a tokamak plasma highlights the problem of reconciling this neoclassical effect with the anomalous (i.e., non-neoclassical) electron thermal transport. This Comment reviews the bootstrap current and considers the implications of a self-consistent modification of neoclassical theory based on an enhanced electron-electron interaction. (author)
Modeling photovoltaic systems for AC appliances
Directory of Open Access Journals (Sweden)
Andreea Maria Neaca
2009-10-01
Full Text Available In this paper is described the development of a model which can simulate the performance of a photovoltaic (PV system under specific meteorological conditions and transforming the DC current into AC current. In this model, the accent stands on the design of a series charge regulator. It is treated also the benefit of creating a circuit, with different methods, that can test the maximum power point trackers (MPPT for different photovoltaic applications.
Current density fluctuations and ambipolarity of transport
International Nuclear Information System (INIS)
Shen, W.; Dexter, R.N.; Prager, S.C.
1991-10-01
The fluctuation in the plasma current density is measured in the MIST reversed field pinch experiment. Such fluctuations, and the measured radial profile of the k spectrum of magnetic fluctuations, supports the view and that low frequency fluctuations (f r >) demonstrates that radial particle transport from particle motion parallel to a fluctuating magnetic field is ambipolar over the full frequency range
Effect of parallel transport currents on the d-wave Josephson junction
International Nuclear Information System (INIS)
Rashedi, Gholamreza
2009-01-01
In this paper, the non-local mixing of coherent current states in d-wave superconducting banks is investigated. The superconducting banks are connected via a ballistic point contact. The banks have mis-orientation and phase difference. Furthermore, they are subjected to a tangential transport current along the ab plane of d-wave crystals and parallel to the interface between the superconductors. The effects of mis-orientation and external transport current on the current-phase relations and current distributions are the subjects of this paper. It is observed that, at values of phase difference close to 0, π and 2π, the current distribution may have a vortex-like form in the vicinity of the point contact. The current distribution of the above-mentioned junction between d-wave superconductors is totally different from the junction between s-wave superconductors. The interesting result which this study shows is that spontaneous and Josephson currents are observed for the case of φ = 0.
a.c. conductance study of polycrystal C{sub 60}
Energy Technology Data Exchange (ETDEWEB)
Yan Feng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Wang Yening [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Huang Yineng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Gu Min [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Zhang Qingming [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Shen Huimin [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure
1995-06-05
The a.c. (1
Fixed switching frequency applied in single-phase boost AC to DC converter
International Nuclear Information System (INIS)
Chen, T.-C.; Ren, T.-J.; Ou, J.-C.
2009-01-01
The fixed switching frequency control for a single-phase boost AC to DC converter to achieve a sinusoidal line current and unity power factor is proposed in this paper. The relation between the line current error and the fixed switching frequency was developed. For a limit line current error, the minimum switching frequency for a boost AC to DC converter can be achieved. The proposed scheme was implemented using a 32-bit digital signal processor TMS320C32. Simulations and experimental results demonstrate the feasibility and fast dynamic response of the proposed control strategy.
AC impedance behavior of a practical-size single-cell SOFC under DC current
Energy Technology Data Exchange (ETDEWEB)
Momma, Akihiko; Kaga, Yasuo; Takano, Kiyonami; Nozaki, Ken; Negishi, Akira; Kato, Ken; Kato, Tohru [Fuel Cell Group, Energy Electronics Institute, National Institute of Advanced Industrial Science and Technology, Umezono Tsukuba-shi, Ibaraki 305-8568 (Japan); Inagaki, Toru; Yoshida, Hiroyuki [Energy Use R and D Center, The Kansai Electric Power Company, Inc., 11-20 Nakoji, 3-Chome, Amagasaki, Hyogo 661-0974 (Japan); Hosoi, Kei; Hoshino, Koji; Akbay, Taner; Akikusa, Jun; Yamada, Masaharu; Chitose, Norihisa [Central Research Institute, Naka Research Center, Mitsubishi Materials Corp. 1002-14 Mukohyama, Naka-machi, Naka-gun, Ibaraki 311-0102 (Japan)
2004-10-29
AC impedance measurements were carried out using practical-size planar disc-type SOFC which employs lanthanum gallate as a solid electrolyte. The data were obtained under practical conditions of gas flow rate and DC current. Under these conditions, the gas conversion impedance (GCI), which originates from the change of the electromotive force (EMF) caused by the change in anodic gaseous concentrations along the flow direction, was observed in the low-frequency range of the data obtained. The overlapping impedance together with GCI on the low-frequency arc was also estimated. Experimentally obtained GCI was in good agreement with that calculated. It was concluded that GCI was predominant in the impedance data obtained under practical conditions. The shift of the high-frequency intercept in the complex impedance diagrams was shown to appear as a result of the change in the distribution of gaseous composition in the anode. The dependency of the low-frequency arc on temperature was also shown, and it was assumed that the overlapped impedance varies as the temperature changes. The validity of the impedance measurement, as a diagnostic means to evaluate the gas flow in SOFC stack, was suggested.
Electric current induced forward and anomalous backward mass transport
International Nuclear Information System (INIS)
Somaiah, Nalla; Sharma, Deepak; Kumar, Praveen
2016-01-01
Multilayered test samples were fabricated in form of standard Blech structure, where W was used as the interlayer between SiO 2 substrate and Cu film. Electromigration test was performed at 250 °C by passing an electric current with a nominal density of 3.9 × 10 10 A m −2 . In addition to the regular electromigration induced mass transport ensuing from the cathode towards the anode, we also observed anomalous mass transport from the anode to the cathode, depleting Cu from the anode as well. We propose an electromigration-thermomigration coupling based reasoning to explain the observed mass transport. (letter)
Directory of Open Access Journals (Sweden)
Yuanwei Zhu
2018-06-01
Full Text Available Based on the existing acknowledgment that space charge modulates AC and DC breakdown of insulating materials, this investigation promotes the related investigation into the situations of more complex electrical stress, i.e., AC-DC combined voltages. Experimentally, the AC-DC breakdown characteristics of oil impregnated paper insulation were systematically investigated. The effects of pre-applied voltage waveform, AC component ratio, and sample thickness on AC-DC breakdown characteristics were analyzed. After that, based on an improved bipolar charge transport model, the space charge profiles and the space charge induced electric field distortion during AC-DC breakdown were numerically simulated to explain the differences in breakdown characteristics between the pre-applied AC and pre-applied DC methods under AC-DC combined voltages. It is concluded that large amounts of homo-charges are accumulated during AC-DC breakdown, which results in significantly distorted inner electric field, leading to variations of breakdown characteristics of oil impregnated paper insulation. Therefore, space charges under AC-DC combined voltages must be considered in the design of converter transformers. In addition, this investigation could provide supporting breakdown data for insulation design of converter transformers and could promote better understanding on the breakdown mechanism of insulating materials subjected to AC-DC combined voltages.
Analytical theory and possible detection of the ac quantum spin Hall effect.
Deng, W Y; Ren, Y J; Lin, Z X; Shen, R; Sheng, L; Sheng, D N; Xing, D Y
2017-07-11
We develop an analytical theory of the low-frequency ac quantum spin Hall (QSH) effect based upon the scattering matrix formalism. It is shown that the ac QSH effect can be interpreted as a bulk quantum pumping effect. When the electron spin is conserved, the integer-quantized ac spin Hall conductivity can be linked to the winding numbers of the reflection matrices in the electrodes, which also equal to the bulk spin Chern numbers of the QSH material. Furthermore, a possible experimental scheme by using ferromagnetic metals as electrodes is proposed to detect the topological ac spin current by electrical means.
Antony, Edna; Taybi, Tahar; Courbot, Mikaël; Mugford, Sam T; Smith, J Andrew C; Borland, Anne M
2008-01-01
In photosynthetic tissues of the CAM plant pineapple (Ananas comosus), storage of soluble sugars in the central vacuole during the daytime and their remobilization at night is required to provide carbon skeletons for nocturnal CO(2) fixation. However, soluble sugars produced photosynthetically must also be exported to support growth processes in heterotrophic tissues. To begin to address how vacuolar sugar storage and assimilate partitioning are regulated in A. comosus, degenerate PCR and cDNA library screening were used to clone three candidate sugar transporters from the leaves of this species. Subcellular localization of the three transporters was investigated via expression of YFP-fusion proteins in tobacco epidermal cells and their co-localization with subcellular markers by confocal microscopy. Using this strategy, a putative hexose transporter (AcMST1) and a putative inositol transporter (AcINT1) were identified that both localized to the tonoplast, whereas a putative sucrose transporter (AcSUT1) was found to localize to prevacuolar compartments. A cDNA (AcMST2) with high similarity to a recently characterized tonoplast hexose transporter in Arabidopsis was also identified from an A. comosus fruit EST database. Analyses of transcript abundance indicated that AcMST1 was more highly expressed in fruits compared to leaves of A. comosus, whilst transcripts of AcINT1, AcSUT1, and AcMST2 were more abundant in leaves. Transcript abundance of AcINT1, the putative inositol transporter, showed day-night changes comparable to those of other CAM-related transcripts described in Mesembryanthemum crystallinum. The results are discussed in terms of the role of vacuolar sugar transporters in regulating carbon flow during the diel cycle in CAM plants.
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
Modelling and measurement of ac loss in BSCCO/Ag-tape windings
International Nuclear Information System (INIS)
Oomen, M P; Nanke, R; Leghissa, M
2003-01-01
High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications
Directory of Open Access Journals (Sweden)
Dohoon Kwon
2017-10-01
Full Text Available A new modeling method for high voltage direct current (HVDC systems and associated controllers is presented for the power system simulator for engineering (PSS/E simulation environment. The aim is to improve the estimation of the transient DC voltage and current in the event of an AC line-to-ground fault. The proposed method consists primary of three interconnected modules for (a equation conversion; (b control-mode selection; and (c DC-line modeling. Simulation case studies were carried out using PSS/E and a power systems computer aided design/electromagnetic transients including DC (PSCAD/EMTDC model of the Jeju– Haenam HVDC system in Korea. The simulation results are compared with actual operational data and the PSCAD/EMTDC simulation results for an HVDC system during single-phase and three-phase line-to-ground faults, respectively. These comparisons show that the proposed PSS/E modeling method results in the improved estimation of the dynamic variation in the DC voltage and current in the event of an AC network fault, with significant gains in computational efficiency, making it suitable for real-time analysis of HVDC systems.
Lima, L. S.
2017-02-01
We have used the Dirac's massless quasi-particles together with the Kubo's formula to study the spin transport by electrons in the graphene monolayer. We have calculated the electric conductivity and verified the behavior of the AC and DC currents of this system, that is a relativistic electron plasma. Our results show that the AC conductivity tends to infinity in the limit ω → 0 , similar to the behavior obtained for the spin transport in the two-dimensional frustrated antiferromagnet in the honeycomb lattice. We have made a diagrammatic expansion for the Green's function and we have not gotten significative change in the results.
Boguslawsky, Iliya; Hayakawa, Masashi
2017-01-01
In this monograph the authors solve the modern scientific problems connected with A.C. motors and generators, based first on the detailed consideration of their physical phenomena. The authors describe the theory and investigative methods they developed and applied in practice, which are considered to be of essential interest for specialists in the field of the electrical engineering industry in European countries, the USA, Argentina, and Brazil, as well as in such countries as India, China, and Iran. This book will be of interest to engineers specialized in the field of the manufacture, operation, and repair of A.C. machines (motors and generators) as well as electric drives; to professors, lecturers, and post-graduate students of technical universities, who are specializing in the field of electric machine engineering and electric drives; and to students who are engaged in the field of high current techniques, electric drives, and electric machine engineering.
Directory of Open Access Journals (Sweden)
Duong Minh Bui
2016-03-01
Full Text Available Transient situations of a uni-grounded low-voltage AC microgrid are simulated in this paper, which include different fault tests and operation transition test between the grid-connected and islanded modes of the uni-grounded microgrid. Based on transient simulation results, available fault protection methods are proposed for the main and back-up protection of a uni-grounded AC microgrid. Main contributions of this paper are (i analysing transient responses of a typically uni-grounded lowvoltage AC microgrid from line-to-line, single line-to-ground, three-phase faults and a microgrid operation transition test; and (ii proposing available fault protection methods for uni-grounded AC microgrids, such as non-directional/directional overcurrent protection solutions, under/over voltage protection solutions, differential protection, voltage-restrained overcurrent protection, and other protection principles not based on high fault currents (e.g. total harmonic distortion detection of phase currents and voltages, or protection methods using symmetrical sequence components of current and voltage.
Three-Phase Multistage System (DC-AC-DC-AC for Connecting Solar Cells to the Grid
Directory of Open Access Journals (Sweden)
Mahmudreza Changizian
2017-11-01
Full Text Available Inverter systems that feed electrical power from photovoltaic (PV system into the grid must convert the direct current of the PV array into the alternating current of the grid. In many applications, it is important for a converter to be lightweight, highly reliable, input/output isolated, flexible and operable in a boost mode. These features can be achieved by using a High-Frequency inverter which involves an isolated DC-DC stage and DC-AC section, which provides AC output. This paper proposes a new three phase topology, based on multi stage converter and PV system in order to use in medium and high power applications. The Perturb and Observe (P&O method is used for maximum power point tracking (MPPT control of PV array. The switching control signals for three-phase inverter are provided by hysteresis control method. Also, the comparison between the proposed topology and traditional structures has been conducted and finally the simulation researches are performed in a closed-loop control system by MATLAB/Simulink software to verify the operation of the proposed structure. The results represent better performance of the introduced system over traditional topologies.
Indoor Air Pollution in Non Ac Passenger Bus
El Husna, Iksiroh; Unzilatirrizqi, Rizal D. Yan El; Karyanto, Yudi; Sunoko, Henna R.
2018-02-01
Passenger buses have been one of favorite means of transportation in Indonesia due to its affordability and flexibility. Intensity of human activities during the trip in the buses have a potential of causing indoor air pollution (polusi udara dalam ruang; PUDR). The indoor air pollution has an impact of 1000-time bigger than outdoor air pollution (polusi udara luar ruang; PULR) on lung. This study aimed to find out indoor air pollution rate of non air conditioned buses using an approach to biological agent pollutant source. The study applied an analysis restricted to microorganisms persistence as one of the sources of the indoor air pollution. The media were placed in different parts of the non AC buses. This study revealed that fungs were found in the non AC buses. They became contaminants and developed pathogenic bacteria that caused air pollution.
Indoor Air Pollution in Non Ac Passenger Bus
Directory of Open Access Journals (Sweden)
El Husna Iksiroh
2018-01-01
Full Text Available Passenger buses have been one of favorite means of transportation in Indonesia due to its affordability and flexibility. Intensity of human activities during the trip in the buses have a potential of causing indoor air pollution (polusi udara dalam ruang; PUDR. The indoor air pollution has an impact of 1000-time bigger than outdoor air pollution (polusi udara luar ruang; PULR on lung. This study aimed to find out indoor air pollution rate of non air conditioned buses using an approach to biological agent pollutant source. The study applied an analysis restricted to microorganisms persistence as one of the sources of the indoor air pollution. The media were placed in different parts of the non AC buses. This study revealed that fungs were found in the non AC buses. They became contaminants and developed pathogenic bacteria that caused air pollution.
Current status of high energy nucleon-meson transport code
Energy Technology Data Exchange (ETDEWEB)
Takada, Hiroshi; Sasa, Toshinobu [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1998-03-01
Current status of design code of accelerator (NMTC/JAERI code), outline of physical model and evaluation of accuracy of code were reported. To evaluate the nuclear performance of accelerator and strong spallation neutron origin, the nuclear reaction between high energy proton and target nuclide and behaviors of various produced particles are necessary. The nuclear design of spallation neutron system used a calculation code system connected the high energy nucleon{center_dot}meson transport code and the neutron{center_dot}photon transport code. NMTC/JAERI is described by the particle evaporation process under consideration of competition reaction of intranuclear cascade and fission process. Particle transport calculation was carried out for proton, neutron, {pi}- and {mu}-meson. To verify and improve accuracy of high energy nucleon-meson transport code, data of spallation and spallation neutron fragment by the integral experiment were collected. (S.Y.)
Energy Technology Data Exchange (ETDEWEB)
Neau, H-J.; Bonnardel-Azzarelli, B. [World Nuclear Transport Inst., London (United Kingdom)
2014-07-01
Various kinds of radioactive waste are generated from nuclear power and fuel cycle facilities. These materials have to be treated, stored and eventually sent to a repository site. Transport of wastes between these various stages is crucial for the sustainable utilization of nuclear energy. The IAEA Regulations for the Safe Transport of Radioactive Material (SSR-6) have, for many decades, provided a safe and efficient framework for radioactive materials transport and continue to do so. However, some shippers have experienced that in the transport of certain specific radioactive wastes, difficulties can be encountered. For example, some materials produced in the decommissioning of nuclear facilities are unique in terms of composition or size and can be difficult to characterize as surface contaminated objects (SCO) or homogeneous. One way WNTI (World Nuclear Transport Institute) helps develop transport methodologies is through the use of Industry Working Groups, bringing together WNTI members with common interests, issues and experiences. The Back-End Transport Industry Working Group focuses on the following issues currently. - Characterization of Waste: techniques and methods to classify wastes - Large Objects: slightly contaminated large objects (ex. spent steam generators) transport - Dual Use Casks: transportable storage casks for spent nuclear fuels, including the very long term storage of spent fuel - Fissile Exceptions: new fissile exceptions provisions of revised TS-R-1 (SSR-6) The paper gives a broad overview of current issues for the packaging and transport of radioactive wastes and the associated work of the WNTI. (author)
AC Losses and Their Thermal Effect in High Temperature Superconducting Machines
DEFF Research Database (Denmark)
Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan
2015-01-01
In transient operations or fault conditions, high temperature superconducting (HTS) machines suffer AC losses which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate AC losses and their thermal effect in HTS machines is presented....... The method consists of three sub-models that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an AC loss model which has...
AC Losses and Their Thermal Effect in High-Temperature Superconducting Machines
DEFF Research Database (Denmark)
Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan
2016-01-01
In transient operations or fault conditions, hightemperature superconducting (HTS) machines suffer ac losses, which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate ac losses and their thermal effect in HTS machines is presented....... The method consists of three submodels that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an ac loss model that has a homogeneous...
AC-driven organic light emission devices with carbon nanotubes
Jeon, So-Yeon; Yu, SeGi
2017-02-01
We have investigated alternating current (AC)-driven organic light-emitting devices (OLEDs), with carbon nanotubes (CNTs) incorporated within the emission layer. With CNT incorporation, the brightness of the OLEDs was substantially improved, and the turn-on voltage was reduced by at least a factor of five. Furthermore, the current levels of the CNT-incorporated OLEDs were lower than that of the reference device. A roughly 70% decrease in the current level was obtained for a CNT concentration of 0.03 wt%. This was accomplished by keeping the concentration of CNTs low and the length of CNTs short, which helped to suppress the percolation networking of CNTs within the emitting layer. Strong local electric fields near the end-tips of CNTs and micro-capacitors formed by dispersed CNTs might have caused this high brightness and these low currents. CNT incorporation in the emitting layer can improve the characteristics of AC-driven OLEDs, which are considered to be one of the candidates for flat panel displays and lightning devices.
AC-driven Organic Light Emission Devices with Carbon Nanotubes
Energy Technology Data Exchange (ETDEWEB)
Jeon, So-Yeon [Sungkyunkwan University, Suwon (Korea, Republic of); Yu, SeGi [Hankuk University of Foreign Studies, Yongin (Korea, Republic of)
2017-02-15
We have investigated alternating current (AC)-driven organic light-emitting devices (OLEDs), with carbon nanotubes (CNTs) incorporated within the emission layer. With CNT incorporation, the brightness of the OLEDs was substantially improved, and the turn-on voltage was reduced by at least a factor of five. Furthermore, the current levels of the CNT-incorporated OLEDs were lower than that of the reference device. A roughly 70% decrease in the current level was obtained for a CNT concentration of 0.03 wt%. This was accomplished by keeping the concentration of CNTs low and the length of CNTs short, which helped to suppress the percolation networking of CNTs within the emitting layer. Strong local electric fields near the end-tips of CNTs and micro-capacitors formed by dispersed CNTs might have caused this high brightness and these low currents. CNT incorporation in the emitting layer can improve the characteristics of AC-driven OLEDs, which are considered to be one of the candidates for flat panel displays and lightning devices.
Scaling with toroidal current of impurity transport in ATC
International Nuclear Information System (INIS)
Marmar, E.S.; Cohen, S.A.; Cecchi, J.L.
1976-06-01
An experiment measuring the scaling with changing plasma conditions of a parameter characteristic of the transport of aluminum injected into the ATC tokamak is discussed. This parameter is the time after injection at which the photon signal from Al XI reaches its maximum. It is found that the data are in agreement with the predictions of a computer code which uses neoclassical theory in the Pfirsch-Schluter regime. An approximate model describing impurity transport in ATC is also presented. This model is utilized to calculate the expected scaling with current of the aluminum transport assuming classical, neoclassical and pseudoclassical forms for the diffusion coefficient. The data are in agreement with both the neoclassical and pseudoclassical results from this model
Fault-current limiter using a superconducting coil
International Nuclear Information System (INIS)
Boenig, H.J.; Paice, D.A.
1982-01-01
A novel circuit, consisting of solid-state diodes and a biased superconducting coil, for limiting the fault currents in three-phase ac systems is presented. A modification of the basic circuit results in a solid-state ac breaker with current-limiting features. The operating characteristics of the fault-current limiter and the ac breaker are analyzed. An optimization procedure for sizing the superconducting coil is derived
Simulation of the AC corona phenomenon with experimental validation
International Nuclear Information System (INIS)
Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R
2017-01-01
The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach. (paper)
AC Loss Reduction in Filamentized YBCO Coated Conductors with Virtual Transverse Cross-cuts
Energy Technology Data Exchange (ETDEWEB)
Zhang, Yifei [ORNL; Duckworth, Robert C [ORNL; Ha, Tam T [ORNL; List III, Frederick Alyious [ORNL; Gouge, Michael J [ORNL; Chen, Y [SuperPower Incorporated, Schenectady, New York; X, Xiong, [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2011-01-01
While the performance of YBa{sub 2}Cu{sub 3}O{sub 7-x} (YBCO)-based coated conductors under dc currents has improved significantly in recent years, filamentization is being investigated as a technique to reduce ac loss so that the 2nd generation (2G) high temperature superconducting (HTS) wires can also be utilized in various ac power applications such as cables, transformers and fault current limiters. Experimental studies have shown that simply filamentizing the superconducting layer is not effective enough to reduce ac loss because of incomplete flux penetration in between the filaments as the length of the tape increases. To introduce flux penetration in between the filaments more uniformly and further reduce the ac loss, virtual transverse cross-cuts were made in superconducting filaments of the coated conductors fabricated using the metal organic chemical vapor deposition (MOCVD) method. The virtual transverse cross-cuts were formed by making cross-cuts (17 - 120 {micro}m wide) on the IBAD (ion beam assisted deposition)-MgO templates using laser scribing followed by depositing the superconducting layer ({approx} 0.6 {micro}m thick). AC losses were measured and compared for filamentized conductors with and without the cross-cuts under applied peak ac fields up to 100 mT. The results were analyzed to evaluate the efficacy of filament decoupling and the feasibility of using this method to achieve ac loss reduction.
Coherent transport through interacting quantum dots
Energy Technology Data Exchange (ETDEWEB)
Hiltscher, Bastian
2012-10-05
The present thesis is composed of four different works. All deal with coherent transport through interacting quantum dots, which are tunnel-coupled to external leads. There a two main motivations for the use of quantum dots. First, they are an ideal device to study the influence of strong Coulomb repulsion, and second, their discrete energy levels can easily be tuned by external gate electrodes to create different transport regimes. The expression of coherence includes a very wide range of physical correlations and, therefore, the four works are basically independent of each other. Before motivating and introducing the different works in more detail, we remark that in all works a diagrammatic real-time perturbation theory is used. The fermionic degrees of freedom of the leads are traced out and the elements of the resulting reduced density matrix can be treated explicitly by means of a generalized master equation. How this equation is solved, depends on the details of the problem under consideration. In the first of the four works adiabatic pumping through an Aharonov-Bohm interferometer with a quantum dot embedded in each of the two arms is studied. In adiabatic pumping transport is generated by varying two system parameters periodically in time. We consider the two dot levels to be these two pumping parameters. Since they are located in different arms of the interferometer, pumping is a quantum mechanical effect purely relying on coherent superpositions of the dot states. It is very challenging to identify a quantum pumping mechanism in experiments, because a capacitive coupling of the gate electrodes to the leads may yield an undesired AC bias voltage, which is rectified by a time dependent conductance. Therefore, distinguishing features of these two transport mechanisms are required. We find that the dependence on the magnetic field is the key feature. While the pumped charge is an odd function of the magnetic flux, the rectified current is even, at least in
Coherent transport through interacting quantum dots
International Nuclear Information System (INIS)
Hiltscher, Bastian
2012-01-01
The present thesis is composed of four different works. All deal with coherent transport through interacting quantum dots, which are tunnel-coupled to external leads. There a two main motivations for the use of quantum dots. First, they are an ideal device to study the influence of strong Coulomb repulsion, and second, their discrete energy levels can easily be tuned by external gate electrodes to create different transport regimes. The expression of coherence includes a very wide range of physical correlations and, therefore, the four works are basically independent of each other. Before motivating and introducing the different works in more detail, we remark that in all works a diagrammatic real-time perturbation theory is used. The fermionic degrees of freedom of the leads are traced out and the elements of the resulting reduced density matrix can be treated explicitly by means of a generalized master equation. How this equation is solved, depends on the details of the problem under consideration. In the first of the four works adiabatic pumping through an Aharonov-Bohm interferometer with a quantum dot embedded in each of the two arms is studied. In adiabatic pumping transport is generated by varying two system parameters periodically in time. We consider the two dot levels to be these two pumping parameters. Since they are located in different arms of the interferometer, pumping is a quantum mechanical effect purely relying on coherent superpositions of the dot states. It is very challenging to identify a quantum pumping mechanism in experiments, because a capacitive coupling of the gate electrodes to the leads may yield an undesired AC bias voltage, which is rectified by a time dependent conductance. Therefore, distinguishing features of these two transport mechanisms are required. We find that the dependence on the magnetic field is the key feature. While the pumped charge is an odd function of the magnetic flux, the rectified current is even, at least in
International Nuclear Information System (INIS)
Goldfarb, R.B.; Clark, A.F.
1985-01-01
Magnetization and ac susceptibility of a standard NbTi superconductor were measured as a function of longitudinal dc magnetic field. The ac-field-amplitude and frequency dependences of the complex susceptibility are examined. The magnetization is related to the susceptibility by means of a theoretical derivation based on the field dependence of the critical current density. Hysteresis losses, obtained directly from dc hysteresis loops and derived theoretically from ac susceptibility and critical current density, were in reasonable agreement
She, Xu; Chokhawala, Rahul Shantilal; Bray, James William; Sommerer, Timothy John; Zhou, Rui; Zhang, Di
2017-08-29
A high-voltage direct-current (HVDC) transmission system includes an alternating current (AC) electrical source and a power converter channel that includes an AC-DC converter electrically coupled to the electrical source and a DC-AC inverter electrically coupled to the AC-DC converter. The AC-DC converter and the DC-AC inverter each include a plurality of legs that includes at least one switching device. The power converter channel further includes a commutating circuit communicatively coupled to one or more switching devices. The commutating circuit is configured to "switch on" one of the switching devices during a first portion of a cycle of the H-bridge switching circuits and "switch off" the switching device during a second portion of the cycle of the first and second H-bridge switching circuits.
Bifurcation theory of ac electric arcing
International Nuclear Information System (INIS)
Christen, Thomas; Peinke, Emanuel
2012-01-01
The performance of alternating current (ac) electric arcing devices is related to arc extinction or its re-ignition at zero crossings of the current (so-called ‘current zero’, CZ). Theoretical investigations thus usually focus on the transient behaviour of arcs near CZ, e.g. by solving the modelling differential equations in the vicinity of CZ. This paper proposes as an alternative approach to investigate global mathematical properties of the underlying periodically driven dynamic system describing the electric circuit containing the arcing device. For instance, the uniqueness of the trivial solution associated with the insulating state indicates the extinction of any arc. The existence of non-trivial attractors (typically a time-periodic state) points to a re-ignition of certain arcs. The performance regions of arcing devices, such as circuit breakers and arc torches, can thus be identified with the regions of absence and existence, respectively, of non-trivial attractors. Most important for applications, the boundary of a performance region in the model parameter space is then associated with the bifurcation of the non-trivial attractors. The concept is illustrated for simple black-box arc models, such as the Mayr and the Cassie model, by calculating for various cases the performance boundaries associated with the bifurcation of ac arcs. (paper)
Ac susceptibility of a Bi-2223/Ag tape in a perpendicular field
International Nuclear Information System (INIS)
Savvides, N.; Mueller, K.-H.
1999-01-01
Full text: We report experimental measurements and theoretical calculations of the real ( X ') and imaginary or loss ( X '') parts of the ac susceptibility as a function of temperature T = 4 - 130 K, frequency ω/2π = 5 Hz - 5 kHz and ac magnetic field amplitude μ 0 H m = 0.02 - 7 mT for of a monofilament silver-sheathed Bi-2223 tape. The susceptibilities consist of a hysteretic component due to ac loss ( Xsc '') in the superconductor core and an eddy current component due to eddy current loss ( Xed '') in the silver sheath. At high temperatures the low frequency limit is used to calculate the hysteretic and eddy current susceptibilities while at low temperatures the susceptibility is found to be due to eddy currents flowing along the edges of the tape. The measured loss at low frequencies (< 50 Hz) and high temperatures is dominated by the hysteresis loss which varies with amplitude but is essentially independent of frequency. At higher frequencies the eddy current loss of the silver sheath becomes dominant and it increases dramatically with frequency at both low and high temperatures
Transport current anisotropy in oriented grained bulk YBa2Cu3O(x) superconductor
International Nuclear Information System (INIS)
Selvamanickam, V.; Salama, K.
1990-01-01
The anisotropy in transport current density has been studied on bulk YBa2Cu3O(x) superconductor. The transport current density measurements were performed on oriented grained YBa2Cu3O(x) superconductor with the current aligned at different angles to the a-b plane. The angular dependence of Jc shows a rapid drop when the transport current is misaligned from the a-b plane at small angles and then a slow decrease at higher angles. An anisotropy ratio of about 25 is observed at 77 K and zero field between the Jc along a-b plane and that perpendicular to the plane. 15 refs
Intra-particle migration of mercury in granular polysulfide-rubber-coated activated carbon (PSR-AC)
Kim, Eun-Ah; Masue-Slowey, Yoko; Fendorf, Scott; Luthy, Richard G.
2011-01-01
The depth profile of mercuric ion after the reaction with polysulfide-rubber-coated activated carbon (PSR-AC) was investigated using micro-x-ray fluorescence (μ-XRF) imaging techniques and mathematical modeling. The μ-XRF results revealed that mercury was concentrated at 0~100 μm from the exterior of the particle after three months of treatment with PSR-AC in 10 ppm HgCl2 aqueous solution. The μ-X-ray absorption near edge spectroscopic (μ-XANES) analyses indicated HgS as a major mercury species, and suggested that the intra-particle mercury transport involved a chemical reaction with PSR polymer. An intra-particle mass transfer model was developed based on either a Langmuir sorption isotherm with liquid phase diffusion (Langmuir model) or a kinetic sorption with surface diffusion (kinetic sorption model). The Langmuir model predicted the general trend of mercury diffusion, although at a slower rate than observed from the μ-XRF map. A kinetic sorption model suggested faster mercury transport, which overestimated the movement of mercuric ions through an exchange reaction between the fast and slow reaction sites. Both μ-XRF and mathematical modeling results suggest mercury removal occurs not only at the outer surface of the PSR-AC particle but also at some interior regions due to a large PSR surface area within an AC particle. PMID:22133913
Sediment Resuspension and Transport During Bora in the Western Adriatic Coastal Current
Mullenbach, B. L.; Geyer, W. R.; Sherwood, C. R.
2004-12-01
The Western Adriatic Coastal Current (WACC) is an important agent for along-shelf transport of sediment and fresh water in the western Adriatic Sea. The WACC is driven by a combination of buoyancy forcing from the Po River (northern Adriatic) and wind forcing from northeasterly Bora winds. The large seasonal pulse of freshwater (during the winter) from the Po River influences WACC strength; however, preliminary results from current measurements and model runs indicate that the WACC responds quickly and strongly to Bora wind events, with a strengthening of the current moving southward. Along-margin sediment transport to the south is significantly increased as a result of Bora wind events, presumably because of enhanced wave resuspension and WACC velocity. Elevated sediment fluxes have been observed in both the upper water column (i.e., core of the WACC) and bottom boundary layer (BBL) during these events, which suggests that wind-driven currents may be coupled with the near-bottom transport. This study addresses the interaction of the WACC with the BBL and the impact of this interaction on sediment transport in the western Adriatic. Two benthic tripods were deployed from November 2002 to June 2003 on an across-shelf transect near the Chienti River (at 10 and 20-m water depth), in the region where WACC begins to intensify (200 km south of Po River). Continuous measurements of suspended sediment concentration and current velocity were recorded in the upper-water column and BBL to document sediment transport events. A time series of sediment fluxes and shear velocities (from currents only, u*c; from waves and currents, u*wc) were calculated from these data. Results show that suspended sediment concentrations near the seabed (few cmab) during Bora wind events are strongly correlated with u*wc, which supports a previous hypothesis that wave resuspension (rather than direct fluvial input) is responsible for much of the suspended sediment available for transport southward
International Nuclear Information System (INIS)
Kerns, C.R.
1977-01-01
A device is provided for detecting the current level of a dc signal. It includes an even harmonic modulator to which a reference ac signal is applied. The unknown dc signal acts on the reference ac signal so that the output of the modulator includes an even harmonic whose amplitude is proportional to the unknown dc current. The device may be used to provide overcurrent protection for proportional wire chambers
Design and initial tests of beam current monitoring systems for the APS transport lines
International Nuclear Information System (INIS)
Wang, Xucheng.
1992-01-01
The non-intercepting beam current monitoring systems suitable for a wide, range of beam parameters have been developed for the Advanced Photon Source (APS) low energy transport lines and high energy transport line. The positron or electron beam pulse in the transport lines wig have peak beam currents ranging from 8 mA to 29 A with pulse widths varying from 120 ps to 30 ns and pulse repetition rates from 2 Hz to 60 Hz. The peak beam current or total beam charge is measured with the fast or integrating current transformer, respectively, manufactured by Bergoz. In-house high speed beam signal processing electronics provide a DC level output proportional to the peak current or total charge for the digitizer input. The prototype systems were tested on the linacs which have beam pulse structures similar to that of the APS transport lines. This paper describes the design of beam signal processing electronics and grounding and shielding methods for current transformers. The results of the initial operations are presented. A short introduction on the preliminary design of current monitoring systems for the APS rings is also included
Moment approach to neoclassical flows, currents and transport in auxiliary heated tokamaks
International Nuclear Information System (INIS)
Kim, Yil Bong.
1988-02-01
The moment approach is utilized to derive the full complement of neoclassical transport processes in auxiliary heated tokamaks. The effects of auxiliary heating [neutral beam injection (NBI) and ion cyclotron resonance heating (ICRH)] considered arise from the collisional interaction between the background plasma species and the fast-ion-tail species. From a known fast ion distribution function we evaluate the parallel (to the magnetic field) momentum and heat flow inputs to the background plasma. Then, through the momentum and heat flow balance equations, we can determine the induced parallel flows (and current) and radial transpot fluxes in ''equilibrium'' (on the time scale much longer than the collisional relaxation time, i.e., t >> 1ν/sub ii/). In addition to the fast-ion-induced current, the total neoclassical current includes the boostap current, which is driven by the pressure and temperature gradients, the Pfirsch-Schlueter current which is required for charge neutrality, and the neoclassical (including trapped particle effects) Spitzer current due to the parallel electric field. The radial transport fluxes also include off-diagonal compnents in the transport matrix which correspond to the Ware (neoclassical) pinch due to the inductive applied electric field an the fast-ion-induced radial fluxes, in addition to the usual pressure- and temperature-gradient-driven fluxes (particle diffusion and heat conduction). Once the tranport coefficient are completely determined, the radial fluxes and the heat fluxes can be substituted into the density and energy evolution equations to provide a complete description of ''equilibrium'' (δδt << ν/sub ii/) neoclassical transport processes in a plasma. 47 refs., 14 figs
International Nuclear Information System (INIS)
Noji, H; Haji, K; Hamada, T
2003-01-01
We have calculated the alternating current (ac) losses of a 114 MVA high-T C superconducting (HTS) transmission cable using an electric-circuit (EC) model. The HTS cable is fabricated by Tokyo Electric Power Company and Sumitomo Electric Industries, Ltd. The EC model is comprised of a resistive part and an inductive part. The resistive part is obtained by the approximated Norris equation for a HTS tape. The Norris equation indicates hysteresis losses due to self-fields. The inductive part has two components, i.e. inductances related to axial fields and those related to circumferential fields. The layer currents and applied fields of each layer were calculated by the EC model. By using both values, the ac losses of the one-phase HTS cable were obtained by calculation considering the self-field, the axial field and the circumferential field of the HTS tape. The measured ac loss transporting 1 kA rms is 0.7 W m -1 ph -1 , which is equal to the calculation. The distribution of each layer loss resembles in shape the distribution of the circumferential field in each layer, which indicates that the circumferential fields strongly influence the ac losses of the HTS cable
Diagnostics of the Fermilab Tevatron using an AC dipole
Energy Technology Data Exchange (ETDEWEB)
Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)
2008-08-01
The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.
Effects of AC Electric Field on Small Laminar Nonpremixed Flames
Xiong, Yuan
2015-04-01
Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the
Xia, Jixing; Guo, Zhaojiang; Yang, Zezhong; Zhu, Xun; Kang, Shi; Yang, Xin; Yang, Fengshan; Wu, Qingjun; Wang, Shaoli; Xie, Wen; Xu, Weijun; Zhang, Youjun
2016-09-01
The diamondback moth, Plutella xylostella (L.), is a worldwide pest of cruciferous crops and can rapidly develop resistance to many chemical insecticides. Although insecticidal crystal proteins (i.e., Cry and Cyt toxins) derived from Bacillus thuringiensis (Bt) have been useful alternatives to chemical insecticides for the control of P. xylostella, resistance to Bt in field populations of P. xylostella has already been reported. A better understanding of the resistance mechanisms to Bt should be valuable in delaying resistance development. In this study, the mechanisms underlying P. xylostella resistance to Bt Cry1Ac toxin were investigated using two-dimensional differential in-gel electrophoresis (2D-DIGE) and ligand blotting for the first time. Comparative analyses of the constitutive expression of midgut proteins in Cry1Ac-susceptible and -resistant P. xylostella larvae revealed 31 differentially expressed proteins, 21 of which were identified by mass spectrometry. Of these identified proteins, the following fell into diverse eukaryotic orthologous group (KOG) subcategories may be involved in Cry1Ac resistance in P. xylostella: ATP-binding cassette (ABC) transporter subfamily G member 4 (ABCG4), trypsin, heat shock protein 70 (HSP70), vacuolar H(+)-ATPase, actin, glycosylphosphatidylinositol anchor attachment 1 protein (GAA1) and solute carrier family 30 member 1 (SLC30A1). Additionally, ligand blotting identified the following midgut proteins as Cry1Ac-binding proteins in Cry1Ac-susceptible P. xylostella larvae: ABC transporter subfamily C member 1 (ABCC1), solute carrier family 36 member 1 (SLC36A1), NADH dehydrogenase iron-sulfur protein 3 (NDUFS3), prohibitin and Rap1 GTPase-activating protein 1. Collectively, these proteomic results increase our understanding of the molecular resistance mechanisms to Bt Cry1Ac toxin in P. xylostella and also demonstrate that resistance to Bt Cry1Ac toxin is complex and multifaceted. Copyright © 2016 Elsevier B.V. All
A nonlinear model for AC induced corrosion
Directory of Open Access Journals (Sweden)
N. Ida
2012-09-01
Full Text Available The modeling of corrosion poses particular difficulties. The understanding of corrosion as an electrochemical process has led to simple capacitive-resistive models that take into account the resistance of the electrolytic cell and the capacitive effect of the surface potential at the interface between conductors and the electrolyte. In some models nonlinear conduction effects have been added to account for more complex observed behavior. While these models are sufficient to describe the behavior in systems with cathodic protection, the behavior in the presence of induced AC currents from power lines and from RF sources cannot be accounted for and are insufficient to describe the effects observed in the field. Field observations have shown that a rectifying effect exists that affects the cathodic protection potential and this effect is responsible for corrosion in the presence of AC currents. The rectifying effects of the metal-corrosion interface are totally missing from current models. This work proposes a nonlinear model based on finite element analysis that takes into account the nonlinear behavior of the metal-oxide interface and promises to improve modeling by including the rectification effects at the interface.
Takashima, Keisuke; Kaneko, Toshiro
2017-06-01
The effects of nanosecond pulse superposition to alternating current voltage (NS + AC) on the generation of an air dielectric barrier discharge (DBD) plasma and reactive species are experimentally studied, along with measurements of ozone (O3) and dinitrogen monoxide (N2O) in the exhausted gas through the air DBD plasma (air plasma effluent). The charge-voltage cycle measurement indicates that the role of nanosecond pulse superposition is to induce electrical charge transport and excess charge accumulation on the dielectric surface following the nanosecond pulses. The densities of O3 and N2O in NS + AC DBD are found to be significantly increased in the plasma effluent, compared to the sum of those densities generated in NS DBD and AC DBD operated individually. The production of O3 and N2O is modulated significantly by the phase in which the nanosecond pulse is superimposed. The density increase and modulation effects by the nanosecond pulse are found to correspond with the electrical charge transport and the excess electrical charge accumulation induced by the nanosecond pulse. It is suggested that the electrical charge transport by the nanosecond pulse might result in the enhancement of the nanosecond pulse current, which may lead to more efficient molecular dissociation, and the excess electrical charge accumulation induced by the nanosecond pulse increases the discharge coupling power which would enhance molecular dissociation.
AC application of second generation HTS wire
Thieme, C. L. H.; Gagnon, K.; Voccio, J.; Aized, D.; Claassen, J.
2008-02-01
For the production of Second Generation (2G) YBCO High Temperature Superconductor wire American Superconductor uses a wide-strip MOD-YBCO/RABiTSTM process, a low-cost approach for commercial manufacturing. It can be engineered with a high degree of flexibility to manufacture practical 2G conductors with architectures and properties tailored for specific applications and operating conditions. For ac applications conductor and coil design can be geared towards low hysteretic losses. For applications which experience high frequency ac fields, the stabilizer needs to be adjusted for low eddy current losses. For these applications a stainless-steel laminate is used. An example is a Low Pass Filter Inductor which was developed and built in this work.
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
Current-based detection of nonlocal spin transport in graphene for spin-based logic applications
Wen, Hua; Zhu, Tiancong; Luo, Yunqiu Kelly; Amamou, Walid; Kawakami, Roland K.
2014-05-01
Graphene has been proposed for novel spintronic devices due to its robust and efficient spin transport properties at room temperature. Some of the most promising proposals require current-based readout for integration purposes, but the current-based detection of spin accumulation has not yet been developed. In this work, we demonstrate current-based detection of spin transport in graphene using a modified nonlocal geometry. By adding a variable shunt resistor in parallel to the nonlocal voltmeter, we are able to systematically cross over from the conventional voltage-based detection to current-based detection. As the shunt resistor is reduced, the output current from the spin accumulation increases as the shunt resistance drops below a characteristic value R*. We analyze this behavior using a one-dimensional drift-diffusion model, which accounts well for the observed behavior. These results provide the experimental and theoretical foundation for current-based detection of nonlocal spin transport.
Confinement and transport properties during current ramps in the ASDEX Upgrade tokamak
Fable, E.; Angioni, C.; Hobirk, J.; Pereverzev, G.; Fietz, S.; Hein, T.; ASDEX Upgrade Team
2011-04-01
A detailed analysis of experimental data from the ASDEX Upgrade tokamak is carried out to shed light on the properties of confinement and transport in the current ramp-up and ramp-down phases of the plasma discharge. The experimental database is used to identify the relevant ranges of parameters explored during the ramp-up and the ramp-down. The energy confinement time observed in the two ramps displays interesting evolution, in many cases attaining different values at the same current level between ramp-up and ramp-down. The possible reasons for this behaviour are investigated. Interpretative transport simulations are used as a tool to clarify the interplay between different parameters, which are coupled in a non-linear way. In addition, a theory-based transport model is used to understand the behaviour of confinement as observed in the experiment, evidencing the role of both turbulent and neoclassical transport. Linear gyrokinetic calculations are performed to identify the relevant turbulence regime, showing that a broad range of frequencies, in the trapped electron modes (TEMs) and in the ion temperature gradient modes (ITGs) regimes, is explored during both the ramp-up and ramp-down. In the same framework, a quasi-linear model is applied to calculate the value of the local logarithmic density gradient and compare it with the experimental value. Finally, first non-linear simulations of heat transport during the current ramps are presented.
A Generalised Fault Protection Structure Proposed for Uni-grounded Low-Voltage AC Microgrids
Bui, Duong Minh; Chen, Shi-Lin; Lien, Keng-Yu; Jiang, Jheng-Lun
2016-04-01
This paper presents three main configurations of uni-grounded low-voltage AC microgrids. Transient situations of a uni-grounded low-voltage (LV) AC microgrid (MG) are simulated through various fault tests and operation transition tests between grid-connected and islanded modes. Based on transient simulation results, available fault protection methods are proposed for main and back-up protection of a uni-grounded AC microgrid. In addition, concept of a generalised fault protection structure of uni-grounded LVAC MGs is mentioned in the paper. As a result, main contributions of the paper are: (i) definition of different uni-grounded LVAC MG configurations; (ii) analysing transient responses of a uni-grounded LVAC microgrid through line-to-line faults, line-to-ground faults, three-phase faults and a microgrid operation transition test, (iii) proposing available fault protection methods for uni-grounded microgrids, such as: non-directional or directional overcurrent protection, under/over voltage protection, differential current protection, voltage-restrained overcurrent protection, and other fault protection principles not based on phase currents and voltages (e.g. total harmonic distortion detection of currents and voltages, using sequence components of current and voltage, 3I0 or 3V0 components), and (iv) developing a generalised fault protection structure with six individual protection zones to be suitable for different uni-grounded AC MG configurations.
International Nuclear Information System (INIS)
Anon.
2003-01-01
During january and february 2003, a unique event concerning nuclear transport was reported and rated 1 on the INES scale. This event concerns the absence of a maintenance operation on a shipping cask. This shipping cask was used for several years for nuclear transport inside La-hague site before being re-assigned to transport on public thoroughfare. The re-assignment of the cask should have been preceded and conditioned by a maintenance operation whose purpose is to check the efficiency of its radiation shield. During this period 2 on-site inspections concerning the transport of nuclear materials were performed. (A.C.)
Low-Cost Voltage Zero-Crossing Detector for AC-Grid Applications
Directory of Open Access Journals (Sweden)
Vorobyov Maxim
2014-10-01
Full Text Available Renewable energy sources and energy storage devices are becoming more popular. Some of them like small hydropower turbines, wind turbines and diesel generators produce AC voltage with different frequency and voltage than the main grid. For them power electronics converters are necessary. Power electronics converters presented in industry use two or three level energy conversion, although direct AC to AC converters exist, but one of the main problems is the switch commutation when current or voltage is crossing the zero point. Zero crossing sensors are used to solve this problem. They consist of current or voltage measurement unit and zero crossing detector. Different approaches are used for zero crossing: hardware or software. Hardware approach is simple but it has low precision. Software approach has high precision but it is complicated and expensive. In this paper a simple low cost high precision approach is presented. It takes all advantages from both approaches. While tested with two types of microcontrollers the precision of experimental measurement is 25 μs - 40 μs.
DEFF Research Database (Denmark)
Zermeno, Victor M. R.; Abrahamsen, Asger Bech; Mijatovic, Nenad
2013-01-01
A homogenization method to model a stack of second generation High Temperature Superconducting tapes under AC applied transport current or magnetic field has been obtained. The idea is to find an anisotropic bulk equivalent for the stack such that the geometrical layout of the internal alternatin...
Radial transport of storm time ring current ions
Lui, A. T. Y.
1993-01-01
Radial transport of energetic ions for the development of the main phase of geomagnetic storms is investigated with data from the medium energy particle analyzer (MEPA) on the Charge Composition Explorer spacecraft, which monitored protons, helium ions, and the carbon-nitrogen-oxygen group, which is mostly dominated by oxygen ions. From a study of four geomagnetic storms, we show that the flux increase of these ions in the inner ring current region can be accounted for by an inward displacement of the ring current population by 0.5 to 3.5 R(E). There is a general trend that a larger inward displacement occurs at higher L shells than at lower ones. These results are in agreement with previous findings. The radially injected population consists of the prestorm population modified by substorm injections which occur on a much shorter time scale than that for a storm main phase. It is also found that the inward displacement is relatively independent of ion mass and energy, suggesting that the radial transport of these energetic ions is effected primarily by convective motion from a large electric field or by diffusion resulting from magnetic field fluctuations.
Low AC Loss YBCO Coated Conductor Geometry by Direct Inkjet Printing
Energy Technology Data Exchange (ETDEWEB)
Rupich, Martin, Dr. [American Superconductor Corporation; Duckworth, Robert, Dr. [Oak Ridge National Laboratory
2009-10-01
The second generation (2G) high temperature superconductors (HTS) wire offers potential benefits for many electric power applications, including ones requiring filamentized conductors with low ac loss, such as transformers and fault current limiters. However, the use of 2G wire in these applications requires the development of both novel multi-filamentary conductor designs with lower ac losses and the development of advanced manufacturing technologies that enable the low-cost manufacturing of these filamentized architectures. This Phase I SBIR project focused on testing inkjet printing as a potential low-cost, roll-to-roll manufacturing technique to fabricate potential low ac loss filamentized architectures directly on the 2G template strips.
International Nuclear Information System (INIS)
Liu, Wen; Lund, Henrik; Mathiesen, Brian Vad
2013-01-01
Transport is one of the most challenge sectors when addressing energy security and climate change due to its high reliance on oil products and lack of the alternative fuels. This paper explores the ability of three transport strategies to contribute to the development of a sustainable transport in China. With this purpose in mind, a Chinese transport model has been created and three current transport strategies which are high speed railway (HSR), urban rail transit (URT) and electric vehicle (EV) were evaluated together with a reference transport system in 2020. As conservative results, 13% of the energy saving and 12% of the CO 2 emission reduction can be attained by accomplishing three strategies compared with the reference transport system. However, the energy demand of transport in 2020 with the implementation of three strategies will be about 1.7 times as much as today. The three strategies show the potential of drawing the transport demand to the more energy efficient vehicles; however, more initiatives are needed if the sustainable transport is the long term objective, such as the solutions to stabilise the private vehicle demands, to continuously improve the vehicle efficiency and to boost the alternative fuels produced from the renewable energy sources. - Highlights: • A Chinese transport model was created and three transport strategies were evaluated • Transport is the biggest driver of the oil demand in China not the industry • The energy demand of transport in 2020 will be twice as much as today • Strategies contribute 13% energy saving and 12% CO 2 emission reduction • More initiatives are needed if a sustainable transport is the long-term objective
Advanced reliability improvement of AC-modules (ARIA)
International Nuclear Information System (INIS)
Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.
2001-09-01
are fully or partially shaded. Alpha Real has conducted considerable testing of shading and temperature rises of up to 180C have been observed. Such a temperature rise will influence the lifetime and reliability of the module, and it is therefore common practice to protect modules from these conditions by using by-pass diodes. Having now an active element on the back of the module, such as a module integrated inverter, new possibilities are offered for new concepts for hot-spot prevention. The main conclusions of the ARIA project are: Both the AC module inverters, Sunmaster 130S and Edisun E230721G, withstood the electrical immunity tests successfully; The Sunmaster 130S passed the accelerated reliability tests with good results; The Edisun E230721G passed the temperature cycling test and a humidity-freezing test; The ANIT s.r.l. ARIA modules met all requirements of the CEI/IEC 61215 standard; The voltage comparison method is a most promising principle for hot spot detection. It is implemented into both the Solcolino E230721G and the Sunmaster 130S. The costs for a 200W module are about $1. to $2.5, where the costs for by-pass diodes are $4 to $15; Measurements at different locations in three countries have shown that the new Hot Spot Detector (HSD) by comparing the voltages operates. Computer simulations show that if the current through the shaded cell is less than or equal to the current generated by the shaded cell, the shaded cell will not become reverse biased. 10 refs
Transport and acceleration of the high-current ion beam in magneto-isolated gap
International Nuclear Information System (INIS)
Karas', V.I.; Kornilov, E.A.; Manuilenko, O.V.; Fedorovskaya, O.V.; Tarakanov, V.P.
2015-01-01
The possibility of transportation and acceleration of the high-current ion beam in the magneto-isolated gap has been demonstrated. Found the parameters of the system and beams (the magnetic field produced by the coils with opposing currents, the size of the system, and the parameters of the beams), under which the uniform acceleration of the high-current ion beam all along the gap length is realized. It is shown that the quality of the ion beam, during transport and acceleration, at the exit of the gap is acceptable for many technological applications.
Particle transport analysis in lower hybrid current drive discharges of JT-60U
International Nuclear Information System (INIS)
Nagashima, K.; Ide, S.; Naito, O.
1996-01-01
Particle transport is modified in lower hybrid current drive discharges of JT-60U. The density profile becomes broad during the lower hybrid wave injection and the profile change depends on the injected wave spectrum. Particle transport coefficients (diffusion coefficient and profile peaking factor) were evaluated using gas-puff modulation experiments. The diffusion coefficient in the current drive discharges is about three times larger than in the ohmic discharges. The profile peaking factor decreases in the current drive discharges and the evaluated values are consistent with the measured density profiles. (author)
dc Arc Fault Effect on Hybrid ac/dc Microgrid
Fatima, Zahra
The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.
Directory of Open Access Journals (Sweden)
Qin Zhou
2013-05-01
Full Text Available Atlantic Water, with its origin in the western Atlantic, enters the Nordic Seas partly as a barotropic current following the continental slope. This water mass is carried across the Atlantic by the baroclinic North Atlantic Current (NAC. When the NAC meets the continental slope at the east side of the Atlantic, some of the transport is converted to barotropic transport over the slope before continuing northward. Here, we show that this baroclinic to barotropic conversion is in agreement with geostrophic theory. Historical observations show that the transport of the slope current increases significantly from the Rockall Channel (RC to the Faroe–Shetland Channel (FSC. Geostrophy predicts that with a northward decreasing buoyancy, baroclinic currents from the west will be transferred into northward topographically steered barotropic flow. We use hydrographic data from two sections crossing the continental slope, one located in the RC and another in the FSC, to estimate baroclinic and barotropic transport changes over the slope, within the framework of geostrophic dynamics. Our results indicate that ~1 Sv of the cross-slope baroclinic flow is mainly converted to northward barotropic transport above the 200–500m isobaths, which is consistent with observed transport changes between the RC and the FSC. Similar processes are also likely to occur further south, along the eastern Atlantic margin. This shows that AW within the slope current in the FSC is derived from both the eastern and the western Atlantic, in agreement with earlier studies of AW inflow to the Nordic Seas.
Revealing origin of quasi-one dimensional current transport in defect rich two dimensional materials
DEFF Research Database (Denmark)
Lotz, Mikkel Rønne; Boll, Mads; Hansen, Ole
2014-01-01
to a non-uniform current flow characteristic of lower dimensionality. In this work, simulations based on a finite element method together with a Monte Carlo approach are used to establish the transition from 2D to quasi-1D current transport, when applying a micro four-point probe to measure on 2D...... conductors with an increasing amount of line-shaped defects. Clear 2D and 1D signatures are observed at low and high defect densities, respectively, and current density plots reveal the presence of current channels or branches in defect configurations yielding 1D current transport. A strong correlation...
Direct observations of the Antarctic Slope Current transport at 113°E
Peña-Molino, B.; McCartney, M. S.; Rintoul, S. R.
2016-10-01
The Antarctic Slope Current (ASC), defined here as the region of westward flow along the continental slope off Antarctica, forms the southern limb of the subpolar gyres. It regulates the exchange of water across the shelf break and provides a path for interbasin westward transport. Despite its significance, the ASC remains largely unobserved around most of the Antarctic continent. Here we present direct velocity observations from a 17 month current meter moored array deployed across the continental slope between the 1000 and the 4200 m isobaths, in the southeastern Indian Ocean near 113°E. The observed time-mean flow consists of a surface-intensified jet associated with the Antarctic Slope Front (ASF) and a broader bottom-intensified westward flow that extends out to approximately the 4000 m isobath and is strongest along the upper slope. The time-mean transport of the ASC is -29.2 Sv. Fluctuations in the transport are large, typically exceeding the mean by a factor of 2. They are mainly due to changes in the northward extent of the current over the lower slope. However, seasonal changes in the wind also drive variations in the transport of the ASF and the flow in the upper slope. Both mean and variability are largely barotropic, thus invisible to traditional geostrophic methods.
A Comparison of Alternating Current and Direct Current Electrospray Ionization for Mass Spectrometry
Sarver, Scott A.; Chetwani, Nishant; Dovichi, Norman J.; Go, David B.; Gartner, Carlos A.
2014-04-01
A series of studies comparing the performance of alternating current electrospray ionization (AC ESI) mass spectrometry (MS) and direct current electrospray ionization (DC ESI) MS have been conducted, exploring the absolute signal intensity and signal-to-background ratios produced by both methods using caffeine and a model peptide as targets. Because the high-voltage AC signal was more susceptible to generating gas discharges, the operating voltage range of AC ESI was significantly smaller than that for DC ESI, such that the absolute signal intensities produced by DC ESI at peak voltages were one to two orders of magnitude greater than those for AC ESI. Using an electronegative nebulizing gas, sulfur hexafluoride (SF6), instead of nitrogen (N2) increased the operating range of AC ESI by ~50 %, but did not appreciably improve signal intensities. While DC ESI generated far greater signal intensities, both ionization methods produced comparable signal-to-background noise, with AC ESI spectra appearing qualitatively cleaner. A quantitative calibration analysis was performed for two analytes, caffeine and the peptide MRFA. AC ESI utilizing SF6 outperforms all other techniques for the detection of MRFA, producing chromatographic limits of detection nearly one order of magnitude lower than that of DC ESI utilizing N2, and one-half that of DC ESI utilizing SF6. However, DC ESI outperforms AC ESI for the analysis of caffeine, indicating that improvements in spectral quality may benefit certain compounds or classes of compounds, on an individual basis.
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
Inductive current measurements in an oriented grained YBa2Cu3Ox superconductor
International Nuclear Information System (INIS)
Kupfer, H.; Keller, C.; Salama, K.; Selvamanickam, V.
1989-01-01
The critical current of grain aligned YBa 2 Cu 3 O x bulk material was investigated by inductive flux profile and ac susceptibility measurements. The induced current was directed perpendicular to the a-b plane oriented grains where high values of the transport current, have been previously reported. In spite of the unfavorable geometry of the investigated shielding current, no features of granularity were observed. The results yield a uniform bulk critical current density j c of 3x10 4 A/cm 2 at zero field and 77 K. Field and temperature dependences of this j c are discussed and compared with those in a granular Y-Ba-Cu-O material
Time Series of Transport and Currents on the Chukchi Shelf: 2010 - 2015
Stabeno, P. J.; Ladd, C. A.; Mordy, C. W.; Sullivan, M. E.
2016-02-01
Starting in 2010, NOAA/EcoFOCI in partnership with BOEM, has measured currents and water properties at multiple mooring sites on the Chukchi shelf and slope. Observations began at three sites (C1, C2, C3) off Icy Cape in 2010 and expanded in 2013 to include three sites around Barrow Canyon and two sites northeast of Hanna Shoal. In 2014, a mooring was deployed on the slope (1000 m) northeast of Hanna Shoal. A near-continuous velocity record exists at C2 from August 2010 - September 2015. These velocity data are combined with 40 satellite-tracked drifter trajectories (drogue depth 30 m) and hydrographic transects (2010 - 2015) to examine flow patterns and transport on the eastern Chukchi shelf. Six primary hydrographic transects extending from Pt. Hope (DBO3) to Barrow Canyon (DBO5) were occupied most years. Transport past Icy Cape accounts for 40% of the transport through Bering Strait. Maximum monthly-mean transport (>0.8 Sv) is in July with low interannual variability, while the lowest monthly transports are in December - April with high interannual variability. Currents are significantly correlated with alongshore winds. Satellite-tracked drifters deployed near Bering Strait show onshelf flow at Central Channel. Drifters deployed along the Icy Cape line are transported northeastward, converging to a narrow flow, and mainly exit the shelf through Barrow Canyon. The drifters then travel westward along the slope. In summer, drifters and hydrographic sections delineate the pathways of the nutrient-poor Alaska Coastal Current, and the nutrient-rich water to the west (Bering Sea water and Anadyr water). These data were collected mainly as part of three BOEM funded projects (CHAOZ, CHAOZ-Extension and ArcWEST).
Energy Technology Data Exchange (ETDEWEB)
Yuan Weijia; Campbell, A M; Coombs, T A [Electronic, Power and Energy Conversion Group, Engineering Department, University of Cambridge, Cambridge CB2 1PZ (United Kingdom)], E-mail: wy215@cam.ac.uk
2009-07-15
A model is presented for calculating the AC losses of a stack of second-generation high temperature superconductor tapes. This model takes as a starting point the model of Clem and co-workers for a stack in which each tape carries the same current. It is based on the assumption that the magnetic flux lines lie parallel to the tapes within the part of the stack where the flux has not penetrated. In this paper we allow for the depth of penetration of field to vary across the stack, and use the Kim model to allow for the variation of J{sub c} with B. The model is applied to the cases of a transport current and an applied field. For a transport current the calculated result differs from the Norris expression for a single tape carrying a uniform current and it does not seem possible to define a suitable average J{sub c} which could be used. Our method also gives a more accurate value for the critical current of the stack than other methods. For an applied field the stack behaves as a solid superconductor with the J{sub c} averaged locally over several tapes, but still allowed to vary throughout the stack on a larger scale. For up to about ten tapes the losses rise rapidly with the number of tapes, but in thicker stacks the tapes shield each other and the losses become that of a slab with a field parallel to the faces.
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
Current transport across the pentacene/CVD-grown graphene interface for diode applications
International Nuclear Information System (INIS)
Berke, K; Tongay, S; McCarthy, M A; Rinzler, A G; Appleton, B R; Hebard, A F
2012-01-01
We investigate the electronic transport properties across the pentacene/graphene interface. Current transport across the pentacene/graphene interface is found to be strikingly different from transport across pentacene/HOPG and pentacene/Cu interfaces. At low voltages, diodes using graphene as a bottom electrode display Poole-Frenkel emission, while diodes with HOPG and Cu electrodes are dominated by thermionic emission. At high voltages conduction is dominated by Poole-Frenkel emission for all three junctions. We propose that current across these interfaces can be accurately modeled by a combination of thermionic and Poole-Frenkel emission. Results presented not only suggest that graphene provides low resistive contacts to pentacene where a flat-laying orientation of pentacene and transparent metal electrodes are desired but also provides further understanding of the physics at the organic semiconductor/graphene interface. (paper)
Current transport across the pentacene/CVD-grown graphene interface for diode applications.
Berke, K; Tongay, S; McCarthy, M A; Rinzler, A G; Appleton, B R; Hebard, A F
2012-06-27
We investigate the electronic transport properties across the pentacene/graphene interface. Current transport across the pentacene/graphene interface is found to be strikingly different from transport across pentacene/HOPG and pentacene/Cu interfaces. At low voltages, diodes using graphene as a bottom electrode display Poole–Frenkel emission, while diodes with HOPG and Cu electrodes are dominated by thermionic emission. At high voltages conduction is dominated by Poole–Frenkel emission for all three junctions. We propose that current across these interfaces can be accurately modeled by a combination of thermionic and Poole–Frenkel emission. Results presented not only suggest that graphene provides low resistive contacts to pentacene where a flat-laying orientation of pentacene and transparent metal electrodes are desired but also provides further understanding of the physics at the organic semiconductor/graphene interface.
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
A Bingham-plastic model for fluid mud transport under waves and currents
Liu, Chun-rong; Wu, Bo; Huhe, Ao-de
2014-04-01
Simplified equations of fluid mud motion, which is described as Bingham-Plastic model under waves and currents, are presented by order analysis. The simplified equations are non-linear ordinary differential equations which are solved by hybrid numerical-analytical technique. As the computational cost is very low, the effects of wave current parameters and fluid mud properties on the transportation velocity of the fluid mud are studied systematically. It is found that the fluid mud can move toward one direction even if the shear stress acting on the fluid mud bed is much smaller than the fluid mud yield stress under the condition of wave and current coexistence. Experiments of the fluid mud motion under current with fluctuation water surface are carried out. The fluid mud transportation velocity predicted by the presented mathematical model can roughly match that measured in experiments.
Effects of AC Electric Field on Small Laminar Nonpremixed Flames
Xiong, Yuan
2015-01-01
Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received
Direct current power delivery system and method
Zhang, Di; Garces, Luis Jose; Dai, Jian; Lai, Rixin
2016-09-06
A power transmission system includes a first unit for carrying out the steps of receiving high voltage direct current (HVDC) power from an HVDC power line, generating an alternating current (AC) component indicative of a status of the first unit, and adding the AC component to the HVDC power line. Further, the power transmission system includes a second unit for carrying out the steps of generating a direct current (DC) voltage to transfer the HVDC power on the HVDC power line, wherein the HVDC power line is coupled between the first unit and the second unit, detecting a presence or an absence of the added AC component in the HVDC power line, and determining the status of the first unit based on the added AC component.
Phase-locking of driven vortex lattices with transverse ac force and periodic pinning
International Nuclear Information System (INIS)
Reichhardt, Charles; Kolton, Alejandro B.; Dominguez, Daniel; Gronbech-Jensen, Niels
2001-01-01
For a vortex lattice moving in a periodic array we show analytically and numerically that a new type of phase locking occurs in the presence of a longitudinal dc driving force and a transverse ac driving force. This phase locking is distinct from the Shapiro step phase locking found with longitudinal ac drives. We show that an increase in critical current and a fundamental phase-locked step width scale with the square of the driving ac amplitude. Our results should carry over to other systems such as vortex motion in Josephson-junction arrays
DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS
Directory of Open Access Journals (Sweden)
S. YU. Buryak
2014-05-01
Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.
System and Battery Charge Control for PV-Powered AC Lighting Systems
Energy Technology Data Exchange (ETDEWEB)
Kern, G.
1999-04-01
This report reviews a number of issues specific to stand-alone AC lighting systems. A review of AC lighting technology is presented, which discusses the advantages and disadvantages of various lamps. The best lamps for small lighting systems are compact fluorescent. The best lamps for intermediate-size systems are high- or low-pressure sodium. Specifications for battery charging and load control are provided with the goal of achieving lamp lifetimes on the order of 16,000 to 24,000 hours and battery lifetimes of 4 to 5 years. A rough estimate of the potential domestic and global markets for stand-alone AC lighting systems is presented. DC current injection tests were performed on high-pressure sodium lamps and the test results are presented. Finally, a prototype system was designed and a prototype system controller (with battery charger and DC/AC inverter) was developed and built.
Photovoltaic system with improved AC connections and method of making same
Energy Technology Data Exchange (ETDEWEB)
Cioffi, Philip Michael; Todorovic, Maja Harfman; Herzog, Michael Scott; Korman, Charles Steven; Doherty, Donald M.; Johnson, Neil Anthony
2018-02-13
An alternating current (AC) harness for a photovoltaic (PV) system includes a wire assembly having a first end and a second end, the wire assembly having a plurality of lead wires, and at least one AC connection module positioned at a location along a length of the wire assembly between the first end and the second end. Further, the at least one AC connection module includes a first connection terminal electrically coupled to the plurality of lead wires of the wire assembly and constructed to electrically couple the wire assembly with an output of a first PV module of the PV system. The at least one AC connection module also includes a second connection terminal electrically coupled to the plurality of lead wires of the wire assembly and constructed to electrically couple the wire assembly with an output of a second PV module of the PV system.
The Effects of Theta and Gamma tACS on Working Memory and Electrophysiology
Directory of Open Access Journals (Sweden)
Anja Pahor
2018-01-01
Full Text Available A single blind sham-controlled study was conducted to explore the effects of theta and gamma transcranial alternating current stimulation (tACS on offline performance on working memory tasks. In order to systematically investigate how specific parameters of tACS affect working memory, we manipulated the frequency of stimulation (theta frequency vs. gamma frequency, the type of task (n-back vs. change detection task and the content of the tasks (verbal vs. figural stimuli. A repeated measures design was used that consisted of three sessions: theta tACS, gamma tACS and sham tACS. In total, four experiments were conducted which differed only with respect to placement of tACS electrodes (bilateral frontal, bilateral parietal, left fronto-parietal and right-fronto parietal. Healthy female students (N = 72 were randomly assigned to one of these groups, hence we were able to assess the efficacy of theta and gamma tACS applied over different brain areas, contrasted against sham stimulation. The pre-post/sham resting electroencephalogram (EEG analysis showed that theta tACS significantly affected theta amplitude, whereas gamma tACS had no significant effect on EEG amplitude in any of the frequency bands of interest. Gamma tACS did not significantly affect working memory performance compared to sham, and theta tACS led to inconsistent changes in performance on the n-back tasks. Active theta tACS significantly affected P3 amplitude and latency during performance on the n-back tasks in the bilateral parietal and right-fronto parietal protocols.
AC losses of single-core MgB{sub 2} wires with different metallic sheaths
Energy Technology Data Exchange (ETDEWEB)
Kováč, J., E-mail: elekjkov@savba.sk; Šouc, J.; Kováč, P.; Hušek, I.
2015-12-15
Highlights: • AC losses in single-core MgB{sub 2} wires with different metallic sheaths have been measured. • It has been shown that metallic sheath can affect the measured AC loss considerably. • GlidCop and Stainless Steel have negligible effect to the overall loss. • Strong contribution of eddy currents has been found in the wire with well conductive copper sheath. • Due to Monel sheath AC loss of MgB{sub 2} core is not visible. - Abstract: AC losses of single-core MgB{sub 2} superconductors with different metallic sheaths (Cu, GlidCop, stainless steel and Monel) have been measured and analyzed. These wires were exposed to external magnetic field with frequencies 72 and 144 Hz and amplitudes up to 0.1 T at temperatures ranged from 18 to 40 K. The obtained results have shown that applied metallic sheath can affect the measured AC loss considerably. In the case of GlidCop and Stainless Steel a negligible small effect of metallic sheath was observed. Strong contribution of eddy currents has been found in the wire with well conductive copper sheath. In the case of Monel sheath, the hysteresis loss of magnetic sheath is dominated and AC loss of MgB{sub 2} core is practically not visible.
International Nuclear Information System (INIS)
Porcar, L.; Bourgault, D.; Chaud, X.; Noudem, J.G.; Tournier, R.; Tixador, P.
1998-01-01
High transport currents along the (a,b) planes and along the c-axis have been measured in pulsed current of different pseudo-frequencies. Self field losses and transport current of 8000 A (20000 A cm -2 ) have been measured in Y 1 Ba 2 Cu 3 O 7-δ bars textured by the melting zone technique. Critical currents as high as 500 A (90000 A cm -2 ) along the (a,b) planes or 3000 A (7500 A cm -2 ) along the c-axis have been measured. For both orientations, the transition from the normal state to the superconducting state has been observed. Electric field of 1000 V m -1 and study of the superconducting state recovery are reported. (orig.)
Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza
2008-01-01
AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency.
International Nuclear Information System (INIS)
Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza
2008-01-01
AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency
Energy Technology Data Exchange (ETDEWEB)
Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza [Center of Excellence for Power System Automation and Operation, Electrical Engineering Department, Iran University of Science and Technology, Tehran (Iran, Islamic Republic of)
2008-01-15
AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency.
Current-voltage hysteresis and dielectric properties of PVA coated MWCNT film
Das, Amit Kumar; Meikap, Ajit Kumar
2017-12-01
In this work, we have prepared polyvinyl alcohol (PVA) coated multiwall carbon nanotube (MWCNT) film by an in situ chemical oxidative preparation technique. The thermogravimetric analysis clearly explains the thermal degradation of pure polymer and polymer nanocomposite film. We have studied the AC electrical transport properties and current-voltage (I-V) characteristic of PVA-MWCNT composites within the temperature range 300 ≤ T ≤ 423 K and frequency range 150 Hz ≤ f ≤ 2 MHz. It is observed that the dielectric constant of the composite film increases significantly. The frequency variation of AC conductivity follows the power law ( ωS ) and a sharp transition from small polaron tunneling to correlated barrier hopping model is found. The imaginary part of electric modulus shows non-Debye type asymmetric behaviour. The impedance spectroscopy shows the negative temperature coefficient of resistance of the composite film. Nyquist plot of the composite film at different temperatures is established from impedance measurement. The current-voltage characteristic (under ± 20 V) shows hysteresis behaviour and field dependent resistance. We simulate the experimentally observed current density-electric field data with the established theory.
Current-voltage hysteresis and dielectric properties of PVA coated MWCNT film
Das, Amit Kumar; Meikap, Ajit Kumar
2018-06-01
In this work, we have prepared polyvinyl alcohol (PVA) coated multiwall carbon nanotube (MWCNT) film by an in situ chemical oxidative preparation technique. The thermogravimetric analysis clearly explains the thermal degradation of pure polymer and polymer nanocomposite film. We have studied the AC electrical transport properties and current-voltage (I-V) characteristic of PVA-MWCNT composites within the temperature range 300 ≤ T ≤ 423 K and frequency range 150 Hz ≤ f ≤ 2 MHz. It is observed that the dielectric constant of the composite film increases significantly. The frequency variation of AC conductivity follows the power law ( ωS ) and a sharp transition from small polaron tunneling to correlated barrier hopping model is found. The imaginary part of electric modulus shows non-Debye type asymmetric behaviour. The impedance spectroscopy shows the negative temperature coefficient of resistance of the composite film. Nyquist plot of the composite film at different temperatures is established from impedance measurement. The current-voltage characteristic (under ± 20 V) shows hysteresis behaviour and field dependent resistance. We simulate the experimentally observed current density-electric field data with the established theory.
Directory of Open Access Journals (Sweden)
Tongkun Lan
2018-01-01
Full Text Available AC (alternating current system backup protection setting calculation is an important basis for ensuring the safe operation of power grids. With the increasing integration of modular multilevel converter based high voltage direct current (MMC-HVDC into power grids, it has been a big challenge for the AC system backup protection setting calculation, as the MMC-HVDC lacks the fault self-clearance capability under pole-to-pole faults. This paper focused on the pole-to-pole faults analysis for the AC system backup protection setting calculation. The principles of pole-to-pole faults analysis were discussed first according to the standard of the AC system protection setting calculation. Then, the influence of fault resistance on the fault process was investigated. A simplified analytic approach of pole-to-pole faults in MMC-HVDC for the AC system backup protection setting calculation was proposed. In the proposed approach, the derived expressions of fundamental frequency current are applicable under arbitrary fault resistance. The accuracy of the proposed approach was demonstrated by PSCAD/EMTDC (Power Systems Computer-Aided Design/Electromagnetic Transients including DC simulations.
Exchange-Dominated Pure Spin Current Transport in Alq3 Molecules.
Jiang, S W; Liu, S; Wang, P; Luan, Z Z; Tao, X D; Ding, H F; Wu, D
2015-08-21
We address the controversy over the spin transport mechanism in Alq3 utilizing spin pumping in the Y3Fe5O12/Alq3/Pd system. An unusual angular dependence of the inverse spin Hall effect is found. It, however, disappears when the microwave magnetic field is fully in the sample plane, excluding the presence of the Hanle effect. Together with the quantitative temperature-dependent measurements, these results provide compelling evidence that the pure spin current transport in Alq3 is dominated by the exchange-mediated mechanism.
Electromigration failures under bidirectional current stress
Tao, Jiang; Cheung, Nathan W.; Hu, Chenming
1998-01-01
Electromigration failure under DC stress has been studied for more than 30 years, and the methodologies for accelerated DC testing and design rules have been well established in the IC industry. However, the electromigration behavior and design rules under time-varying current stress are still unclear. In CMOS circuits, as many interconnects carry pulsed-DC (local VCC and VSS lines) and bidirectional AC current (clock and signal lines), it is essential to assess the reliability of metallization systems under these conditions. Failure mechanisms of different metallization systems (Al-Si, Al-Cu, Cu, TiN/Al-alloy/TiN, etc.) and different metallization structures (via, plug and interconnect) under AC current stress in a wide frequency range (from mHz to 500 MHz) has been study in this paper. Based on these experimental results, a damage healing model is developed, and electromigration design rules are proposed. It shows that in the circuit operating frequency range, the "design-rule current" is the time-average current. The pure AC component of the current only contributes to self-heating, while the average (DC component) current contributes to electromigration. To ensure longer thermal-migration lifetime under high frequency AC stress, an additional design rule is proposed to limit the temperature rise due to self-joule heating.
High-current beam dynamics and transport, theory and experiment
International Nuclear Information System (INIS)
Reiser, M.
1986-01-01
Recent progress in the understanding of beam physics and technology factors determining the current and brightness of ion and electron beams in linear accelerators will be reviewed. Topics to be discussed including phase-space density constraints of particle sources, low-energy beam transport include charge neutralization, emittance growth due to mismatch, energy exchange, instabilities, nonlinear effects, and longitudinal bunching
Power electronics applied to industrial systems and transports
Patin, Nicolas
2015-01-01
This book provides a comprehensive overview of power electronic converters (DC / DC, DC / AC, AC / DC and AC / AC) conventionally used in industrial and transportation applications, specifically for the supply of electric machines with variable speed drop off window. From the perspective of design and sizing, this book presents the different functions encountered in a modular way for power electronics.Power Converters and Their Control details less traditional topics such as matrix converters and multilevel converters. This book also features a case study design of an industrial controller, wh
DC injection into low voltage AC networks
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-07-01
This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.
Energy Technology Data Exchange (ETDEWEB)
Weiss, Roland [Siemens AG, Erlangen (Germany); Boeke, Ulrich [Philips Group Innovation-Research, Eindhoven (Netherlands); Maurer, Wilhelm [Infineon Technologies AG, Neubiberg (Germany); Zeltner, Stefan [Fraunhofer-Inst. fuer Integrierte Systeme und Bauelementetechnologie (IISB), Erlangen (Germany)
2012-07-01
The joint undertaking ''Direct Current Components and Grid'' (DCC+G) takes on the strategic challenge to reduce energy consumption and thus the reduction of CO{sub 2} emission caused by commercially used buildings through research in the fields of Direct Current distribution at a voltage level of {+-} 380 V. The major energy consumers in commercially used buildings, ready for the ''net-zero-energy'' goal of the European Union, are heat pumps for heating, ventilation systems, air conditioning units, cooling units (HVAC), lighting systems and information technology. All these components and subsystems have in common, that the most efficient versions would benefit from a direct current supply. Additionally the local producers of electric energy like photovoltaic systems usually generate DC-current. A Direct Current distribution grid within buildings would avoid the repeating conversion from DC and AC an vice versa and therefore reduce conversion losses. Important components of a direct current distribution grid are central, smart, high efficient, bidirectional rectifiers replacing the large number of small, less efficient rectifiers used today. Such large central rectifiers units could additionally be used to actively improve the power quality of the smart local AC distribution grid. One major part of the described activities is to show energy savings of about 5 % of electrical energy with a 2-phase direct current distribution grid using a voltage level of {+-} 380 V. (orig.)
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
Frequency dependent magneto-transport in charge transfer Co(II) complex
Energy Technology Data Exchange (ETDEWEB)
Shaw, Bikash Kumar; Saha, Shyamal K., E-mail: cnssks@iacs.res.in
2014-09-01
A charge transfer chelated system containing ferromagnetic metal centers is the ideal system to investigate the magneto-transport and magneto-dielectric effects due to the presence of both electronic as well as magnetic properties and their coupling. Magneto-transport properties in materials are usually studied through dc charge transport under magnetic field. As frequency dependent conductivity is an essential tool to understand the nature of carrier wave, its spatial extension and their mutual interaction, in the present work, we have investigated frequency dependent magneto-transport along with magnetization behavior in [Co{sub 2}(II)-(5-(4-PhMe)-1,3,4-oxadiazole-H{sup +}-2-thiolate){sub 5}](OAc){sub 4} metal complex to elucidate the nature of above quantities and their response under magnetic field in the transport property. We have used the existing model for ac conduction incorporating the field dependence to explain the frequency dependent magneto-transport. It is seen that the frequency dependent magneto-transport could be well explained using the existing model for ac conduction. -Highlights: • Chelated Co(II) complex is synthesized for magneto-transport applications. • Frequency dependent magneto-transport and magnetization behavior are studied. • Nature of carrier wave, its spatial extension is investigated under magnetic field. • Existing model for ac conduction is used with magnetic field dependence.
Methods for stable recording of short-circuit current in a Na+-transporting epithelium.
Gondzik, Veronika; Awayda, Mouhamed S
2011-07-01
Epithelial Na(+) transport as measured by a variety of techniques, including the short-circuit current technique, has been described to exhibit a "rundown" phenomenon. This phenomenon manifests as time-dependent decrease of current and resistance and precludes the ability to carry out prolonged experiments aimed at examining the regulation of this transport. We developed methods for prolonged stable recordings of epithelial Na(+) transport using modifications of the short-circuit current technique and commercial Ussing-type chambers. We utilize the polarized MDCK cell line expressing the epithelial Na(+) channel (ENaC) to describe these methods. Briefly, existing commercial chambers were modified to allow continuous flow of Ringer solution and precise control of such flow. Chamber manifolds and associated plumbing were modified to allow precise temperature clamp preventing temperature oscillations. Recording electrodes were modified to eliminate the use of KCl and prevent membrane depolarization from KCl leakage. Solutions utilized standard bicarbonate-based buffers, but all gasses were prehydrated to clamp buffer osmolarity. We demonstrate that these modifications result in measurements of current and resistance that are stable for at least 2 h. We further demonstrate that drifts in osmolarity similar to those obtained before prior to our modifications can lead to a decrease of current and resistance similar to those attributed to rundown.
Current leads for superconducting solenoids in a transportable Dewar flask for currents up to 1kA
International Nuclear Information System (INIS)
Shirshov, L.S.
1981-01-01
A simple design of the current lead for currents up to 1 kA into a transportable helium dewar with 22 mm neck diameter is described. The lead characteristics have been studied at various conditions. Examples of pulse superconducting solenoid usage, parmitting to achieve the magnetic field up to 3.3 T are given. The 1% field homogeneity has been obtained on a length of 90 mm [ru
Xu, Pengfei; Zhang, Bo; Wang, Zezhong; Chen, Shuiming; He, Jinliang
2017-12-01
By synchronous measurement of corona current and the water droplet deformation process on a conductor surface, different types of corona discharge are visualized when AC voltage is applied on a line-ground electrode system. The corona characteristics are closely related to the applied voltage and water supply rate. With the increase of AC voltage, the positive Taylor cone discharge firstly appears and then disappears, replaced by the dripping and crashing discharge. Furthermore, the number of pulses in each pulse train increases with the increase of applied voltage. The mechanism of the transfer from the positive Taylor cone discharge to the dripping and crashing discharge is found to be related to the oscillation process of the water droplet. The water supply rate also has a great influence on the characteristics of corona currents. The number of positive pulse trains increases linearly when the water supply rate gets larger, leading to a higher audible noise and radio interference level from the AC corona, which is quite different from that of the DC corona. The difference between the AC and DC coronas under rainfall conditions is analyzed finally.
AC characterization of bulk organic solar cell in the dark and under illumination
International Nuclear Information System (INIS)
Váry, Michal; Perný, Milan; Šály, Vladimír; Packa, Juraj
2014-01-01
Highlights: • A study of organic bulk photovoltaic (PV) solar cell. • Current–voltage characteristics in the dark and under illumination. • AC measurements, both under illumination and in the dark conditions. • Equivalent AC circuit. • Effective lifetime assigned with electron–hole recombination and diffusion time of the electron was estimated. - Abstract: Impedance spectroscopy has been used widely to evaluate the transport processes in photovoltaic, mainly based on inorganic semiconductors, structures – solar cells. The aim of this research was to characterize improved organic bulk photovoltaic (PV) solar cells exploiting this method. Progress in technology of investigated organic solar cell involves the use of an active layer based on low band gap type of polymer. The organic PV cell with front transparent electrode and rear metal electrode and active layer produced by Konarka Technologies was analyzed by electrical DC and AC measurements. Current–voltage (I–V) characteristics in the dark and under illumination were measured and basic PV parameters were calculated. AC measurements, both under illumination and in the dark conditions, were processed in order to identify electronic behavior using equivalent AC circuit which was suggested by fitting of measured impedance data. Circuit with the best correlation to measured data is analyzed in details. Voltage and frequency dependences of fitted equivalent circuit components and calculated parameters are explained and presented in the paper
Sensitivity analysis explains quasi-one-dimensional current transport in two-dimensional materials
DEFF Research Database (Denmark)
Boll, Mads; Lotz, Mikkel Rønne; Hansen, Ole
2014-01-01
We demonstrate that the quasi-one-dimensional (1D) current transport, experimentally observed in graphene as measured by a collinear four-point probe in two electrode configurations A and B, can be interpreted using the sensitivity functions of the two electrode configurations (configurations...... A and B represents different pairs of electrodes chosen for current sources and potential measurements). The measured sheet resistance in a four-point probe measurement is averaged over an area determined by the sensitivity function. For a two-dimensional conductor, the sensitivity functions for electrode...... configurations A and B are different. But when the current is forced to flow through a percolation network, e.g., graphene with high density of extended defects, the two sensitivity functions become identical. This is equivalent to a four-point measurement on a line resistor, hence quasi-1D transport...
Energy Technology Data Exchange (ETDEWEB)
Crepieux, Adeline [Aix Marseille Univ., Universite de Toulon, CNRS, CPT, Marseille (France)
2017-09-15
The electrical and heat currents flowing through a quantum dot are calculated in the presence of a time-modulated gate voltage with the help of the out-of-equilibrium Green function technique. From the first harmonics of the currents, we extract the electrical and thermoelectrical trans-admittances and ac-conductances. Next, by a careful comparison of the ac-conductances with the finite-frequency electrical and mixed electrical-heat noises, we establish the fluctuation-dissipation relations linking these quantities, which are thus generalized out-of-equilibrium for a quantum system. It is shown that the electrical ac-conductance associated to the displacement current is directly linked to the electrical noise summed over reservoirs, whereas the relation between the thermoelectrical ac-conductance and the mixed noise contains an additional term proportional to the energy step that the electrons must overcome when traveling through the junction. A numerical study reveals however that a fluctuation-dissipation relation involving a single reservoir applies for both electrical and thermoelectrical ac-conductances when the frequency dominates over the other characteristic energies. (copyright 2017 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Sediment Transport Capacity of Turbidity Currents: from Microscale to Geological Scale.
Eggenhuisen, J. T.; Tilston, M.; Cartigny, M.; Pohl, F.; de Leeuw, J.; van der Grind, G. J.
2016-12-01
A big question in sedimentology concerns the magnitude of fluxes of sediment particles, solute matter and dissolved gasses from shallow marine waters to deep basins by turbidity current flow. Here we establish sediment transport capacity of turbidity current flow on three levels. The most elementary level is set by the maximum amount of sediment that can be contained at the base of turbidity currents without causing complete extinction of boundary layer turbulence. The second level concerns the capacity in a vertical column within turbidity currents. The third level involves the amount of sediment that can be transported in turbidite systems on geological timescales. The capacity parameter Γ compares turbulent forces near the boundary of a turbulent suspension to gravity and buoyancy forces acting on suspended particles. The condition of Γ>1 coincides with complete suppression of coherent boundary layer turbulence in Direct Numerical Simulations of sediment-laden turbulent flow. Γ=1 coincides with the upper limit of observed suspended particle concentrations in flume and field measurements. Γ is grainsize independent, yet capacity of the full vertical structure of turbidity currents becomes grainsize dependent. This is due to the appearance of grainsize dependent vertical motions within turbulence as a primary control on the shape of the vertical concentration profile. We illustrate this dependence with experiments and theory and conclude that capacity depends on the competence of prevailing turbulence to suspend particle sizes. The concepts of capacity and competence are thus tangled. Finally, the capacity of turbidity current flow structure is coupled to geological constraints on recurrence times, channel and lobe life cycles, and allogenic forcing on system activity to arrive at system scale sediment transport capacity. We demonstrate a simple model that uses the fundamental process insight described above to estimate geological sediment budgets from
Characterization of current transport in ferroelectric polymer devices
Hanna, Amir
2014-01-01
We report the charge injection characteristics in poly(vinylidene fluoride-trifluoroethylene), P(VDF-TrFE), as a function of electrode material in metal/ferroelectric/metal device structures. Symmetric and asymmetric devices with Al, Ag, Au and Pt electrodes were fabricated to determine the dominant carrier type, injection current density, and to propose transport mechanisms in the ferroelectric polymer. Higher work function metals such as Pt are found to inject less charges compared to lower work function metals, implying n-type conduction behavior for P(VDF-TrFE) with electrons as the dominant injected carrier. Two distinct charge transport regimes were identified in the P(VDF-TrFE) devices; a Schottky-limited conduction regime for low to intermediate fields (E < 20 MV/m), and a space-charge limited conduction (SCLC) regime for high fields (20 < E < 120 MV/m). Implication of these results for degradation in P(VDF-TrFE) memory performance are discussed. © 2013 Elsevier B.V. All rights reserved.
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
Interior point algorithm-based power flow optimisation of a combined AC and DC multi-terminal grid
Directory of Open Access Journals (Sweden)
Farhan Beg
2015-01-01
Full Text Available The high cost of power electronic equipment, lower reliability and poor power handling capacity of the semiconductor devices had stalled the deployment of systems based on DC (multi-terminal direct current system (MTDC networks. The introduction of voltage source converters (VSCs for transmission has renewed the interest in the development of large interconnected grids based on both alternate current (AC and DC transmission networks. Such a grid platform also realises the added advantage of integrating the renewable energy sources into the grid. Thus a grid based on DC MTDC network is a possible solution to improve energy security and check the increasing supply demand gap. An optimal power solution for combined AC and DC grids obtained by the solution of the interior point algorithm is proposed in this study. Multi-terminal HVDC grids lie at the heart of various suggested transmission capacity increases. A significant difference is observed when MTDC grids are solved for power flows in place of conventional AC grids. This study deals with the power flow problem of a combined MTDC and an AC grid. The AC side is modelled with the full power flow equations and the VSCs are modelled using a connecting line, two generators and an AC node. The VSC and the DC losses are also considered. The optimisation focuses on several different goals. Three different scenarios are presented in an arbitrary grid network with ten AC nodes and five converter stations.
The target-specific transporter and current status of diuretics as antihypertensive.
Ali, Syed Salman; Sharma, Pramod Kumar; Garg, Vipin Kumar; Singh, Avnesh Kumar; Mondal, Sambhu Charan
2012-04-01
The currently available diuretics increase the urinary excretion of sodium chloride by selective inhibition of specific sodium transporters in the loop of Henle and distal nephron. In recent years, the molecular cloning of the diuretic-sensitive sodium transporters at distal convoluted tubule has improved our understanding of the cellular mechanisms of action of each class of diuretics. Diuretics are tools of considerable therapeutic importance. First, they effectively reduce blood pressure. Loop and thiazide diuretics are secreted from the proximal tubule via the organic anion transporter-1 and exert their diuretic action by binding to the Na(+)-K(+)-2Cl(-) co-transporter type 2 in the thick ascending limb and the Na(+)-Cl(-) co-transporter in the distal convoluted tubule, respectively. Recent studies in animal models suggest that abundance of these ion transporters is affected by long-term diuretic administration. The WHO/ISH guidelines point out that diuretics enhance the efficacy of antihypertensive drugs and will most often be a component of combination therapy. © 2011 The Authors Fundamental and Clinical Pharmacology © 2011 Société Française de Pharmacologie et de Thérapeutique.
Energy Technology Data Exchange (ETDEWEB)
Chen Qiao, E-mail: cqhy1127@yahoo.com.c [Department of Maths and Physics, Hunan Institute of Engineering, Xiangtan 411104 (China); Liu Jin [Institute of Theoretical Physics, Chinese Academy of Science, Beijing 100190 (China); Wang Zhiyong [School of Optoelectronic Information, Chongqing University of Technology, Chongqing 400054 (China)
2011-01-17
We have investigated the current for the system of vibrating quantum dot irradiated with a rotating magnetic field and an oscillating magnetic field by nonequilibrium Green's function. The rotating magnetic field rotates with the angular frequency {omega}{sub r} around the z-axis with the tilt angle {theta}, and the time-oscillating magnetic field is located in the z-axis with the angular frequency {omega}. Different behaviors have been shown in the presence of electron-phonon interaction (EPI) which plays a significant role in the transport. The current displays asymmetric behavior as the source-drain bias eV=0, novel side peaks or shoulders can be found due to the phonon absorption and emission procedure, and the negative differential resistance becomes stronger as the parameter g increases. Furthermore, the strong EPI also destroys the quasiperiodic oscillations of current in the region {mu}{sub 0}B{sub 1}>2.5{Delta}. The electron transport properties are also significantly influenced by the linewidth function {Gamma}.
Transport Characteristics of Mesoscopic Radio-Frequency Single Electron Transistor
International Nuclear Information System (INIS)
Phillips, A. H.; Kirah, K.; Aly, N. A. I.; El-Sayes, H. E.
2008-01-01
The transport property of a quantum dot under the influence of external time-dependent field is investigated. The mesoscopic device is modelled as semiconductor quantum dot coupled weakly to superconducting leads via asymmetric double tunnel barriers of different heights. An expression for the current is deduced by using the Landauer–Buttiker formula, taking into consideration of both the Coulomb blockade effect and the magnetic field. It is found that the periodic oscillation of the current with the magnetic field is controlled by the ratio of the frequency of the applied ac-field to the electron cyclotron frequency. Our results show that the present device operates as a radio-frequency single electron transistor
ACS Postflash Characterization
Smith, Linda
2011-10-01
This program will evaluate the in-flight performance of the ACS/WFC post-flash lamp. A series of observations of Omega Cen will be taken using short and long exposures. The short exposures will be post-flashed using pre-determined exposure times to produce backgrounds from 0 to 125 e-. The data will be used to {1} make an empirical study of the effectiveness in preserving counts for faint stars on various post-flash backgrounds; {2} validate that our current mechanisms for formula-based and pixel-based corrections provide good fixes for whatever CTE remains; and {3} probe a fine enough range of backgrounds that users will be able to pick the level that optimizes their science, which will be a straightforward compromise between the noise added and the signal preserved.
Final design of the Korean AC/DC converters for the ITER coil power supply system
Energy Technology Data Exchange (ETDEWEB)
Oh, Jong-Seok, E-mail: jsoh@nfri.re.kr [ITER Korea, National Fusion Research Institute, Daejeon 305-806 (Korea, Republic of); Choi, Jungwan; Suh, Jae-Hak; Choi, Jihyun [ITER Korea, National Fusion Research Institute, Daejeon 305-806 (Korea, Republic of); Lee, Lacksang; Kim, Changwoo; Park, Hyungjin; Jo, Seongman; Lee, Seungyun; Hwang, Kwangcheol; Liu, Hyoyol [Dawonsys Corp., Siheung 429-450 (Korea, Republic of); Hong, Ki-Don; Sim, Dong-Joon; Lee, Jang-Soo [Hyosung Corp., Gongdeok-Dong, Seoul 121-720 (Korea, Republic of); Lee, Eui-Jae; Kwon, Yang-Hae; Lee, Dae-Yeol; Ko, Ki-Won; Kim, Jong-Min [Mobiis Corp., Yangjae-dong, Seoul 137-888 (Korea, Republic of); Song, Inho [ITER Organization, Route de Vinon sur Verdon, CS 90 046, 13067 St. Paul Lez Durance Cedex (France); and others
2015-10-15
The final design of the ITER TF, CS, CC and VS AC/DC converters has been completed to implement ITER requirements following the detailed design and refinements of the preliminary design. The number of parallel thyristors and the rating of fuses are coordinated to keep those devices within the explosion limit even under most severe fault conditions. The impedance of the converter transformer has been optimized taking into account the energization inrush current, short circuit current, reactive power consumption and the available DC voltage. To ensure system integrity, AC/DC converters are mechanically divided into transformers, AC busbars, 6-pulse bridges, DC interconnecting busbars and DC reactors, and then all subsystems are decoupled by flexible links. To provide stable real time network communication down to the converters, a one GbE link is deployed between master controllers and local controllers. IEEE 1588 is implemented to the embedded controllers for precision time synchronization. This paper describes the detailed solutions implemented in the final design for the ITER AC/DC converters with R&D results of converter prototypes.
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
Sorption and Transport of Pharmaceutical chemicals in Organic- and Mineral-rich Soils
Vulava, V. M.; Schwindaman, J.; Murphey, V.; Kuzma, S.; Cory, W.
2011-12-01
Pharmaceutical, active ingredients in personal care products (PhACs), and their derivative compounds are increasingly ubiquitous in surface waters across the world. Sorption and transport of four relatively common PhACs (naproxen, ibuprofen, cetirizine, and triclosan) in different natural soils was measured. All of these compounds are relatively hydrophobic (log KOW>2) and have acid/base functional groups, including one compound that is zwitterionic (cetirizine.) The main goal of this study was to correlate organic matter (OM) and clay content in natural soils and sediment with sorption and degradation of PhACs and ultimately their potential for transport within the subsurface environment. A- and B-horizon soils were collected from four sub-regions within a pristine managed forested watershed near Charleston, SC, with no apparent sources of anthropogenic contamination. These four soil series had varying OM content (fOC) between 0.4-9%, clay mineral content between 6-20%, and soil pH between 4.5-6. The A-horizon soils had higher fOC and lower clay content than the B-horizon soils. Sorption isotherms measured from batch sorption experimental data indicated a non-linear sorption relationship in all A- and B-horizon soils - stronger sorption was observed at lower PhAC concentrations and lower sorption at higher concentrations. Three PhACs (naproxen, ibuprofen, and triclosan) sorbed more strongly with higher fOC A-horizon soils compared with the B-horizon soils. These results show that soil OM had a significant role in strongly binding these three PhACs, which had the highest KOW values. In contrast, cetirizine, which is predominantly positively charged at pH below 8, strongly sorbed to soils with higher clay mineral content and least strongly to higher fOC soils. All sorption isotherms fitted well to the Freundlich model. For naproxen, ibuprofen, and triclosan, there was a strong and positive linear correlation between the Freundlich adsorption constant, Kf, and f
Critical current measurement in superconducting rings using an automatic inductive technique
International Nuclear Information System (INIS)
Gonzalez-Jorge, H.; Linares, B.; Quelle, I.; Carballo, E.; Romani, L.; Domarco, G.
2007-01-01
A measurement technique was developed to identify the critical current of superconducting rings. It is based on the detection of the voltage on a secondary coil when the current induced in the superconductor by a primary one go beyond to the critical value. The technique uses a DC power supply to control the AC current circulating by the primary circuit. Such circuit mainly consists on an AC power supply which gives a constant AC voltage, a primary inducting coil and a control coil with iron core. The AC current circulating by this circuit is modified with the change in the impedance of the control coil due to the fact of the DC current supplied by the power supply in parallel with it
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
International Nuclear Information System (INIS)
Soeldner, F.X.; Pereverzev, G.V.; Bartiromo, R.; Fahrbach, H.U.; Leuterer, F.; Murmann, H.D.; Staebler, A.; Steuer, K.H.
1993-01-01
Transport code calculations were made for experiments with the combined operation of lower hybrid current drive and heating and of neutral beam injection heating on ASDEX. Peaking or flattening of the electron temperature profile are mainly explained by modifications of the MHD induced electron heat transport. They originate from current profile changes due to lower hybrid and neutral beam current drive and to contributions from the bootstrap current. Ion heat transport cannot be described by one single model for all heating scenarios. The ion heat conductivity is reduced during lower hybrid heated phases with respect to Ohmic and neutral beam heating. (author). 13 refs, 5 figs
Alternate current interference in pipeline; Interferencia por corrente alternada em dutos
Energy Technology Data Exchange (ETDEWEB)
Oliver, Joao Hipolito de Lima [TRANSPETRO - PETROBRAS Transporte S.A., Rio de Janeiro, RJ (Brazil)
2003-07-01
This paper regards to the concerning that the pipeline operators should take in to account to better understand and control the alternate current interference (AC- interference). Pipelines sharing rights-of-way with AC high voltage power lines are subjected to AC interference that can cause risk for personnel, operational safety and environment. The AC-interference shall be evaluated, in such way that mitigating action can be applied in order to assure the pipeline is operated in a safety way. The AC-interference evaluation should take in to account the pipeline and the electrical generation/transmission design data. Three approaches are considered: the coating integrity, the personnel chock hazards and the pipeline integrity. The coating integrity is affected by the possibility of high-voltage be induced on the pipeline during power line current fault. The operation and maintenance personnel can be prone to chock hazards (touch voltage and step voltage), depending upon the level of the induced voltage on the pipeline and the ground current. An induced voltage evaluation is then necessary to identify AC potentials in pipeline higher than the safe criteria. The pipeline integrity is concerning to the possibility of occurring alternate current corrosion (AC-corrosion) on the pipe wall. This kind of corrosion is still been investigated, and although it is less critical than the direct current corrosion, it can happen in specific situation. Parameters that affect AC-corrosion are discussed in this paper. Finely it is presented a brief guide to evaluate the possibility of occurring AC- interference in a pipeline and a mitigation measures summary. (author)
Design study of an AC power supply system in JT-60SA
International Nuclear Information System (INIS)
Shimada, Katsuhiro; Baulaigue, Olivier; Cara, Philippe; Coletti, Alberto; Coletti, Roberto; Matsukawa, Makoto; Terakado, Tsunehisa; Yamauchi, Kunihito
2011-01-01
In the initial research phase of JT-60SA, which is the International Thermonuclear Experimental Reactor (ITER) satellite Tokamak with superconducting toroidal and poloidal magnetic field coils, the plasma heating operation of 30 MW-60 s or 20 MW-100 s is planned for 5.5 MA single null divertor plasmas. To achieve this operation, AC power source of the medium voltage of 18 kV and ∼7 GJ has to be provided in total to the poloidal field coil power supplies and additional heating devices such as neutral beam injection (NBI) and electron cyclotron radio frequency (ECRF). In this paper, the proposed AC power supply system in JT-60SA was estimated from the view point of available power, and harmonic currents based on the standard plasma operation scenario during the initial research phase. This AC power supply system consists of the reused JT-60 power supply facilities including motor generators with flywheel, AC breakers, harmonic filters, etc., to make it cost effective. In addition, the conceptual design of the upgraded AC power supply system for the ultimate heating power of 41 MW-100 s in the extended research phase is also described.
Novel dielectric reduces corona breakdown in ac capacitors
Loehner, J. L.
1972-01-01
Dielectric system was developed which consists of two layers of 25-gage paper separated by one layer of 50-gage polypropylene to reduce corona breakdown in ac capacitors. System can be used in any alternating current application where constant voltage does not exceed 400 V rms. With a little research it could probably be increased to 700 to 800 V rms.
76 FR 55213 - Commercial Transportation of Equines to Slaughter
2011-09-07
.... APHIS-2006-0168] RIN 0579-AC49 Commercial Transportation of Equines to Slaughter AGENCY: Animal and... regarding the commercial transportation of equines to slaughter to add a definition of equine for slaughter... of equines in commercial transportation to slaughter are met. DATES: Effective Date: October 7, 2011...
Wolfe, Elizabeth S; Bryant, Elizabeth A
The American College of Surgeons (ACS) mandates that each verified trauma center must have an injury prevention coordinator (IPC); however, Chapter 18 in the Resources for Optimal Care of the Injured Patient (2014) provides minimal information on how to effectively lead or manage an injury prevention (IP) program. This opinion article addresses 3 fundamental components of an effective IP program: (1) construction of an innovative vision of IP programming using current technology; (2) intentional investment and involvement; and (3) stakeholder leadership, engagement, and sustainability. This article also provides leadership and management methods from other professions both within and outside of the health care field that can be translated into sustainable IP program planning, implementation, and longevity.
Aruna, S. A.; Zhang, P.; Lin, F. Y.; Ding, S. Y.; Yao, X. X.
2000-04-01
Within the framework of the thermally activated process of the flux line or flux line bundles, and by time integration of the 1D equation of motion of the circulating current density icons/Journals/Common/vecJ" ALT="vecJ" ALIGN="TOP"/> (icons/Journals/Common/rho" ALT="rho" ALIGN="TOP"/> ,t ), which is suitable for thin superconducting films (R >>d ,icons/Journals/Common/le" ALT="le" ALIGN="TOP"/> icons/Journals/Common/lambda" ALT="lambda" ALIGN="TOP"/> ), we present numerical calculations of the current profiles, magnetization hysteresis loops and ac susceptibility icons/Journals/Common/chi" ALT="chi" ALIGN="TOP"/> n = icons/Journals/Common/chi" ALT="chi" ALIGN="TOP"/> ´n +iicons/Journals/Common/chi" ALT="chi" ALIGN="TOP"/> ´´n for n = 1, 3 and 5 of a thin disc immersed in an axial time-dependent external magnetic field Ba (t ) = Bdc +Bac cos(2icons/Journals/Common/pi" ALT="pi" ALIGN="TOP"/> icons/Journals/Common/nu" ALT="nu" ALIGN="TOP"/> t ). Our calculated results are compared with those of the critical state model (CSM) and found to prove the approximate validity of the CSM below the irreversibility field. The differences between our computed results and those of the CSM are also discussed.
Energy Technology Data Exchange (ETDEWEB)
Hong, Z; Jiang, Y; Pei, R; Coombs, T A [Electronic, Power and Energy Conversion Group, Engineering Department, University of Cambridge, CB2 1PZ (United Kingdom); Ye, L [Department of Electrical Power Engineering, CAU, P. O. Box 210, Beijing 100083 (China); Campbell, A M [Interdisciplinary Research Centre in Superconductivity, University of Cambridge, CB3 0HE (United Kingdom)], E-mail: Zh223@cam.ac.uk
2008-02-15
In order to utilize HTS conductors in AC electrical devices, it is very important to be able to understand the characteristics of HTS materials in the AC electromagnetic conditions and give an accurate estimate of the AC loss. A numerical method is proposed in this paper to estimate the AC loss in superconducting conductors including MgB{sub 2} wires and YBCO coated conductors. This method is based on solving a set of partial differential equations in which the magnetic field is used as the state variable to get the current and electric field distributions in the cross sections of the conductors and hence the AC loss can be calculated. This method is used to model a single-element and a multi-element MgB{sub 2} wires. The results demonstrate that the multi-element MgB{sub 2} wire has a lower AC loss than a single-element one when carrying the same current. The model is also used to simulate YBCO coated conductors by simplifying the superconducting thin tape into a one-dimensional region where the thickness of the coated conductor can be ignored. The results show a good agreement with the measurement.
International Nuclear Information System (INIS)
Chen, A P; Zhukova, V; Zhukov, A; Dominguez, L; Chizhik, A; Blanco, J M; Gonzalez, J
2004-01-01
The influence of an ac magnetic field and the induced magnetic anisotropy (by field annealing and torsion annealing) on the magnetoimpedance (MI) tensor in an amorphous wire has been analysed. The experimental measurements were carried out in an amorphous wire of composition (Co 0.94 Fe 0.06 ) 72.5 Si 12.5 B 15 , with a negative, nearly zero magnetostriction constant, excited either by an ac circular, h φ , or an axial, h z , magnetic field created by an ac electric current passing along the wire or through an exciting coil mounted on the wire, respectively. The ac current amplitude was changed from 7.5 to 40 mA and the current frequency f was varied from 1.5 to 20 MHz. The induced magnetic anisotropies modify the MI response drastically. The field annealed sample shows a unique peak of the MI effect, while the torsion annealed sample presents an asymmetric giant magnetoimpedance ratio associated with the induced magnetic anisotropy which provokes such thermal treatments
Schrabback, T.; Erben, T.; Simon, P.; Miralles, J.-M.; Schneider, P.; Heymans, C.; Eifler, T.; Fosbury, R. A. E.; Freudling, W.; Hetterscheidt, M.; Hildebrandt, H.; Pirzkal, N.
2007-06-01
Context: This is the first paper of a series describing our measurement of weak lensing by large-scale structure, also termed “cosmic shear”, using archival observations from the Advanced Camera for Surveys (ACS) on board the Hubble Space Telescope (HST). Aims: In this work we present results from a pilot study testing the capabilities of the ACS for cosmic shear measurements with early parallel observations and presenting a re-analysis of HST/ACS data from the GEMS survey and the GOODS observations of the Chandra Deep Field South (CDFS). Methods: We describe the data reduction and, in particular, a new correction scheme for the time-dependent ACS point-spread-function (PSF) based on observations of stellar fields. This is currently the only technique which takes the full time variation of the PSF between individual ACS exposures into account. We estimate that our PSF correction scheme reduces the systematic contribution to the shear correlation functions due to PSF distortions to MUSIC sample, we determine a local single field estimate for the mass power spectrum normalisation σ8, CDFS=0.52+0.11-0.15 (stat) ± 0.07(sys) (68% confidence assuming Gaussian cosmic variance) at a fixed matter density Ω_m=0.3 for a ΛCDM cosmology marginalising over the uncertainty of the Hubble parameter and the redshift distribution. We interpret this exceptionally low estimate to be due to a local under-density of the foreground structures in the CDFS. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained from the data archives at the Space Telescope European Coordinating Facility and the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555.
Energy Technology Data Exchange (ETDEWEB)
Futtersack, R., E-mail: romain.futtersack@cea.fr [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Universite Paul Sabatier Toulouse, LAPLACE, 118 Route de Narbonne, F-31062 Toulouse Cedex 9 (France); Tamain, P. [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Hagelaar, G. [Universite Paul Sabatier Toulouse, LAPLACE, 118 Route de Narbonne, F-31062 Toulouse Cedex 9 (France); Ghendrih, Ph.; Simonin, A. [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France)
2013-07-15
We investigate the impact of both parallel and transverse boundary conditions on the current and charge transport in open field line systems using the TOKAM2D code, which solves a minimal model for interchange turbulence. Various limit test cases are discussed and analyzed. In the parallel direction, the sheath conductivity is found to play an essential role in the stabilization of large-scale potential structures, leading to the formation of transport channel or transport barrier respectively for an insulating end wall or a wall with an enhanced sheath conductivity. On another hand, the addition of transverse boundary conditions intrinsically changes the transport characteristics, influencing both radial profiles and probability density functions. It underlines that in some cases a detailed description of the plasma-wall interaction process is required to get a proper description of the current loop pattern that determines electrostatic turbulent transport.
Stability analysis of direct current control in current source rectifier
DEFF Research Database (Denmark)
Lu, Dapeng; Wang, Xiongfei; Blaabjerg, Frede
2017-01-01
Current source rectifier with high switching frequency has a great potential for improving the power efficiency and power density in ac-dc power conversion. This paper analyzes the stability of direct current control based on the time delay effect. Small signal model including dynamic behaviors...
AC impedance electrochemical modeling of lithium-ion positive electrodes
International Nuclear Information System (INIS)
Dees, D.; Gunen, E.; Abraham, D.; Jansen, A.; Prakash, J.
2004-01-01
Under Department of Energy's Advanced Technology Development Program,various analytical diagnostic studies are being carried out to examine the lithium-ion battery technology for hybrid electric vehicle applications, and a series of electrochemical studies are being conducted to examine the performance of these batteries. An electrochemical model was developed to associate changes that were observed in the post-test analytical diagnostic studies with the electrochemical performance loss during testing of lithium ion batteries. While both electrodes in the lithium-ion cell have been studied using a similar electrochemical model, the discussion here is limited to modeling of the positive electrode. The positive electrode under study has a composite structure made of a layered nickel oxide (LiNi 0.8 Co 0.15 Al 0.05 O 2 ) active material, a carbon black and graphite additive for distributing current, and a PVDF binder all on an aluminum current collector. The electrolyte is 1.2M LiPF 6 dissolved in a mixture of EC and EMC and a Celgard micro-porous membrane is used as the separator. Planar test cells (positive/separator/negative) were constructed with a special fixture and two separator membranes that allowed the placement of a micro-reference electrode between the separator membranes (1). Electrochemical studies including AC impedance spectroscopy were then conducted on the individual electrodes to examine the performance and ageing effects in the cell. The model was developed by following the work of Professor Newman at Berkeley (2). The solid electrolyte interface (SEI) region, based on post-test analytical results, was assumed to be a film on the oxide and an oxide layer at the surface of the oxide. A double layer capacity was added in parallel with the Butler-Volmer kinetic expression. The pertinent reaction, thermodynamic, and transport equations were linearized for a small sinusoidal perturbation (3). The resulting system of differential equations was solved
Lu, Bin [Kenosha, WI; Luebke, Charles John [Sussex, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Becker, Scott K [Oak Creek, WI
2011-12-27
A system and method for measuring and controlling stator winding temperature in an AC motor while idling is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of a multi-phase AC motor. The circuit further includes a plurality of switching devices to control current flow and terminal voltages in the multi-phase AC motor and a controller connected to the circuit. The controller is configured to activate the plurality of switching devices to create a DC signal in an output of the motor control device corresponding to an input to the multi-phase AC motor, determine or estimate a stator winding resistance of the multi-phase AC motor based on the DC signal, and estimate a stator temperature from the stator winding resistance. Temperature can then be controlled and regulated by DC injection into the stator windings.
Achromatic beam transport of High Current Injector
International Nuclear Information System (INIS)
Kumar, Sarvesh; Mandal, A.
2016-01-01
The high current injector (HCI) provides intense ion beams of high charge state using a high temperature superconducting ECR ion source. The ion beam is accelerated upto a final energy of 1.8 MeV/u due to an electrostatic potential, a radio frequency quadrupole (RFQ) and a drift tube linac (DTL). The ion beam has to be transported to superconducting LINAC which is around 50 m away from DTL. This section is termed as high energy beam transport section (HEBT) and is used to match the beam both in transverse and longitudinal phase space to the entrance of LINAC. The HEBT section is made up of four 90 deg. achromatic bends and interconnecting magnetic quadrupole triplets. Two RF bunchers have been used for longitudinal phase matching to the LINAC. The ion optical design of HEBT section has been simulated using different beam dynamics codes like TRACEWIN, GICOSY and TRACE 3D. The field computation code OPERA 3D has been utilized for hardware design of all the magnets. All the dipole and quadrupole magnets have been field mapped and their test results such as edge angles measurements, homogeneity and harmonic analysis etc. are reported. The whole design of HEBT section has been performed such that the most of the beam optical components share same hardware design and there is ample space for beam diagnostics as per geometry of the building. Many combination of achromatic bends have been simulated to transport the beam in HEBT section but finally the four 90 deg. achromatic bend configuration is found to be the best satisfying all the geometrical constraints with simplified beam tuning process in real time
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
Protection of AC and DC Microgrids
DEFF Research Database (Denmark)
Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez
2015-01-01
and DC microgrids, and then investigates the existing and promising solutions for the corresponding challenges. To the authors’ knowledge, three parts of smart grids are required to be developed to facilitate implementation of protection scheme in microgrids. The main requirements and open issues......In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...
Soliton ratchetlike dynamics by ac forces with harmonic mixing
DEFF Research Database (Denmark)
Salerno, Mario; Zolotaryuk, Yaroslav
2002-01-01
The possibility of unidirectional motion of a kink (topological soliton) of a dissipative sine-Gordon equation in the presence of ac forces with harmonic mixing (at least biharmonic) and of zero mean, is presented. The dependence of the kink mean velocity on system parameters is investigated...... numerically and the results are compared with a perturbation analysis based on a point-particle representation of the soliton. We find that first order perturbative calculations lead to incomplete descriptions, due to the important role played by the soliton-phonon interaction in establishing the phenomenon...... in the system. Effective soliton transport is achieved when the internal mode and the external force get phase locked. We find that for kinks driven by biharmonic drivers consisting of the superposition of a fundamental driver with its first odd harmonic, the transport arises only due to this internal mode...
Induced AC voltages on pipelines may present a serious hazard
International Nuclear Information System (INIS)
Kirkpatrick, E.L.
1997-01-01
The problem of induced AC voltages on pipelines has always been with us. Early pipeline construction consisted of bare steel or cast iron pipe, which was very well grounded. Bell and spigot, mechanical, or dresser-style joint couplings often were used, creating electrically discontinuous pipelines which are less susceptible to AC induction. Although induced AC affects any pipeline parallel to a high-voltage alternating current (HVAC) power line, the effects were not noticeable on bare pipelines. With the advent of welded steel pipelines, modern cathodic protection (CP) methods and materials, and the vastly improved quality of protective coatings, induced AC effects on pipelines have become a significant consideration on many pipeline rights-of-way. In the last two to three decades, one has been seeing much more joint occupancy of the same right-of-way by one or more pipelines and power lines. As the cost of right-of-way and the difficulty in acquisition, particularly in urban areas, have risen, the concept of joint occupancy rights-of-way has become more attractive to many utility companies. Federal and state regulations usually insist on joint-use right-of-way when a utility proposes crossing regulated or publicly owned lands, wherever there is an existing easement. Such joint use allows the induced AC phenomena to occur and may create electrical hazards and interference to pipeline facilities. Underground pipelines are especially susceptible if they are well-coated and electrically isolated for CP
Leakage current transport mechanisms of La 0.67 Sr 0.33 MnO 3 ...
Indian Academy of Sciences (India)
limited current mechanism under forward bias while thermionic emission model under reverse bias. Analysis indicates that a modulating Schottky barrier exists at the LSMO/BTO interface, which dominates the leakage current transport properties ...
Modeling Solar Energetic Particle Transport near a Wavy Heliospheric Current Sheet
Battarbee, Markus; Dalla, Silvia; Marsh, Mike S.
2018-02-01
Understanding the transport of solar energetic particles (SEPs) from acceleration sites at the Sun into interplanetary space and to the Earth is an important question for forecasting space weather. The interplanetary magnetic field (IMF), with two distinct polarities and a complex structure, governs energetic particle transport and drifts. We analyze for the first time the effect of a wavy heliospheric current sheet (HCS) on the propagation of SEPs. We inject protons close to the Sun and propagate them by integrating fully 3D trajectories within the inner heliosphere in the presence of weak scattering. We model the HCS position using fits based on neutral lines of magnetic field source surface maps (SSMs). We map 1 au proton crossings, which show efficient transport in longitude via HCS, depending on the location of the injection region with respect to the HCS. For HCS tilt angles around 30°–40°, we find significant qualitative differences between A+ and A‑ configurations of the IMF, with stronger fluences along the HCS in the former case but with a distribution of particles across a wider range of longitudes and latitudes in the latter. We show how a wavy current sheet leads to longitudinally periodic enhancements in particle fluence. We show that for an A+ IMF configuration, a wavy HCS allows for more proton deceleration than a flat HCS. We find that A‑ IMF configurations result in larger average fluences than A+ IMF configurations, due to a radial drift component at the current sheet.
AC impedance spectroscopy of NASICON type Na3Fe2(PO4)3 ceramic
Mandal, Biswajit; Thakur, A. K.
2018-05-01
Super ionic conductors (e.g.; A3M2(XO4)3, A=Li, Na) have received attention in applied research due to their interesting electrochemical property and inherently high ionic conductivity [1]. However, structural and compatibility requirements for fast ion transport is stringent and it plays a crucial role. In A3M2(XO4)3, a suitable cage formation in the crystal framework due to corner sharing arrangement of XO4 tetrahedra and MO6 octahedra creates voids that acts as host/guest site for cation transport. In this work, we report Nasicon structure Na3Fe2(PO4)3 (NFP) prepared via sol-gel route mediated by citric acid. Structural analysis confirmed that NFP sample belongs to monoclinic crystal structure having Cc space group (S. G. No 9) with lattice parameters, a=15.106 Å, b=8.722 Å, c=8.775 Å and β=124.96°. Electrical properties of the prepared sample have been studied by AC impedance spectroscopy technique. The AC conductivity results indicated typical signature of ionically conducting system.
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
Energy Technology Data Exchange (ETDEWEB)
Kaushal, Vikas; Margala, Martin [Department of Electrical and Computer Engineering, University of Massachusetts Lowell, MA, 01854 (United States); Yu Qiaoyan; Ampadu, Paul; Guarino, Gregg; Sobolewski, Roman, E-mail: vikas_kaushal@student.uml.ed [Department of Electrical and Computer Engineering, University of Rochester, NY, 14627 (United States)
2009-11-15
In this paper, two different theoretical models, Comsol Multiphysics{sup TM} (a Finite Element Analysis tool), and a field solver Atlas/Blaze from Silvaco, are compared qualitatively to study the effect of the deflector position, its size and electric field on the charge transport and its distribution along the channel, resulting in current outputs and leakages in ballistic deflection transistors (BDT). Silvaco simulations and experimental results were then used to study the lateral charge transport as a result of variation in electric field distribution, which controls the charge current along the channel in BDT. The electric field dependence of gain is also studied with experimental and theoretical results.
International Nuclear Information System (INIS)
Kaushal, Vikas; Margala, Martin; Yu Qiaoyan; Ampadu, Paul; Guarino, Gregg; Sobolewski, Roman
2009-01-01
In this paper, two different theoretical models, Comsol Multiphysics TM (a Finite Element Analysis tool), and a field solver Atlas/Blaze from Silvaco, are compared qualitatively to study the effect of the deflector position, its size and electric field on the charge transport and its distribution along the channel, resulting in current outputs and leakages in ballistic deflection transistors (BDT). Silvaco simulations and experimental results were then used to study the lateral charge transport as a result of variation in electric field distribution, which controls the charge current along the channel in BDT. The electric field dependence of gain is also studied with experimental and theoretical results.
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
Ac loss measurement of SSC dipole magnets
International Nuclear Information System (INIS)
Delchamps, S.; Hanft, R.; Jaffery, T.; Kinney, W.; Koska, W.; Lamm, M.J.; Mazur, P.O.; Orris, D.; Ozelis, J.P.; Strait, J.; Wake, M.
1992-09-01
AC losses in full length and 1.5 m model SSC collider dipoles were successfully measured by the direct observation of energy flow into and out of magnets during a ramp cycle. The measurement was performed by using two double-integrating type digital volt meters (DVM's) for current and voltage measurement. Measurements were performed for six is m long ASST magnets and five 1.5 m long model magnets, inducting one 40 mm diameter magnet. There were large variations in the eddy current losses. Since these magnets use conductors with slight deviations in their internal structures and processing of the copper surface depending on the manufacturer, it is likely that there are differences in the contact resistance between strands. Correlation between the ramp rate dependence of the,quench current and the eddy current loss was evident
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
Negative hydrogen ion beam extraction from an AC heated cathode driven Bernas-type ion source
Energy Technology Data Exchange (ETDEWEB)
Okano, Y.; Miyamoto, N.; Kasuya, T.; Wada, M.
2015-04-08
A plasma grid structure was installed to a Bernas-type ion source used for ion implantation equipment. A negative hydrogen (H{sup −}) ion beam was extracted by an AC driven ion source by adjusting the bias to the plasma grid. The extracted electron current was reduced by positively biasing the plasma grid, while an optimum plasma grid bias voltage for negative ion beam extraction was found to be positive 3 V with respect to the arc chamber. Source operations with AC cathode heating show extraction characteristics almost identical to that with DC cathode heating, except a minute increase in H{sup −} current at higher frequency of cathode heating current.
Energy Technology Data Exchange (ETDEWEB)
Buechler, Markus; Voute, Carl-Heinz; Joos, David [SGK Schweizerische Gesellschaft fuer Korrosionsschutz, Zuerich (Switzerland)
2011-07-01
The current limiting values for corrosion of pipelines under a.c. current stress may be difficult to apply to pipelines, owing to the very heterogeneous bedding of the pipeline, poor jacket quality, or high short-term a.c. voltages. In principle, periodic alternation between very high and very low protective currents may optimize cathodic corrosion protection. This pulsed current strategy was found to be effective in laboratory tests if the operating parameters are set accurately.
Ligand binding and crystal structures of the substrate-binding domain of the ABC transporter OpuA.
Directory of Open Access Journals (Sweden)
Justina C Wolters
2010-04-01
Full Text Available The ABC transporter OpuA from Lactococcus lactis transports glycine betaine upon activation by threshold values of ionic strength. In this study, the ligand binding characteristics of purified OpuA in a detergent-solubilized state and of its substrate-binding domain produced as soluble protein (OpuAC was characterized.The binding of glycine betaine to purified OpuA and OpuAC (K(D = 4-6 microM did not show any salt dependence or cooperative effects, in contrast to the transport activity. OpuAC is highly specific for glycine betaine and the related proline betaine. Other compatible solutes like proline and carnitine bound with affinities that were 3 to 4 orders of magnitude lower. The low affinity substrates were not noticeably transported by membrane-reconstituted OpuA. OpuAC was crystallized in an open (1.9 A and closed-liganded (2.3 A conformation. The binding pocket is formed by three tryptophans (Trp-prism coordinating the quaternary ammonium group of glycine betaine in the closed-liganded structure. Even though the binding site of OpuAC is identical to that of its B. subtilis homolog, the affinity for glycine betaine is 4-fold higher.Ionic strength did not affect substrate binding to OpuA, indicating that regulation of transport is not at the level of substrate binding, but rather at the level of translocation. The overlap between the crystal structures of OpuAC from L.lactis and B.subtilis, comprising the classical Trp-prism, show that the differences observed in the binding affinities originate from outside of the ligand binding site.
Measurement of AC electrical characteristics of SSC superconducting dipole magnets
International Nuclear Information System (INIS)
Smedley, K.M.; Shafer, R.E.
1992-01-01
Experiments were conducted to measure the AC electrical characteristics of SSC superconducting dipole magnets over the frequency range of 0.1 Hz to 10 kHz. A magnet equivalent circuit representing the magnet DC inductance, eddy current losses, coil-to-ground and turn-to-turn capacitance, was synthesized from the experimental data. This magnet equivalent circuit can be used to predict the current ripple distribution along the superconducting magnet string and can provide dynamic information for the design of the collider current regulation loop
Baumann, Michael H; Bulling, Simon; Benaderet, Tova S; Saha, Kusumika; Ayestas, Mario A; Partilla, John S; Ali, Syed F; Stockner, Thomas; Rothman, Richard B; Sandtner, Walter; Sitte, Harald H
2014-05-01
Serotonin (5-HT) transporter (SERT) substrates like fenfluramine and 3,4-methylenedioxymethamphetamine cause long-term depletion of brain 5-HT, while certain other substrates do not. The 5-HT deficits produced by SERT substrates are dependent upon transporter proteins, but the exact mechanisms responsible are unclear. Here, we compared the pharmacology of several SERT substrates: fenfluramine, d-fenfluramine, 1-(m-chlorophenyl)piperazine (mCPP) and 1-(m-trifluoromethylphenyl)piperainze (TFMPP), to establish relationships between acute drug mechanisms and the propensity for long-term 5-HT depletions. In vivo microdialysis was carried out in rat nucleus accumbens to examine acute 5-HT release and long-term depletion in the same subjects. In vitro assays were performed to measure efflux of [(3)H]5-HT in rat brain synaptosomes and transporter-mediated ionic currents in SERT-expressing Xenopus oocytes. When administered repeatedly to rats (6 mg/kg, i.p., four doses), all drugs produce large sustained elevations in extracellular 5-HT (>5-fold) with minimal effects on dopamine. Importantly, 2 weeks after dosing, only rats exposed to fenfluramine and d-fenfluramine display depletion of brain 5-HT. All test drugs evoke fluoxetine-sensitive efflux of [(3)H]5-HT from synaptosomes, but d-fenfluramine and its bioactive metabolite d-norfenfluramine induce significantly greater SERT-mediated currents than phenylpiperazines. Our data confirm that drug-induced 5-HT release probably does not mediate 5-HT depletion. However, the magnitude of transporter-mediated inward current may be a critical factor in the cascade of events leading to 5-HT deficits. This hypothesis warrants further study, especially given the growing popularity of designer drugs that target SERT.
Calorimetric method of ac loss measurement in a rotating magnetic field
Energy Technology Data Exchange (ETDEWEB)
Ghoshal, P. K. [Oxford Instruments NanoScience, Abingdon, Oxfordshire OX13 5QX (United Kingdom); Coombs, T. A.; Campbell, A. M. [Department of Engineering, Electrical Engineering, University of Cambridge, Cambridge CB3 0FA (United Kingdom)
2010-07-15
A method is described for calorimetric ac-loss measurements of high-T{sub c} superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.
Vosskuhl, J; Strüber, D; Herrmann, C S
2015-12-01
Transcranial alternating current stimulation (tACS) is a new technique for the modulation of oscillatory brain activity as measured in the electroencephalogram (EEG). In contrast to well-established stimulation techniques, such as transcranial direct current stimulation and transcranial magnetic stimulation, tACS applies a sinusoidal alternating current at a specific frequency. This enables the modulation of the amplitude and frequency of endogenous brain oscillations as well as related cognitive processes. Therefore, the use of tACS has the possibility to evaluate well-known correlations between brain oscillations and cognitive processes in terms of causality. Such causal relationships have been documented in numerous neurocognitive studies on sensory, motor and perceptual processes; however, the clinical application of tACS is still in its infancy. In principle, any pathology that can reliably be connected with brain oscillations of a defined frequency is treatable. A current main focus of clinical research is on symptoms of Parkinson's disease and to a lesser degree, tinnitus. For an effective application of tACS it is important to choose the electrode positions as well as the frequency, intensity and duration of the stimulation in a theory-based and symptom-related manner. A successful therapeutic intervention requires the persistence of the tACS effect after stimulation has ceased. A mechanism that offers not only an explanation to the origin of persistent tACS effects but is also of high therapeutic benefit is neural plasticity. Therefore, one current focus of research aims at a better understanding of tACS after effects.
Resonance reduction for AC drives with small capacitance in the DC link
DEFF Research Database (Denmark)
Máthé, Lászlo; Török, Lajos; Wang, Dong
2016-01-01
Pulse Width Modulated AC drives equipped with small DC-link capacitor are becoming an attractive solution for electric drive applications with moderate requirements for shaft dynamic performance. However, when these drives are fed from a weak grid a resonance between the line side impedance...... and the DC-link capacitor appears. Due to this resonance, the THD and the partially weighted harmonic distortion of the line currents are increased, which may rise compatibility problems with the AC line harmonic standards. By using vector control the motor drive is transformed into a constant power load...
Electrodeformation of multi-bilayer spherical concentric membranes by AC electric fields
Lira-Escobedo, J.; Arauz-Lara, J.; Aranda-Espinoza, H.; Adlerz, K.; Viveros-Mendez, P. X.; Aranda-Espinoza, S.
2017-09-01
It is now well established that external stresses alter the behaviour of cells, where such alterations can be as profound as changes in gene expression. A type of stresses of particular interest are those due to alternating-current (AC) electric fields. The effect of AC fields on cells is still not well understood, in particular it is not clear how these fields affect the cell nucleus and other organelles. Here, we propose that one possible mechanism is through the deformation of the membranes. In order to investigate the effect of AC fields on the morphological changes of the cell organelles, we modelled the cell as two concentric bilayer membranes. This model allows us to obtain the deformations induced by the AC field by balancing the elastic energy and the work done by the Maxwell stresses. Morphological phase diagrams are obtained as a function of the frequency and the electrical properties of the media and membranes. We demonstrate that the organelle shapes can be changed without modifying the shape of the external cell membrane and that the organelle deformation transitions can be used to measure, for example, the conductivity of the nucleus.
Surge Protection in Low-Voltage AC Power Circuits: An Anthology
Martzloff, F. D.
2002-10-01
The papers included in this part of the Anthology provide basic information on the propagation of surges in low-voltage AC power circuits. The subject was approached by a combination of experiments and theoretical considerations. One important distinction is made between voltage surges and current surges. Historically, voltage surges were the initial concern. After the introduction and widespread use of current-diverting surge-protective devices at the point-of-use, the propagation of current surges became a significant factor. The papers included in this part reflect this dual dichotomy of voltage versus current and impedance mismatch effects versus simple circuit theory.
DEFF Research Database (Denmark)
Heise, Kirstin Friederike; Kortzorg, Nick; Saturnino, Guilherme Bicalho
2016-01-01
Objective: To evaluate a modified electrode montage with respect to its effect on tACS-dependent modulation of corticospinal excitability and discomfort caused by neurosensory side effects accompanying stimulation. Methods: In a double-blind cross-over design, the classical electrode montage for ....... Conclusions: In comparison to the classic montage, the M1 centre-ring montage enables a more focal stimulation of the target area and, at the same time, significantly reduces neurosensory side effects, essential for placebo-controlled study designs.......Objective: To evaluate a modified electrode montage with respect to its effect on tACS-dependent modulation of corticospinal excitability and discomfort caused by neurosensory side effects accompanying stimulation. Methods: In a double-blind cross-over design, the classical electrode montage...... for primary motor cortex (M1) stimulation (two patch electrodes over M1 and contralateral supraorbital area) was compared with an M1 centre-ring montage. Corticospinal excitability was evaluated before, during, immediately after and 15 minutes after tACS (10 min., 20 Hz vs. 30 s low-frequency transcranial...
Lan, Chunbo; Tang, Lihua; Harne, Ryan L.
2018-05-01
Nonlinear piezoelectric energy harvester (PEH) has been widely investigated during the past few years. Among the majority of these researches, a pure resistive load is used to evaluate power output. To power conventional electronics in practical application, the alternating current (AC) generated by nonlinear PEH needs to be transformed into a direct current (DC) and rectifying circuits are required to interface the device and electronic load. This paper aims at exploring the critical influences of AC and DC interface circuits on nonlinear PEH. As a representative nonlinear PEH, we fabricate and evaluate a monostable PEH in terms of generated power and useful operating bandwidth when it is connected to AC and DC interface circuits. Firstly, the harmonic balance analysis and equivalent circuit representation method are utilized to tackle the modeling of nonlinear energy harvesters connected to AC and DC interface circuits. The performances of the monostable PEH connected to these interface circuits are then analyzed and compared, focusing on the influences of the varying load, excitation and electromechanical coupling strength on the nonlinear dynamics, bandwidth and harvested power. Subsequently, the behaviors of the monostable PEH with AC and DC interface circuits are verified by experiment. Results indicate that both AC and DC interface circuits have a peculiar influence on the power peak shifting and operational bandwidth of the monostable PEH, which is quite different from that on the linear PEH.
Current status of radiation transport tools for proliferation and terrorism prevention
International Nuclear Information System (INIS)
Sale, K.E.
2004-01-01
Full text: We will present the current status and future plans for the set of calculational tools and databases developed and maintained at LLNL. The calculational tools include the Monte Carlo codes TART 1) and COG 2) as well as the deterministic code ARDRA 3) . In addition to these codes we use currently there is a major development effort for a new massively parallel transport code. An important part of the capability we're developing is a sophisticated user interface, based on a commercial 3-D modeling product, to improve the model development process. A major part of this user interface tool is being developed by Strela 4) under the Nuclear Cities Initiative. Strela has developed a hub-and-spoke technology for code input interconversions (between COG, TART and MCNP) and will produce the plug-ins that extend the capabilities of the 3-D modeler for use as a radiation transport input generator. The major advantages of this approach are the built-in user interface for 3-D modeling and the ability to read a large variety of CAD-file formats. In addition to supporting our current radiation transport codes and developing new capabilities we are working on some nuclear data needs for homeland security. These projects are carried out and the Lawrence Berkeley National Laboratory 88' cyclotron and at the Institute for Nuclear Research of the Nation Academy of Science of Ukraine under and STCU contract. Reference: 1. http://www.llnl.gov/cullen1/mc/htm; 2. http://www-phys.llnl.gov/N_Div/COG/ETR/ETR_9306.html; 3. http://www.llnl.gov/CASC/asciturb/talks/PPT-HTML.131596/tsld030.htm; 4. http://strela.snz.ru/
Coordinated control of three-phase AC and DC type EV–ESSs for efficient hybrid microgrid operations
International Nuclear Information System (INIS)
Rahman, Md Shamiur; Hossain, M.J.; Lu, Junwei
2016-01-01
Highlights: • A coordinated control is proposed for three-phase AC and DC type electric vehicles. • A four-quadrant interlinking converter is designed for hybrid microgrid operations. • Concurrent real irradiation data and commercial load profile are used for testing. • Unbalanced scenario due to single-phase electric vehicle charging is considered. • Improved AC and DC bus voltages and frequency regulations are achieved. - Abstract: This paper presents a three-layered coordinated control to incorporate three-phase (3P) alternating current (AC) and direct current (DC) type electric vehicle energy storage systems (EV–ESSs) for improved hybrid AC/DC microgrid operations. The first layer of the algorithm ensures DC subgrid management by regulating the DC bus voltage and DC side power management. The second and third layer manages AC subgrid by regulating the AC bus voltage and the frequency by managing reactive and active power respectively. The multi-layered coordination is embedded into the microgrid central controller (MGCC) which controls the interlinking controller in between AC and DC microgrid and the interfacing controllers of the participating electric vehicles (EVs) and distributed generation (DG) units. The whole system is designed in MATLAB/SIMULINK® environment resembling the under construction microgrid at Griffith University, Australia. Extensive case studies are performed using real life irradiation data and commercial loads of the campus buildings. Impacts of homogeneous and heterogeneous single-phase EV charging are investigated to observe both balanced and unbalanced scenarios. Synchronization during the transition from the islanded to grid-tied mode is tested considering a contingency situation. From the comparative simulation results it is evident that the proposed controller exhibits effective, reliable and robust performance for all the cases.
High current transport experiment for heavy ion inertial fusion
Directory of Open Access Journals (Sweden)
L. R. Prost
2005-02-01
Full Text Available The High Current Experiment at Lawrence Berkeley National Laboratory is part of the U.S. program to explore heavy-ion beam transport at a scale representative of the low-energy end of an induction linac driver for fusion energy production. The primary mission of this experiment is to investigate aperture fill factors acceptable for the transport of space-charge-dominated heavy-ion beams at high intensity (line charge density ∼0.2 μC/m over long pulse durations (4 μs in alternating gradient focusing lattices of electrostatic or magnetic quadrupoles. This experiment is testing transport issues resulting from nonlinear space-charge effects and collective modes, beam centroid alignment and steering, envelope matching, image charges and focusing field nonlinearities, halo, and electron and gas cloud effects. We present the results for a coasting 1 MeV K^{+} ion beam transported through ten electrostatic quadrupoles. The measurements cover two different fill factor studies (60% and 80% of the clear aperture radius for which the transverse phase space of the beam was characterized in detail, along with beam energy measurements and the first halo measurements. Electrostatic quadrupole transport at high beam fill factor (≈80% is achieved with acceptable emittance growth and beam loss, even though the initial beam distribution is not ideal (but the emittance is low nor in thermal equilibrium. We achieved good envelope control, and rematching may only be needed every ten lattice periods (at 80% fill factor in a longer lattice of similar design. We also show that understanding and controlling the time dependence of the envelope parameters is critical to achieving high fill factors, notably because of the injector and matching section dynamics.
Electroporation of cells using EM induction of ac fields by a magnetic stimulator
International Nuclear Information System (INIS)
Chen, C; Robinson, M P; Evans, J A; Smye, S W; O'Toole, P
2010-01-01
This paper describes a method of effectively electroporating mammalian cell membranes with pulsed alternating-current (ac) electric fields at field strengths of 30-160 kV m -1 . Although many in vivo electroporation protocols entail applying square wave or monotonically decreasing pulses via needles or electrode plates, relatively few have explored the use of pulsed ac fields. Following our previous study, which established the effectiveness of ac fields for electroporating cell membranes, a primary/secondary coil system was constructed to produce sufficiently strong electric fields by electromagnetic induction. The primary coil was formed from the applicator of an established transcranial magnetic stimulation (TMS) system, while the secondary coil was a purpose-built device of a design which could eventually be implanted into tissue. The effects of field strength, pulse interval and cumulative exposure time were investigated using microscopy and flow cytometry. Results from experiments on concentrated cell suspensions showed an optimized electroporation efficiency of around 50%, demonstrating that electroporation can be practicably achieved by inducing such pulsed ac fields. This finding confirms the possibility of a wide range of in vivo applications based on magnetically coupled ac electroporation.
Electroporation of cells using EM induction of ac fields by a magnetic stimulator
Energy Technology Data Exchange (ETDEWEB)
Chen, C; Robinson, M P [Department of Electronics, University of York, Heslington, York YO10 5DD (United Kingdom); Evans, J A [Academic Unit of Medical Physics, University of Leeds, Leeds LS2 9JT (United Kingdom); Smye, S W [Department of Medical Physics and Engineering, Leeds Teaching Hospitals, St. James' s University Hospital, Leeds LS9 7TF (United Kingdom); O' Toole, P [Department of Biology, University of York, Heslington, York YO10 5DD (United Kingdom)
2010-02-21
This paper describes a method of effectively electroporating mammalian cell membranes with pulsed alternating-current (ac) electric fields at field strengths of 30-160 kV m{sup -1}. Although many in vivo electroporation protocols entail applying square wave or monotonically decreasing pulses via needles or electrode plates, relatively few have explored the use of pulsed ac fields. Following our previous study, which established the effectiveness of ac fields for electroporating cell membranes, a primary/secondary coil system was constructed to produce sufficiently strong electric fields by electromagnetic induction. The primary coil was formed from the applicator of an established transcranial magnetic stimulation (TMS) system, while the secondary coil was a purpose-built device of a design which could eventually be implanted into tissue. The effects of field strength, pulse interval and cumulative exposure time were investigated using microscopy and flow cytometry. Results from experiments on concentrated cell suspensions showed an optimized electroporation efficiency of around 50%, demonstrating that electroporation can be practicably achieved by inducing such pulsed ac fields. This finding confirms the possibility of a wide range of in vivo applications based on magnetically coupled ac electroporation.
Dynamic voltage-current characteristics for a water jet plasma arc
International Nuclear Information System (INIS)
Yang Jiaxiang; Lan Sheng; Xu Zuoming
2008-01-01
A virtual instrument technology is used to measure arc current, arc voltage, dynamic V-I characteristics, and nonlinear conductance for a cone-shaped water jet plasma arc under ac voltage. Experimental results show that ac arc discharge mainly happens in water vapor evaporated from water when heated. However, due to water's cooling effect and its conductance, arc conductance, reignition voltage, extinguish voltage, and current zero time are very different from those for ac arc discharge in gas work fluid. These can be valuable to further studies on mechanism and characteristics of plasma ac discharge in water, and even in gas work fluid
International Nuclear Information System (INIS)
Bell, Christopher G.; Anastassiou, Costas A.; O’Hare, Danny; Parker, Kim H.; Siggers, Jennifer H.
2012-01-01
Highlights: ► Theory of ac voltammetry on ideal surface-confined redox systems. ► Analytical description of the harmonics and transient of the current response. ► Solution valid for high frequency, large-amplitude sinusoidal input voltage. ► Protocol for determining system parameters from experimental current responses. - Abstract: Large-amplitude ac voltammetry, where the applied voltage is a large-amplitude sinusoidal waveform superimposed onto a dc ramp, is a powerful method for investigating the reaction kinetics of surface-confined redox species. Here we consider the large-amplitude ac voltammetric current response of a quasi-reversible, ideal, surface-confined redox system, for which the redox reaction is described by Butler–Volmer theory. We derive an approximate analytical solution, which is valid whenever the angular frequency of the sine-wave is much larger than the rate of the dc ramp and the standard kinetic rate constant of the redox reaction. We demonstrate how the third harmonic and the initial transient of the current response can be used to estimate parameters of the electrochemical system, namely the kinetic rate constant, the electron transfer coefficient, the adsorption formal potential, the initial proportion of oxidised molecules and the linear double-layer capacitance.
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
Effect of Fast Neutron Irradiation on Current Transport Properties of HTS Materials
Ballarino, A; Kruglov, V S; Latushkin, S T; Lubimov, A N; Ryazanov, A I; Shavkin, S V; Taylor, T M; Volkov, P V
2004-01-01
The effect of fast neutron irradiation with energy up to 35 MeV and integrated fluence of up to 5 x 10**15 cm-2 on the current transport properties of HTS materials Bi-2212 and Bi-2223 has been studied, both at liquid nitrogen and at room temperatures. The samples irradiated were selected after verification of the stability of their superconducting properties after temperature cycling in the range of 77 K - 293 K. It has been found that the irradiation by fast neutrons up to the above dose does not produce a significant degradation of critical current. The effect of room temperature annealing on the recovery of transport properties of the irradiated samples is also reported, as is a preliminary microstructure investigation of the effect of irradiation on the soldered contacts.
AC losses in high Tc superconductors
International Nuclear Information System (INIS)
Campbell, A.M.
1998-01-01
Full text: Although in principle the AC losses in high Tc superconductors can be calculated from the critical current density, a number of complications make this difficult. The Jc is very field dependent, there are intergranular and intragranular critical currents, the material is anisotropic and there is usually a large demagnetising factor. Care must be taken in interpreting electrical measurements since the voltage depends on the position of the contacts. In spite of these complications the simple theory of Norris has proved surprisingly successful and arguments will be presented as to why this is the case. Results on a range of tapes will be compared with theory and numerical methods for predicting losses discussed. Finally a theory for coupling losses will be given for a composite conductor with high resistance barriers round the filaments
Production of Ac-225 for cancer therapy by photon-induced transmutation of Ra-226.
Melville, G; Meriarty, H; Metcalfe, P; Knittel, T; Allen, B J
2007-09-01
The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. The production of Ac-225 has been achieved using bremsstrahlung photons from an 18 MV medical linear accelerator (linac) to bombard a Ra-226 target. A linac dose of 2800 Gy produced about 64 microCi of Ra-225, which decays to Ac-225. This result, while consistent with the theoretical calculations, is far too low to be of practical use. A more powerful linac is required that runs at a higher current, longer pulse length and higher frequency for practical production. This process could also lead to the reduction of the nuclear waste product Ra-226.
Current transport mechanism in graphene/AlGaN/GaN heterostructures with various Al mole fractions
Pandit, Bhishma; Seo, Tae Hoon; Ryu, Beo Deul; Cho, Jaehee
2016-06-01
The current transport mechanism of graphene formed on AlxGa1-xN/GaN heterostructures with various Al mole fractions (x = 0.15, 0.20, 0.30, and 0.40) is investigated. The current-voltage measurement from graphene to AlGaN/GaN shows an excellent rectifying property. The extracted Schottky barrier height of the graphene/AlGaN/GaN contacts increases with the Al mole fraction in AlGaN. However, the current transport mechanism deviates from the Schottky-Mott theory owing to the deterioration of AlGaN crystal quality at high Al mole fractions confirmed by reverse leakage current measurement.
Wang, Y. H.; Jan, S.; Wang, D. P.
2003-05-01
Tidal and mean flows in the Taiwan Strait are obtained from analysis of 2.5 years (1999-2001) of shipboard ADCP data using a spatial least-squares technique. The average tidal current amplitude is 0.46 ms -1, the maximum amplitude is 0.80 ms -1 at the northeast and southeast entrances and the minimum amplitude is 0.20 ms -1 in the middle of the Strait. The tidal current ellipses derived from the shipboard ADCP data compare well with the predictions of a high-resolution regional tidal model. For the mean currents, the average velocity is about 0.40 ms -1. The mean transport through the Strait is northward (into the East China Sea) at 1.8 Sv. The transport is related to the along Strait wind by a simple regression, transport (Sv)=2.42+0.12×wind (ms -1). Using this empirical formula, the maximum seasonal transport is in summer, about 2.7 Sv, the minimum transport is in winter, at 0.9 Sv, and the mean transport is 1.8 Sv. For comparison, this result indicates that the seasonal amplitude is almost identical to the classical estimate by Wyrtki (Physical oceanography of the southeast Asian waters, scientific results of marine investigations of the South China Sea and Gulf of Thailand, 1959-1961. Naga Report 2, Scripps Institute of Oceanography, 195 pp.) based on the mass balance in the South China Sea, while the mean is close to the recent estimate by Isobe [Continental Shelf Research 19 (1999) 195] based on the mass balance in the East China Sea.
ACS experiment for atmospheric studies on "ExoMars-2016" Orbiter
Korablev, O. I.; Montmessin, F.; Fedorova, A. A.; Ignatiev, N. I.; Shakun, A. V.; Trokhimovskiy, A. V.; Grigoriev, A. V.; Anufreichik, K. A.; Kozlova, T. O.
2015-12-01
ACS is a set of spectrometers for atmospheric studies (Atmospheric Chemistry Suite). It is one of the Russian instruments for the Trace Gas Orbiter (TGO) of the Russian-European "ExoMars" program. The purpose of the experiment is to study the Martian atmosphere by means of two observations regimes: sensitive trace gases measurements in solar occultations and by monitoring the atmospheric state during nadir observations. The experiment will allow us to approach global problems of Mars research such as current volcanism, and the modern climate status and its evolution. Also, the experiment is intended to solve the mystery of methane presence in the Martian atmosphere. Spectrometers of the ACS set cover the spectral range from the near IR-range (0.7 μm) to the thermal IR-range (17 μm) with spectral resolution λ/Δλ reaching 50000. The ACS instrument consists of three independent IR spectrometers and an electronics module, all integrated in a single unit with common mechanical, electrical and thermal interfaces. The article gives an overview of scientific tasks and presents the concept of the experiment.
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
AC losses in multilayer power transmission cables comprised of YBCO tapes
International Nuclear Information System (INIS)
Noji, H.
2011-01-01
I calculate AC properties in YBCO cable by an electric circuit model. The optimal helical pitches are determined by the calculation. The layer's current distribution is uniform on the optimal helical pitches. The calculation is useful as a first approximation of AC losses. AC losses in multilayer power transmission cables can be reduced by adjusting the helical winding pitch of each layer to make the layer's current distribution uniform. The optimum helical pitch can be estimated using an electric circuit (EC) model based on the expression that calculates the losses in the superconducting tapes composing the cable. It is known that the losses in a monolayer cable depend on the cable parameters (i.e., the gap between neighboring tapes, number of tapes N, diameter of the cable former and width of the tape). However, regarding Amemiya et al.'s measurement on the losses in monolayer cables, the numerical results of the losses calculated using the Norris formula for an isolated thin strip N times are close to the experimental results. Then, to determine the losses in a three-layer cable that Mukoyama et al. have reported, the losses are calculated by the EC model based on the Norris formula. The helical pitch of each layer is adjusted to make the layer's current distribution uniform in the cable reported by Mukoyama et al. The optimum helical pitches are calculated using the condition where the standard deviation of the layer currents is minimum, and the losses of the cable at the optimum helical pitches are calculated at 1 kA rms . By comparing the results of these calculations with the previously measured results, it was found that the mean error of the calculated values relative to the measured values is 23.7%, which indicates that the calculation using the EC model is useful as a first approximation.
A new DC/AC boost transformerless converter in application of photovoltaic power generation
DEFF Research Database (Denmark)
Wei, Mo; Loh, Poh Chiang; Blaabjerg, Frede
2011-01-01
This paper presents a new DC/AC boost transformerless converter in the applications of photovoltaic (PV) power generation. A new circuit topology of single phase full bridge power inverter with additional DC/DC boost stage is proposed. The proposed topology overcomes two commonly existing......, and then converts the DC into AC to supply the load. A special modulation technique is proposed to eliminate the leakage current which is commonly presents in PV transformerless power generation, helps to increase the system efficiency and output performance....
Revealing origin of quasi-one dimensional current transport in defect rich two dimensional materials
International Nuclear Information System (INIS)
Lotz, Mikkel R.; Boll, Mads; Bøggild, Peter; Petersen, Dirch H.; Hansen, Ole; Kjær, Daniel
2014-01-01
The presence of defects in graphene have for a long time been recognized as a bottleneck for its utilization in electronic and mechanical devices. We recently showed that micro four-point probes may be used to evaluate if a graphene film is truly 2D or if defects in proximity of the probe will lead to a non-uniform current flow characteristic of lower dimensionality. In this work, simulations based on a finite element method together with a Monte Carlo approach are used to establish the transition from 2D to quasi-1D current transport, when applying a micro four-point probe to measure on 2D conductors with an increasing amount of line-shaped defects. Clear 2D and 1D signatures are observed at low and high defect densities, respectively, and current density plots reveal the presence of current channels or branches in defect configurations yielding 1D current transport. A strong correlation is found between the density filling factor and the simulation yield, the fraction of cases with 1D transport and the mean sheet conductance. The upper transition limit is shown to agree with the percolation threshold for sticks. Finally, the conductance of a square sample evaluated with macroscopic edge contacts is compared to the micro four-point probe conductance measurements and we find that the micro four-point probe tends to measure a slightly higher conductance in samples containing defects
Magnetic Particle inspection by DC and AC magnetization current
International Nuclear Information System (INIS)
Lim, Zhong Soo; Kim, Goo Hwa
1996-01-01
Dry magnetic particle inspection was performed to detect the surface defects of the steel billets. The detectability was evaluated according to magnetizing current, temperature, and amount of the magnetic particles on material. We selected a certain set of steel compositions for target materials. Their magnetic properties are measured with B-H hysteresis graph. Results of the magnetic particle inspection(MPI) by direct magnetizing current was compared with results of the finite element method calculations, which were verified by measurement of the magnetic leakage flux above the surface of material. For square rod materials, the magnetic flux density at the corner was about 30% of that at the face center with sufficiently large direct magnetizing current, while it is about 70% with alternating magnetizing current. Alternating magnetizing current generates rather uniform magnetic flux density running from the center to the corner except for the region of about 10 mm extending from the corner.
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
The complex ac susceptibility of superconducting Y-Ba-CuO thin film and bulk samples
International Nuclear Information System (INIS)
Lobotka, P.; Goemoery, F.
1988-01-01
Complex ac susceptibility measurements as function of temperature on Y-Ba-CuO superconductors are reported. A strong dependence of the susceptibility curves on the ac field magnitude and little influence of the superimposed dc field are observed on both, thin film and bulk samples. The susceptibilities of these materials are frequency independent in the range 30 to 7200 Hz what demonstrates the negligible role of eddy currents. A second peak in the imaginary part of susceptibility is observed in the bulk sample at higher levels of ac field. This implies the existence of another component in the sample with higher T c and lower losses. (author)
International Nuclear Information System (INIS)
Hazarika, J.; Kumar, A.
2014-01-01
In this paper, we report the 160 MeV Ni 12+ swift heavy ions (SHIs) irradiation effects on AC conductivity and dielectric relaxation properties of polypyrrole (PPy) nanoparticles in the frequency range of 42 Hz–5 MHz. Four ion fluences of 5 × 10 10 , 1 × 10 11 , 5 × 10 11 and 1 × 10 12 ions/cm 2 have been used for the irradiation purpose. Transport properties in the pristine and irradiated PPy nanoparticles have been investigated with permittivity and modulus formalisms to study the polarization effects and conductivity relaxation. With increasing ion fluence, the relaxation peak in imaginary modulus (M ″ ) plots shifts toward high frequency suggesting long range motion of the charge carriers. The AC conductivity studies suggest correlated barrier hopping as the dominant transport mechanism. The hopping distance (R ω ) of the charge carriers decreases with increasing the ion fluence. Binding energy (W m ) calculations depict that polarons are the dominant charge carriers
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
DEFF Research Database (Denmark)
Yang, Ling; Chen, Yandong; Luo, An
2017-01-01
With the increasing of AC loads injected into DC microgird (MG) through the inverters, the second ripple current (SRC) in the front-end energy storage converter (ESC) and circulating current among the ESCs in DC MG become more and more serious. In this paper, the SRC suppression method by introdu......With the increasing of AC loads injected into DC microgird (MG) through the inverters, the second ripple current (SRC) in the front-end energy storage converter (ESC) and circulating current among the ESCs in DC MG become more and more serious. In this paper, the SRC suppression method...
Current structure and volume transport across 12 degrees N in the Bay of Bengal
Digital Repository Service at National Institute of Oceanography (India)
Murty, V.S.N.; Suryanarayana, A.; Rao, D.P.
of India from April to September. Current structure in November is similar to that in September with a shift in the current bands. Transport in the upper 1000 m between the stations exhibits a reversal west of 83 degrees E from April to September and east...
Development of Nb3Sn AC superconducting wire. Pt. 2
International Nuclear Information System (INIS)
Kasahara, Hobun; Torii, Shinji; Akita, Shirabe; Ueda, Kiyotaka; Kubota, Yoji; Yasohama, Kazuhiko; Kobayashi, Hisayasu; Ogasawara, Takeshi.
1993-01-01
For the realization of superconducting power apparatus, it is important that the development of highly stable superconducting cables. Nb 3 Sn wire has higher critical temperature than NbTi wire. Therefore, it is possible to make highly stable superconducting wires. In this report, we examine a manufacturing process of Ac Nb 3 Sn wire. This manufacturing process has four times higher critical current density than conventional processes. We have made a 400 kVA class AC coil with React and Wind method. The loss density of this coil was 20MW/m 3 at just before the quench. In this case, the temperature of cable increased about 3.8 K. This means that the Nb 3 Sn coil has a very high stability. (author)
Entrainment, transport and deposition of sediment by saline gravity currents
Zordan, Jessica; Juez, Carmelo; Schleiss, Anton J.; Franca, Mário J.
2018-05-01
Few studies have addressed simultaneously the feedback between the hydrodynamics of a gravity current and the geomorphological changes of a mobile bed. Hydrodynamic quantities such as turbulent and mean velocities, bed shear stress and turbulent stresses undoubtedly govern the processes of entrainment, transport and deposition. On the other hand, the incorporation of entrained sediment in the current may change its momentum by introducing extra internal stresses, introducing thus a feedback process. These two main questions are here investigated. Laboratory experiments of saline gravity currents, produced by lock-exchange, flowing over a mobile bed channel reach, are here reported. Different initial buoyancies of the current in the lock are tested together with three different grain sizes of the non-coherent sediment that form the erodible bed. Results from velocity measurements are combined with the visualization of the sediment movement in the mobile reach and with post-test topographic and photo surveys of the geomorphology modifications of the channel bed. Mean and turbulent velocities are measured and bed shear stress and Reynolds stresses are estimated. We show that the mean vertical component of the velocity and bed shear stress are highly correlated with the first instants of sediment entrainment. Vertical turbulent velocity is similarly related to entrainment, although with lower correlation values, contributing as well to the sediment movement. Bed shear stress and Reynolds shear stress measured near the bed are correlated with sediment entrainment for longer periods, indicating that these quantities are associated to distal transport as well. Geomorphological changes in the mobile bed are strongly related to the impulse caused by the bed shear stress on the sediment. On the other hand, we show that the nature of the grain of the mobile bed reach influences the hydrodynamics of the current which means that a feedback mechanisms between both occurs during
Ebisawa, Tomoko; Nakajima, Atsushi; Haida, Haruka; Wakita, Ryo; Ando, Shizuka; Yoshioka, Tomohiko; Ikoma, Toshiyuki; Tanaka, Junzo; Fukayama, Haruhisa
2014-06-27
Iontophoresis (IOP) is a noninvasive method of delivering medication transcutaneously through the skin. The electrodes used in this method should tightly fit to rough and irregular surfaces and be biologically safe, easy to handle and prepare, and cost-effective. To satisfy these requirements, calcium alginate gel can be a candidate electrode for IOP. Using calcium alginate gel electrodes, we examined whether lidocaine can be effectively transported across an excised rat skin by squarewave alternating current (AC) application. A squarewave AC with either a 70% or 80% duty cycle was continuously applied to 0.5% calcium alginate gel electrodes containing 10% lidocaine at 10 V and 1 kHz for 60 min. Lidocaine concentration was measured using a spectrophotometer and the temperature of the gel was determined. The lidocaine concentrations for AC-IOP at the 70% and 80% duty cycles were significantly higher than that without AC-IOP. Furthermore, the group with the 80% duty cycle showed higher lidocaine concentrations than the group with the 70% duty cycle. The temperatures of all the groups were lower than 28 °C throughout the procedure. In conclusion, the calcium alginate gel can be used as a possible matrix for IOP electrodes.
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
DEFF Research Database (Denmark)
Bifaretti, Steffano; Zanchetta, Pericle; Iov, Florin
2008-01-01
The paper proposes a novel power conversion system for Universal and Flexible Power Management (UNIFLEX-PM) in Future Electricity Network. Its structure is based on a back-to-back three-phase AC-DC 7-level converter; each AC side is connected to a different PCC, representing the main grid and....../or various distributed generation systems. Effective and accurate power flow control is demonstrated through simulation in Matlab- Simulink environment on a model based on a two-port structure and using a Predictive Control technique. Control of different Power flow profiles has been successfully tested...
Equivalence of Primary Control Strategies for AC and DC Microgrids
Directory of Open Access Journals (Sweden)
Eneko Unamuno
2017-01-01
Full Text Available Microgrid frequency and voltage regulation is a challenging task, as classical generators with rotational inertia are usually replaced by converter-interfaced systems that inherently do not provide any inertial response. The aim of this paper is to analyse and compare autonomous primary control techniques for alternating current (AC and direct current (DC microgrids that improve this transient behaviour. In this context, a virtual synchronous machine (VSM technique is investigated for AC microgrids, and its behaviour for different values of emulated inertia and droop slopes is tested. Regarding DC microgrids, a virtual-impedance-based algorithm inspired by the operation concept of VSMs is proposed. The results demonstrate that the proposed strategy can be configured to have an analogous behaviour to VSM techniques by varying the control parameters of the integrated virtual-impedances. This means that the steady-state and transient behaviour of converters employing these strategies can be configured independently. As shown in the simulations, this is an interesting feature that could be, for instance, employed for the integration of different dynamic generation or storage systems, such as batteries or supercapacitors.
Ac hopping conduction at extreme disorder takes place on the percolating cluster
DEFF Research Database (Denmark)
Schrøder, Thomas; Dyre, J. C.
2008-01-01
Simulations of the random barrier model show that ac currents at extreme disorder are carried almost entirely by the percolating cluster slightly above threshold; thus contributions from isolated low activation-energy clusters are negligible. The effective medium approximation in conjunction...
DEFF Research Database (Denmark)
Lotz, Mikkel Rønne; Boll, Mads; Østerberg, Frederik Westergaard
2016-01-01
-configurations depends on the dimensionality of the current transport (i.e., one- or two-dimensional). At low grain density or low grain boundary resistivity, two-dimensional transport is observed. In contrast, at moderate grain density and high grain resistivity, one-dimensional transport is seen. Ultimately...
Flame spread over inclined electrical wires with AC electric fields
Lim, Seung J.
2017-07-21
Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field applied, the flame spread rate and the flame width of downwardly spreading flames (DSFs) decreased from the horizontal case for −20° ≤ θ < 0° and maintained near constant values for −90° ≤ θ < −20°, while the flame spread rate increased appreciably as the inclination angle of upwardly spreading flames (USFs) increased. When an AC electric field was applied, the behavior of flame spread rate in DSFs (USFs) could be classified into two (three) sub-regimes characterized by various functional dependences on VAC, fAC, and θ. In nearly all cases of DSFs, a globular molten polyethylene formed ahead of the spreading flame edge, occasionally dripping onto the ground. In these cases, an effective flame spread rate was defined to represent the burning rate by measuring the mass loss due to dripping. This effective spread rate was independent of AC frequency, while it decreased linearly with voltage and was independent of the inclination angle. In DSFs, when excessively high voltage and frequency were applied, the dripping led to flame extinction during propagation and the extinction frequency correlated well with applied voltage. In USFs, when high voltage and frequency were applied, multiple globular molten PEs formed at several locations, leading to ejections of multiple small flame segments from the main flame, thereby reducing the flame spread rate, which could be attributed to the electrospray phenomenon.
Circumpolar Deep Water transport and current structure at the Amundsen Sea shelf break
Assmann, Karen M.; Wåhlin, Anna K.; Heywood, Karen J.; Jenkins, Adrian; Kim, Tae Wan; Lee, Sang Hoon
2017-04-01
The West Antarctic Ice Sheet has been losing mass at an increasing rate over the past decades. Ocean heat transport to the ice-ocean interface has been identified as an important contributor to this mass loss and the role it plays in ice sheet stability makes it crucial to understand its drivers in order to make accurate future projections of global sea level. While processes closer to the ice-ocean interface modulate this heat transport, its ultimate source is located in the deep basin off the continental shelf as a core of relatively warm, salty water underlying a colder, fresher shallow surface layer. To reach the marine terminating glaciers and the base of floating ice shelves, this warm, salty water mass must cross the bathymetric obstacle of the shelf break. Glacial troughs that intersect the Amundsen shelf break and deepen southwards towards the ice shelf fronts have been shown to play an important role in transporting warm, salty Circumpolar Deep Water (CDW) towards the ice shelves. North of the shelf break, circulation in the Amundsen Sea occupies an intermediate regime between the eastward Antarctic Circumpolar Current that impinges on the shelf break in the Bellingshausen Sea and the westward southern limb of the Ross Gyre that follows the shelf break in the Ross Sea. Hydrographic and mooring observations and numerical model results at the mouth of the central shelf break trough leading to Pine Island and Thwaites Glaciers show a westward wind-driven shelf break current overlying an eastward undercurrent that turns onto the shelf in the trough. It is thought that the existence of the latter feature facilitates the on-shelf transport of CDW. A less clearly defined shelf break depression further west acts as the main pathway for CDW to Dotson and eastern Getz Ice shelves. Model results indicate that a similar eastward undercurrent exists here driving the on-shelf transport of CDW. Two moorings on the upper slope east of the trough entrance show a
Makowski, Jessica; Chambers, Don; Bonin, Jennifer
2013-04-01
Previous studies have suggested that ocean bottom pressure (OBP) can be used to measure the transport variability of the Antarctic Circumpolar Current (ACC). The OBP observations from the Gravity Recovery and Climate Experiment (GRACE) will be used to calculate transport along the 150°E longitude choke point, between Antarctica and Australia. We will examine whether zonally averaged wind stress, wind stress curl, or local zonal winds are more coherent with zonal mass transport variability. Preliminary studies suggest that seasonal variation in transport across 150°E is more correlated with winds along and north of the northern front of the ACC: the Sub Tropical front (STF). It also appears that interannual variations in transport along 150°E are related to wind variations south of the STF and centered south of the Sub Antarctic Front (SAF). We have observed a strong anti-correlation across the SAF, in the Indian Ocean, which suggests wind stress curl may also be responsible for transport variations. Preliminary results will be presented.
Current status of radiation transport tools for proliferation and terrorism prevention
International Nuclear Information System (INIS)
Sale, K.E.
2004-01-01
We present the current status and future plans for the set of calculational tools and data bases developed and maintained at LLNL. The calculational tools include the Monte Carlo codes TART and COG as well as the deterministic code ARDRA. In addition to these codes presently in use there is a major development effort for a new massively parallel transport code. An important part of the capability we're developing is a sophisticated user interface, based on a commercial 3-D modeling product, to improve the model development process. A major part of this user interface tool is being developed by Strela under the Nuclear Cities Initiative. Strela has developed a hub-and-spoke technology for code input interconversions (between COG, TART and MCNP) and will produce the plug-ins that extend the capabilities of the 3-D modeler for use as a radiation transport input generator. The major advantages of this approach are the built-in user interface for 3-D modeling and the ability to read a large variety of CAD-file formats. In addition to supporting our current radiation transport codes and developing new capabilities we are working on some nuclear data needs for homeland security. These projects are carried out and the Lawrence Berkeley National Laboratory 88' cyclotron and at the Institute for Nuclear Research of the Nation Academy of Science of Ukraine under and STCU contract. (author)
DEFF Research Database (Denmark)
Denisov, S.; Flach, S.; Ovchinnikov, A. A.
2002-01-01
We consider low-dimensional dynamical systems exposed to a heat bath and to additional ac fields. The presence of these ac fields may lead to a breaking of certain spatial or temporal symmetries, which in turn cause nonzero averages of relevant observables. Nonlinear (non)adiabatic response is em...... is employed to explain the effect. We consider a case of a particle in a periodic potential as an example and discuss the relevant symmetry breakings and the mechanisms of rectification of the current in such a system.......We consider low-dimensional dynamical systems exposed to a heat bath and to additional ac fields. The presence of these ac fields may lead to a breaking of certain spatial or temporal symmetries, which in turn cause nonzero averages of relevant observables. Nonlinear (non)adiabatic response...
Directory of Open Access Journals (Sweden)
Kathryn Kuivila
2008-10-01
Full Text Available The occurrence and potential effects of current-use pesticides are of concern in the San Francisco Estuary watershed but our understanding of the spatial and temporal distribution of contamination is limited. This paper summarizes almost two decades of historical data and uses it to describe our current knowledge of the processes controlling the occurrence of current-use pesticides in the watershed. Monitoring studies analyze fewer than half of the pesticides applied in the watershed and most of our knowledge is about inputs of dissolved pesticides in the upper watershed. The four major seasonal patterns of riverine inputs of pesticides to the estuary can be identified by usage and transport mechanism. Dormant spray insecticides applied to orchards and herbicides applied to a variety of crops are transported by rainfall during the winter. Alfalfa pesticides are detected following rainfall and irrigation return flow in the spring, and rice pesticides are detected following release of rice field water in the summer. Irrigation return flows transport a variety of herbicides during the summer. In addition, pesticides applied on Delta islands can cause elevated pesticide concentrations in localized areas. Although not as well characterized, urban creeks appear to have their own patterns of insecticide concentrations causing toxicity throughout most of the year. Current-use pesticides have also been detected on suspended and bed sediments throughout the watershed but limited data make it difficult to determine occurrence patterns. Data gaps include the lack of analysis of many pesticides (or degradates, changing pesticide use, limited information on pesticide transport within the Delta, and an incomplete understanding of the transport and persistence of sediment-associated pesticides. Future monitoring programs should be designed to address these data gaps.
Directory of Open Access Journals (Sweden)
Damianus Kans Pangaraya
2015-09-01
Full Text Available The conventional asphalt road has almost been considered fail to serve the transportation needs. It is indicated by the occurrence of premature damage which is caused by vehicle load and climate. Starbit E-55, the polymer modified bitumen, is formulated to meet the requirement of transport development. Considering those needs, it is important to investigate the feasibility level of that modified bitumen as alternate asphalt instead of the conventional one. This research began with the measurement of the properties of hard layered AC-WC Starbit E-55, then comparing the result to 60/70 penetration of Pertamina asphalt. The next step is then, to determine the converted value so as to be close to that of Pertamina (60/70 penetration. This step is conducted by applying durability and ITS tests on the mixture. Result of the tests showed that hard layered AC-WC Starbit E-55 has better characteristic at 5.7% optimum level asphalt and 6.4% of Pertamina asphalt (60/70 penetration. Starbit E-55 converted level within hard-layered ACWC is 5.6%. The performance test result on immersion with variance of 1, 3, 5, 7 and 14 days shows that durability value of Starbit E-55 AC-WC has better performance. During the process, Starbit E-55 required 15.38% higher energy consumption.
Structural, magnetic and electrical transport properties in cold-drawn thin Fe-rich wires
International Nuclear Information System (INIS)
Garcia, C.; Chizhik, A.; Val, J.J. del; Zhukov, A.; Blanco, J.M.; Gonzalez, J.
2005-01-01
Microstructural (X-ray diffraction), magnetic properties (hysteresis loop), electrical resistivity, magneto-impedance and stress impedance effects have been investigated in cold-drawn Fe 77.5 B 15 Si 7.5 amorphous wire. Initial amorphous wire (obtained by the in-rotating-water technique) with diameter of 125 μm was submitted to cold-drawn process decreasing the diameter to 50 μm. Such cold-drawn wire was treated by current annealing (currents of 190, 210, 220 and 230 mA during times between 1 and 45 min) for tailoring the magnetic and electrical transport properties. A qualitative analysis of the magnetoimpedance and stress impedance effects is given by considering the influence of the magnetoelastic anisotropy and frequency of the AC driving electrical current on the circular permeability
Influence of a transport current on the local magnetic field distribution in sintered YBa2Cu3Ox
International Nuclear Information System (INIS)
Zimmermann, P.; Keller, H.; Kuendig, W.; Puempin, B.; Savic, I.M.; Schneider, J.W.; Simmler, H.; Kaldis, E.; Rusiecki, S.
1991-01-01
The influence of a transport current on the magnetic flux-line distribution in sintered YBCO was studied by means of μSR. Pronounced differences between zero-field-cooled (ZFC) and field-cooled (FC) signals and irreversible behavior were observed. In the ZFC case even a small transport current (10 A/cm 2 ) tends to order irreversibly the inhomogeneous flux-line distribution considerably, suggesting a broad distribution of pinning barriers. However, for a FC sample no noticeable change in the flux distribution in the presence of a transport current (up to 40 A/cm 2 ) was detected, indicating that the FC state represents a stable flux-line configuration. (orig.)
AC losses for the various voltage-leads in a semi-triple layer BSCCO conductor
International Nuclear Information System (INIS)
Li, Z.; Ryu, K.; Hwang, S.D.; Cha, G.; Song, H.J.
2011-01-01
Two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer. Voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The loss from the total-lead significantly differs from the sum of the wire losses. In order to investigate the AC loss of the multilayer conductor in a high temperature superconductor cable, a voltage-lead was generally attached to the outermost layer of the conductor. But the conductor's AC loss has not been completely cleared due to the various contact positions and arrangements of the voltage-lead. In this paper, we prepared a semi-triple layer conductor consisting of an inner layer and an outer layer with double layer structure. To measure the AC loss of the conductor, two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer and arranged along their surfaces, as well as another voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The results show that the AC losses for each layer measured from the inner-lead and the outer-lead, respectively, are identical to the sum of the wire losses. The AC losses in the semi-triple layer conductor measured from the total-lead and the outer-lead are identical for the uniform layer current density, and similar to the sum of the wire losses in both layers. However, the losses measured for the non-uniform layer current density from three voltage-leads are unequal to each other, and the loss from the total-lead significantly differs from the sum of the wire losses.
Method to predetermine current/power flow change in a dc grid
DEFF Research Database (Denmark)
2017-01-01
occurs at one of the AC/DC converters; establishing a generalized droop feedback gain matrix G; controlling current/power flow within DC grid towards predefined setpoints, by use of control law. The invention presents an analytical approach to derive the generalized feedback gain allowing......The invention relates to a method for controlling current/power flow within a power transmission system, comprising two or more interconnected converter stations. The method comprises the steps of: providing a DC admittance matrix given from the DC grid; providing a current distribution matrix...... for a number of, such as for all possible AC/DC converter outages; providing a DC bus voltage vector for the DC grid; the DC bus voltage vector being a vector containing the values of the voltage change at the AC/DC converters, measured at the AC/DC converters, before, during and after a forced current change...
Fast-ion transport and neutral beam current drive in ASDEX upgrade
DEFF Research Database (Denmark)
Geiger, B.; Weiland, M.; Jacobsen, Asger Schou
2015-01-01
The neutral beam current drive efficiency has been investigated in the ASDEX Upgrade tokamak by replacing on-axis neutral beams with tangential off-axis beams. A clear modification of the radial fast-ion profiles is observed with a fast-ion D-alpha diagnostic that measures centrally peaked profiles...... during on-axis injection and outwards shifted profiles during off-axis injection. Due to this change of the fast-ion population, a clear modification of the plasma current profile is predicted but not observed by a motional Stark effect diagnostic. The fast-ion transport caused by MHD activity has been...
Summary of the working group on high current transport and final focus lenses
International Nuclear Information System (INIS)
Garren, A.A.
1978-09-01
The group reviewed recent work, and then addressed itself to relating the current understanding of relevant beam transport effects to the four reference concepts. In addition there was discussion on plans for future experimental and theoretical work. Discussions covered the following topics: (1) Transverse instabilities on intense beams through periodic focusing systems, (2) evaluation and correction of chromatic aberrations in the final beam transport lines, (3) evaluation and correction of geometric aberrations due to quadrupole fringe fields, and (4) ion focusing by electrons
Ripple Field AC Losses in 10-MW Wind Turbine Generators With a MgB2 Superconducting Field Winding
DEFF Research Database (Denmark)
Liu, Dong; Polinder, Henk; Magnusson, Niklas
2016-01-01
Superconducting (SC) synchronous generators are proposed as a promising candidate for 10-20-MW direct-drive wind turbines because they can have low weights and small sizes. A common way of designing an SC machine is to use SC wires with high current-carrying capability in the dc field winding...... and the ac armature winding is made with copper conductors. In such generators, the dc field winding is exposed to ac magnetic field ripples due to space harmonics from the armature. In generator design phases, the ac loss caused by these ripple fields needs to be evaluated to avoid local overheating...... and an excessive cooling budget. To determine the applicability of different design solutions in terms of ac losses, this paper estimates the ac loss level of 10-MW wind generator designs employing a MgB2 SC field winding. The effects on ac losses are compared between nonmagnetic and ferromagnetic teeth...
International Nuclear Information System (INIS)
Anon.
2002-01-01
During September and October 2001, 1 event has been reported and classified at the first level of the INES scale. This incident concerns the violation of the European regulation that imposes to any driver of radioactive matter of being the holder of a certificate asserting that he attended a special training. During this period, 13 in-site inspections have been made in places related to nuclear transport. (A.C.)
Current status of quantum electrical metrology
International Nuclear Information System (INIS)
Urano, Chiharu; Kaneko, Nobuhisa; Kiryu, Shogo
2005-01-01
Physical background, current status of proof systems and researches of the next generation standards of Josephson voltage and Quantized Hall Resistance (QHR) standard system are described. Josephson effect, the principle and theory of quantized hall effect, usual voltage standard system, standard feed of direct current resistance, and researches of voltage standard and direct current resistance standard are explained. The current-voltage of Josephson element in the usual voltage standard proof system and bias method, outline of typical Josephson voltage standard proof system and GaAs/AlGaAs heterostructure used as resistance standard are stated. Cryogenic Current Comparator (CCC) and Direct Current Comparator (DCC) proofread usual resistor. New Quantum Hall Array Resistance Standard (QHARS) is studied by BNM-LNE group in French, and the other new AC Quantized Hall Resistance (AC-QHR) by the European ACQHE Project. (S.Y.)
International Nuclear Information System (INIS)
Ke Jianhao; Wang Jinwen; Deng Riqiang; Wang Xunzhang
2008-01-01
Although orf66 (ac66) of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is conserved in all sequenced lepidopteran baculovirus genomes, its function is not known. This paper describes generation of an ac66 knockout AcMNPV bacmid mutant and analyses of the influence of ac66 deletion on the virus replication in Sf-9 cells so as to determine the role of ac66 in the viral life cycle. Results indicated that budded virus (BV) yields were reduced over 99% in ac66-null mutant infected cells in comparison to that in wild-type virus infected cells. Optical microscopy revealed that occlusion body synthesis was significantly reduced in the ac66 knockout bacmid-transfected cells. In addition, ac66 deletion interrupted preoccluded virion synthesis. The mutant phenotype was rescued by an ac66 repair bacmid. On the other hand, real-time PCR analysis indicated that ac66 deletion did not affect the levels of viral DNA replication. Electron microscopy revealed that ac66 is not essential for nucleocapsid assembly, but for the efficient transport of nucleocapsids from the nucleus to the cytoplasm. These results suggested that ac66 plays an important role for the efficient exit of nucleocapsids from the nucleus to the cytoplasm for BV synthesis as well as for preoccluded virion and occlusion synthesis
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
Current transport mechanism in graphene/AlGaN/GaN heterostructures with various Al mole fractions
Directory of Open Access Journals (Sweden)
Bhishma Pandit
2016-06-01
Full Text Available The current transport mechanism of graphene formed on AlxGa1−xN/GaN heterostructures with various Al mole fractions (x = 0.15, 0.20, 0.30, and 0.40 is investigated. The current–voltage measurement from graphene to AlGaN/GaN shows an excellent rectifying property. The extracted Schottky barrier height of the graphene/AlGaN/GaN contacts increases with the Al mole fraction in AlGaN. However, the current transport mechanism deviates from the Schottky-Mott theory owing to the deterioration of AlGaN crystal quality at high Al mole fractions confirmed by reverse leakage current measurement.
Development of magneto-rheologial fluid (MRF) based clutch for output torque control of AC motors
Nguyen, Q. Hung; Do, H. M. Hieu; Nguyen, V. Quoc; Nguyen, N. Diep; Le, D. Thang
2018-03-01
In industry, the AC motor is widely used because of low price, power availability, low cost maintenance. The main disadvantages of AC motors compared to DC motors are difficulty in speed and torque control, requiring expensive controllers with complex control algorithms. This is the basic limitations in the widespread adoption of AC motor systems for industrial automation. One feasible solution for AC motor control is using MRF (magneto-rheological fluid) based clutches (shortly called MR clutches) Although there have been many studies on MR clutches, most of these clutches used traditional configuration with coils wound on the middle cylindrical part and a compotator is used to supply power to the coils. Therefore, this type of MR clutches possesses many disadvantages such as high friction and unstable applied current due to commutator, complex structure which causes difficulty in manufacture, assembly, and maintenance. In addition, the bottleneck problem of magnetic field is also a challenging issue. In this research, we will develop a new type of MR clutches that overcomes the abovementioned disadvantages of traditional MR clutches and more suitable for application in controlling of AC motor. Besides, in this study, speed and torque control system for AC motors using developed MR clutches is designed and experimental validated.
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
International Nuclear Information System (INIS)
Peters, M.
1996-01-01
In the first experiment the plasma current in the RTP tokamak is varied. Here the underlying idea was to check whether at a low plasma current, transport in the tokamak resembles transport in stellarators more than at higher currents. Secondly, experiments have been done to study the relation of the diffusivity χ to the temperature and its gradient in both W7-AS and RTP. In this case the underlying idea was to find the explanation for the phenomenon observed in both tokamaks and stellarators that the quality of the confinement degrades when more heating is applied. A possible explanation is that the diffusivity increases with the temperature or its gradient. Whereas in standard tokamak and stellarator experiments the temperature and its gradient are strongly correlated, a special capability of the plasma heating system of W7-AS and RTP can force them to decouple. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Peters, M
1996-01-16
In the first experiment the plasma current in the RTP tokamak is varied. Here the underlying idea was to check whether at a low plasma current, transport in the tokamak resembles transport in stellarators more than at higher currents. Secondly, experiments have been done to study the relation of the diffusivity {chi} to the temperature and its gradient in both W7-AS and RTP. In this case the underlying idea was to find the explanation for the phenomenon observed in both tokamaks and stellarators that the quality of the confinement degrades when more heating is applied. A possible explanation is that the diffusivity increases with the temperature or its gradient. Whereas in standard tokamak and stellarator experiments the temperature and its gradient are strongly correlated, a special capability of the plasma heating system of W7-AS and RTP can force them to decouple. (orig.).
Makowski, J.; Chambers, D. P.; Bonin, J. A.
2012-12-01
Previous studies have suggested that ocean bottom pressure (OBP) can be used to measure the transport variability of the Antarctic Circumpolar Current (ACC). Using OBP data from the JPL ECCO model and the Gravity Recovery and Climate Experiment (GRACE), we examine the zonal transport variability of the ACC integrated between the major fronts between 2003-2010. The JPL ECCO data are used to determine average front positions for the time period studies, as well as where transport is mainly zonal. Statistical analysis will be conducted to determine the uncertainty of the GRACE observations using a simulated data set. We will also begin looking at low frequency changes and how coherent transport variability is from region to region of the ACC. Correlations with bottom pressure south of the ACC and the average basin transports will also be calculated to determine the probability of using bottom pressure south of the ACC as a means for describing the ACC dynamics and transport.
AC electric field induced vortex in laminar coflow diffusion flames
Xiong, Yuan
2014-09-22
Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.
AC electric field induced vortex in laminar coflow diffusion flames
Xiong, Yuan; Cha, Min; Chung, Suk-Ho
2014-01-01
Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.
Analytical solution of the PNP equations at AC applied voltage
International Nuclear Information System (INIS)
Golovnev, Anatoly; Trimper, Steffen
2012-01-01
A symmetric binary polymer electrolyte subjected to an AC voltage is considered. The analytical solution of the Poisson–Nernst–Planck equations (PNP) is found and analyzed for small applied voltages. Three distinct time regimes offering different behavior can be discriminated. The experimentally realized stationary behavior is discussed in detail. An expression for the external current is derived. Based on the theoretical result a simple method is suggested of measuring the ion mobility and their concentration separately. -- Highlights: ► Analytical solution of Poisson–Nernst–Planck equations. ► Binary polymer electrolyte subjected to an external AC voltage. ► Three well separated time scales exhibiting different behavior. ► The experimentally realized stationary behavior is discussed in detail. ► A method is proposed measuring the mobility and the concentration separately.
Design and implementation of co-operative control strategy for hybrid AC/DC microgrids
Mahmud, Rasel
This thesis is mainly divided in two major sections: 1) Modeling and control of AC microgrid, DC microgrid, Hybrid AC/DC microgrid using distributed co-operative control, and 2) Development of a four bus laboratory prototype of an AC microgrid system. At first, a distributed cooperative control (DCC) for a DC microgrid considering the state-of-charge (SoC) of the batteries in a typical plug-in-electric-vehicle (PEV) is developed. In DC microgrids, this methodology is developed to assist the load sharing amongst the distributed generation units (DGs), according to their ratings with improved voltage regulation. Subsequently, a DCC based control algorithm for AC microgrid is also investigated to improve the performance of AC microgrid in terms of power sharing among the DGs, voltage regulation and frequency deviation. The results validate the advantages of the proposed methodology as compared to traditional droop control of AC microgrid. The DCC-based control methodology for AC microgrid and DC microgrid are further expanded to develop a DCC-based power management algorithm for hybrid AC/DC microgrid. The developed algorithm for hybrid microgrid controls the power flow through the interfacing converter (IC) between the AC and DC microgrids. This will facilitate the power sharing between the DGs according to their power ratings. Moreover, it enables the fixed scheduled power delivery at different operating conditions, while maintaining good voltage regulation and improved frequency profile. The second section provides a detailed explanation and step-by-step design and development of an AC/DC microgrid testbed. Controllers for the three-phase inverters are designed and tested on different generation units along with their corresponding inductor-capacitor-inductor (LCL) filters to eliminate the switching frequency harmonics. Electric power distribution line models are developed to form the microgrid network topology. Voltage and current sensors are placed in the proper
Apparatuses and method for converting electromagnetic radiation to direct current
Kotter, Dale K; Novack, Steven D
2014-09-30
An energy conversion device may include a first antenna and a second antenna configured to generate an AC current responsive to incident radiation, at least one stripline, and a rectifier coupled with the at least one stripline along a length of the at least one stripline. An energy conversion device may also include an array of nanoantennas configured to generate an AC current in response to receiving incident radiation. Each nanoantenna of the array includes a pair of resonant elements, and a shared rectifier operably coupled to the pair of resonant elements, the shared rectifier configured to convert the AC current to a DC current. The energy conversion device may further include a bus structure operably coupled with the array of nanoantennas and configured to receive the DC current from the array of nanoantennas and transmit the DC current away from the array of nanoantennas.
Pastor-Soler, Nuria; Beaulieu, Valerie; Litvin, Tatiana N; Da Silva, Nicolas; Chen, Yanqiu; Brown, Dennis; Buck, Jochen; Levin, Lonny R; Breton, Sylvie
2003-12-05
Modulation of environmental pH is critical for the function of many biological systems. However, the molecular identity of the pH sensor and its interaction with downstream effector proteins remain poorly understood. Using the male reproductive tract as a model system in which luminal acidification is critical for sperm maturation and storage, we now report a novel pathway for pH regulation linking the bicarbonate activated soluble adenylyl cyclase (sAC) to the vacuolar H+ATPase (V-ATPase). Clear cells of the epididymis and vas deferens contain abundant V-ATPase in their apical pole and are responsible for acidifying the lumen. Proton secretion is regulated via active recycling of V-ATPase. Here we demonstrate that this recycling is regulated by luminal pH and bicarbonate. sAC is highly expressed in clear cells, and apical membrane accumulation of V-ATPase is triggered by a sAC-dependent rise in cAMP in response to alkaline luminal pH. As sAC is expressed in other acid/base transporting epithelia, including kidney and choroid plexus, this cAMP-dependent signal transduction pathway may be a widespread mechanism that allows cells to sense and modulate extracellular pH.
Alizadeh Sahraei, Abolfazl; Ayati, Moosa; Baniassadi, Majid; Rodrigue, Denis; Baghani, Mostafa; Abdi, Yaser
2018-03-01
This study attempts to comprehensively investigate the effects of multi-walled carbon nanotubes (MWCNTs) on the AC and DC electrical conductivity of epoxy nanocomposites. The samples (0.2, 0.3, and 0.5 wt. % MWCNT) were produced using a combination of ultrason and shear mixing methods. DC measurements were performed by continuous measurement of the current-voltage response and the results were analyzed via a numerical percolation approach, while for the AC behavior, the frequency response was studied by analyzing phase difference and impedance in the 10 Hz to 0.2 MHz frequency range. The results showed that the dielectric parameters, including relative permittivity, impedance phase, and magnitude, present completely different behaviors for the frequency range and MWCNT weight fractions studied. To better understand the nanocomposites electrical behavior, equivalent electric circuits were also built for both DC and AC modes. The DC equivalent networks were developed based on the current-voltage curves, while the AC equivalent circuits were proposed by using an optimization problem according to the impedance magnitude and phase at different frequencies. The obtained equivalent electrical circuits were found to be highly useful tools to understand the physical mechanisms involved in MWCNT filled polymer nanocomposites.
A study of the variability in the Benguela Current volume transport
Majumder, Sudip; Schmid, Claudia
2018-04-01
The Benguela Current forms the eastern limb of the subtropical gyre in the South Atlantic and transports a blend of relatively fresh and cool Atlantic water and relatively warm and salty Indian Ocean water northwestward. Therefore, it plays an important role not only for the local freshwater and heat budgets but for the overall meridional heat and freshwater transport in the South Atlantic. Historically, the Benguela Current region is relatively data sparse, especially with respect to long-term velocity observations. A new three-dimensional data set of the horizontal velocity in the upper 2000 m that covers the years 1993 to 2015 is used to analyze the variability in the Benguela Current. This data set was derived using observations from Argo floats, satellite sea surface height, and wind fields. Since Argo floats do not cover regions shallower than 1000 m, the data set has gaps inshore. The main features of the horizontal circulation observed in this data set are in good agreement with those from earlier studies based on limited observations. Therefore, it can be used for a more detailed study of the flow pattern as well as the variability in the circulation in this region. It is found that the mean meridional transport in the upper 800 m between the continental shelf of Africa and 3° E, decreases from 23 ± 3 Sv (1 Sv = 106 m3 s-1) at 31° S to 11 ± 3 Sv at 28° S. In terms of variability, the 23-year long time series at 30 and 35° S reveals phases with large energy densities at periods of 3 to 7 months, which can be attributed to the occurrence of Agulhas rings in this region. The prevalence of Agulhas rings is also behind the fact that the energy density at 35° S at the annual period is smaller than at 30° S because the former latitude is closer to Agulhas Retroflection and therefore more likely to be impacted by the Agulhas rings. In agreement with this, the energy density associated with mesoscale variability at 30° S is weaker than at 35° S. With
Jebri, Fatma; Zakardjian, Bruno; Birol, Florence; Bouffard, Jérôme; Jullion, Loïc.; Sammari, Cherif
2017-11-01
A 20 year coastal altimetry data set (X-TRACK) is used, for the first time, to gain insight into the long-term interannual variations of the surface circulation in the Sicily Channel. First, a spectral along with a time/space diagram analysis are applied to the monthly means. They reveal a regionally coherent current patterns from track to track with a marked interannual variability that is unequally shared between the Atlantic Tunisian Current and Atlantic Ionian Stream inflows in the Sicily Channel and the Bifurcation Tyrrhenian Current outflow northeast of Sicily. Second, an empirical altimetry-based transport-like technique is proposed to quantify volume budgets inside the closed boxes formed by the crossing of the altimetry tracks and coastlines over the study area. A set of hydrographic measurements is used to validate the method. The inferred altimetry transports give a well-balanced mean eastward Atlantic Waters baroclinic flow of 0.4 Sv and standard deviations of 0.2 Sv on a yearly basis throughout the Sicily Channel and toward the Ionian Sea, which is fairly coherent with those found in the literature. Furthermore, the analysis allows to quantify the intrusions of Atlantic Waters over the Tunisian Shelf (0.12 ± 0.1 Sv) and highlights two main modes of variability of the main surface waters path over the Sicily Channel through the Bifurcation Atlantic Tunisian Current and Atlantic Ionian Stream systems. Some physical mechanisms are finally discussed with regards to changes in the observed currents and transports.
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
AC loss in superconducting wires operating in a wind turbine like generator
DEFF Research Database (Denmark)
Seiler, Eugen; Zirngibl, Thomas; Mijatovic, Nenad
2010-01-01
We have manufactured a small circular superconducting coil impregnated with epoxy fibreglass. The coil was wound from a Bi-2223/Ag superconducting wire and it was tested in liquid nitrogen at 77 K. Current-voltage characteristic and the AC losses of the coil were measured and compared...
Fluid Flow and Mixing Induced by AC Continuous Electrowetting of Liquid Metal Droplet
Directory of Open Access Journals (Sweden)
Qingming Hu
2017-04-01
Full Text Available In this work, we proposed a novel design of a microfluidic mixer utilizing the amplified Marangoni chaotic advection induced by alternating current (AC continuous electrowetting of a metal droplet situated in electrolyte solution, due to the linear and quadratic voltage-dependence of flow velocity at small or large voltages, respectively. Unlike previous researchers exploiting the unidirectional surface stress with direct current (DC bias at droplet/medium interface for pumping of electrolytes where the resulting flow rate is linearly proportional to the field intensity, dominance of another kind of dipolar flow pattern caused by local Marangoni stress at the drop surface in a sufficiently intense AC electric field is demonstrated by both theoretical analysis and experimental observation, which exhibits a quadratic growth trend as a function of the applied voltage. The dipolar shear stress merely appears at larger voltages and greatly enhances the mixing performance by inducing chaotic advection between the neighboring laminar flow. The mixer design developed herein, on the basis of amplified Marangoni chaotic advection around a liquid metal droplet at larger AC voltages, has great potential for chemical reaction and microelectromechanical systems (MEMS actuator applications because of generating high-throughput and excellent mixing performance at the same time.
Auditory Cortex tACS and tRNS for Tinnitus: Single versus Multiple Sessions
Directory of Open Access Journals (Sweden)
Laura Claes
2014-01-01
Full Text Available Tinnitus is the perception of a sound in the absence of an external acoustic source, which often exerts a significant impact on the quality of life. Currently there is evidence that neuroplastic changes in both neural pathways are involved in the generation and maintaining of tinnitus. Neuromodulation has been suggested to interfere with these neuroplastic alterations. In this study we aimed to compare the effect of two upcoming forms of transcranial electrical neuromodulation: alternating current stimulation (tACS and random noise stimulation (tRNS, both applied on the auditory cortex. A database with 228 patients with chronic tinnitus who underwent noninvasive neuromodulation was retrospectively analyzed. The results of this study show that a single session of tRNS induces a significant suppressive effect on tinnitus loudness and distress, in contrast to tACS. Multiple sessions of tRNS augment the suppressive effect on tinnitus loudness but have no effect on tinnitus distress. In conclusion this preliminary study shows a possibly beneficial effect of tRNS on tinnitus and can be a motivation for future randomized placebo-controlled clinical studies with auditory tRNS for tinnitus. Auditory alpha-modulated tACS does not seem to be contributing to the treatment of tinnitus.
Study of Power Flow Algorithm of AC/DC Distribution System including VSC-MTDC
Directory of Open Access Journals (Sweden)
Haifeng Liang
2015-08-01
Full Text Available In recent years, distributed generation and a large number of sensitive AC and DC loads have been connected to distribution networks, which introduce a series of challenges to distribution network operators (DNOs. In addition, the advantages of DC distribution networks, such as the energy conservation and emission reduction, mean that the voltage source converter based multi-terminal direct current (VSC-MTDC for AC/DC distribution systems demonstrates a great potential, hence drawing growing research interest. In this paper, considering losses of the reactor, the filter and the converter, a mathematical model of VSC-HVDC for the load flow analysis is derived. An AC/DC distribution network architecture has been built, based on which the differences in modified equations of the VSC-MTDC-based network under different control modes are analyzed. In addition, corresponding interface functions under five control modes are provided, and a back/forward iterative algorithm which is applied to power flow calculation of the AC/DC distribution system including VSC-MTDC is proposed. Finally, by calculating the power flow of the modified IEEE14 AC/DC distribution network, the efficiency and validity of the model and algorithm are evaluated. With various distributed generations connected to the network at appropriate locations, power flow results show that network losses and utilization of transmission networks are effectively reduced.
A novel wireless power and data transmission AC to DC converter for an implantable device.
Liu, Jhao-Yan; Tang, Kea-Tiong
2013-01-01
This article presents a novel AC to DC converter implemented by standard CMOS technology, applied for wireless power transmission. This circuit combines the functions of the rectifier and DC to DC converter, rather than using the rectifier to convert AC to DC and then supplying the required voltage with regulator as in the transitional method. This modification can reduce the power consumption and the area of the circuit. This circuit also transfers the loading condition back to the external circuit by the load shift keying(LSK), determining if the input power is not enough or excessive, which increases the efficiency of the total system. The AC to DC converter is fabricated with the TSMC 90nm CMOS process. The circuit area is 0.071mm(2). The circuit can produce a 1V DC voltage with maximum output current of 10mA from an AC input ranging from 1.5V to 2V, at 1MHz to 10MHz.
Effect of dc field on ac-loss peak in a commercial Bi:2223/Ag tape
Öztürk, Ali; Düzgün, İbrahim; Çelebi, Selahattin
2017-12-01
Measurements of the ac susceptibility in a commercial Bi:2223/Ag tape for some different ac magnetic field amplitudes, Hac, in the presence of bias magnetic field Hdc directed along Hac are reported. It is found that the peak values of the imaginary component of ac susceptibility χ″max versus Hac trace a valley for the orientation where applied field Ha perpendicular to wide face of the tape total. We note that the observation of the valley depends on various parameters such as field dependence parameter n in the critical current density, in the simple power law expression jc = α(T)/Bn, choice of the bias field Hdc together with selected ac field amplitudes Hac, and dimension and geometry of sample studied. Our calculations based on critical state model with jc = α(1 - T/Tcm)p/Bn using the fitting parameters of n = 0.25, p = 2.2, Tcm = 108 K gives quite good results to compare the experimental and calculated curves.
Transport of nuclear materials
International Nuclear Information System (INIS)
Anon.
2002-01-01
During november and december 2001, 2 events concerning nuclear transport were reported and classified on the first grade (grade 1) of the INES scale. The first event concerns a hole in a transport cask of contaminated tools. The hole seems to have been made by the fork of a handling equipment. The second event concerns the loss of a parcel containing a technetium generator, this generator represented an activity of about 141 G Becquerel of 99 Mo the day it left the premises of CIS-bio in Saclay. (A.C.)
Hopfinger, Joseph B; Parsons, Jonathan; Fröhlich, Flavio
2017-04-01
Previous electrophysiological studies implicate both alpha (8-12 Hz) and gamma (>30 Hz) neural oscillations in the mechanisms of selective attention. Here, participants preformed two separate visual attention tasks, one endogenous and one exogenous, while transcranial alternating current stimulation (tACS), at 10 Hz, 40 Hz, or sham, was applied to the right parietal lobe. Our results provide new evidence for the roles of gamma and alpha oscillations in voluntary versus involuntary shifts of attention. Gamma (40 Hz) stimulation resulted in improved disengagement from invalidly cued targets in the endogenous attention task, whereas alpha stimulation (10 Hz) had no effect on endogenous attention, but increased the exogenous cuing effect. These findings agree with previous studies suggesting that right inferior parietal regions may be especially important for the disengagement of attention, and go further to provide details about the specific type of oscillatory neural activity within that brain region that is differentially involved in endogenous versus exogenous attention. Our results also have potential implications for the plasticity and training of attention systems.
Implementation and Evaluation of WLAN 802.11ac for Residential Networks in NS-3
Directory of Open Access Journals (Sweden)
Andy Bubune Amewuda
2018-01-01
Full Text Available Wi-Fi has been an amazingly successful technology. Its success may be attributed to the fact that, despite the significant advances made in technology over the last decade, it has remained backward compatible. 802.11ac is the latest version of the wireless LAN (WLAN standard that is currently being adopted, and it promises to deliver very high throughput (VHT, operating at the 5 GHz band. In this paper, we report on an implementation of 802.11ac wireless LAN for residential scenario based on the 802.11ax task group scenario document. We evaluate the 802.11ac protocol performance under different operating conditions. Key features such as modulation coding set (MCS, frame aggregation, and multiple-input multiple-output (MIMO were investigated. We also evaluate the average throughput, delay, jitter, optimum range for goodput, and effect of station (STA density per access point (AP in a network. ns-3, an open source network simulator with features supporting 802.11ac, was used to perform the simulation. Results obtained indicate that very high data rates are achievable. The highest data rate, the best mean delay, and mean jitter are possible under combined features of 802.11ac (MIMO and A-MPDU.
Comparison of high-voltage ac and pulsed operation of a surface dielectric barrier discharge
Williamson, James M.; Trump, Darryl D.; Bletzinger, Peter; Ganguly, Biswa N.
2006-10-01
A surface dielectric barrier discharge (DBD) in atmospheric pressure air was excited either by low frequency (0.3-2 kHz) high-voltage ac or by short, high-voltage pulses at repetition rates from 50 to 600 pulses s-1. The short-pulse excited discharge was more diffuse and did not have the pronounced bright multiple cathode spots observed in the ac excited discharge. The discharge voltage, current and average power deposited into the discharge were calculated for both types of excitation. As a measure of plasma-chemical efficiency, the ozone number density was measured by UV absorption as a function of average deposited power. The density of ozone produced by ac excitation did not increase so rapidly as that produced by short-pulse excitation as a function of average power, with a maximum measured density of ~3 × 1015 cm-3 at 25 W. The maximum ozone production achieved by short-pulse excitation was ~8.5 × 1015 cm-3 at 20 W, which was four times greater than that achieved by ac excitation at the same power level.
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer
Directory of Open Access Journals (Sweden)
Phuc Thinh Doan
2013-06-01
Full Text Available This paper develops a sensorless vector controlled method for AC induction motor using sliding-mode observer. For developing the control algorithm, modeling of AC induction motor is presented. After that, a sliding mode observer is proposed to estimate the motor speed, the rotor flux, the angular position of the rotor flux and the motor torque from monitored stator voltages and currents. The use of the nonlinear sliding mode observer provides very good performance for both low and high speed motor operation. Furthermore, the proposed system is robust in motor losses and load variations. The convergence of the proposed observer is obtained using the Lyapunov theory. Hardware and software for simulation and experiment of the AC induction motor drive are introduced. The hardware consists of a 1.5kw AC induction motor connected in series with a torque sensor and a powder brake. A controller is developed based on DSP TMS320F28355. The simulation and experimental results illustrate that fast torque and speed response with small torque ripples can be achieved. The proposed control scheme is suitable to the application fields that require high performance of torque response such as electric vehicles. doi:http://dx.doi.org/10.12777/ijse.4.2.2013.39-43 [How to cite this article: Doan, P. T., Nguyen, T. T., Jeong, S. K., Oh, S. J., & Kim, S. B. (2013. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer. INTERNATIONAL JOURNAL OF SCIENCE AND ENGINEERING, 4(2, 39-43; doi: http://dx.doi.org/10.12777/ijse.4.2.2013.39-43
Design of a high-current low-energy beam transport line for an intense D-T/D-D neutron generator
International Nuclear Information System (INIS)
Lu, Xiaolong; Wang, Junrun; Zhang, Yu; Li, Jianyi; Xia, Li; Zhang, Jie; Ding, Yanyan; Jiang, Bing; Huang, Zhiwu; Ma, Zhanwen; Wei, Zheng; Qian, Xiangping; Xu, Dapeng; Lan, Changlin; Yao, Zeen
2016-01-01
An intense D-T/D-D neutron generator is currently being developed at the Lanzhou University. The Cockcroft–Walton accelerator, as a part of the neutron generator, will be used to accelerate and transport the high-current low-energy beam from the duoplasmatron ion source to the rotating target. The design of a high-current low-energy beam transport (LEBT) line and the dynamics simulations of the mixed beam were carried out using the TRACK code. The results illustrate that the designed beam line facilitates smooth transportation of a deuteron beam of 40 mA, and the number of undesired ions can be reduced effectively using two apertures.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
Stability of alternating current gliding arcs
DEFF Research Database (Denmark)
Kusano, Yukihiro; Salewski, Mirko; Leipold, Frank
2014-01-01
on Ohm’s law indicates that the critical length of alternating current (AC) gliding arc discharge columns can be larger than that of a corresponding direct current (DC) gliding arc. This finding is supported by previously published images of AC and DC gliding arcs. Furthermore, the analysis shows......A gliding arc is a quenched plasma that can be operated as a non-thermal plasma at atmospheric pressure and that is thus suitable for large-scale plasma surface treatment. For its practical industrial use the discharge should be extended stably in ambient air. A simple analytical calculation based...... that the critical length can be increased by increasing the AC frequency, decreasing the serial resistance and lowering the gas flow rate. The predicted dependence of gas flow rate on the arc length is experimentally demonstrated. The gap width is varied to study an optimal electrode design, since the extended non...
The effect of surface grain reversal on the AC losses of sintered Nd–Fe–B permanent magnets
International Nuclear Information System (INIS)
Moore, Martina; Roth, Stefan; Gebert, Annett; Schultz, Ludwig; Gutfleisch, Oliver
2015-01-01
Sintered Nd–Fe–B magnets are exposed to AC magnetic fields in many applications, e.g. in permanent magnet electric motors. We have measured the AC losses of sintered Nd–Fe–B magnets in a closed circuit arrangement using AC fields with root mean square-values up to 80 mT (peak amplitude 113 mT) over the frequency range 50 to 1000 Hz. Two magnet grades with different dysprosium content were investigated. Around the remanence point the low grade material (1.7 wt% Dy) showed significant hysteresis losses; whereas the losses in the high grade material (8.9 wt% Dy) were dominated by classical eddy currents. Kerr microscopy images revealed that the hysteresis losses measured for the low grade magnet can be mainly ascribed to grains at the sample surface with multiple domains. This was further confirmed when the high grade material was subsequently exposed to DC and AC magnetic fields. Here a larger number of surface grains with multiple domains are also present once the step in the demagnetization curve attributed to the surface grain reversal is reached and a rise in the measured hysteresis losses is evident. If in the low grade material the operating point is slightly offset from the remanence point, such that zero field is not bypassed, its AC losses can also be fairly well described with classical eddy current theory. - Highlights: • The eddy current losses of sintered Nd–Fe–B magnets were measured. • Field amplitudes up to 113 mT over the frequency range 50 to 1000 Hz were applied. • The Nd–Fe–B magnets showed significant hysteresis losses at low amplitudes (∼100 mT). • The source of such hysteresis losses in sintered Nd–Fe–B magnets was identified. • Two magnet grades with different dysprosium content were investigated
The effect of surface grain reversal on the AC losses of sintered Nd–Fe–B permanent magnets
Energy Technology Data Exchange (ETDEWEB)
Moore, Martina, E-mail: m.moore@ifw-dresden.de [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Roth, Stefan; Gebert, Annett [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Schultz, Ludwig [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); TU Dresden, Institute for Materials Science, 01062 Dresden (Germany); Gutfleisch, Oliver [TU Darmstadt, Department of Materials Science, Alarich-Weiß-Str. 16, 64287 Darmstadt (Germany); Fraunhofer Project Group for Materials Recycling and Resource Strategies IWKS, 63457 Hanau (Germany)
2015-02-01
Sintered Nd–Fe–B magnets are exposed to AC magnetic fields in many applications, e.g. in permanent magnet electric motors. We have measured the AC losses of sintered Nd–Fe–B magnets in a closed circuit arrangement using AC fields with root mean square-values up to 80 mT (peak amplitude 113 mT) over the frequency range 50 to 1000 Hz. Two magnet grades with different dysprosium content were investigated. Around the remanence point the low grade material (1.7 wt% Dy) showed significant hysteresis losses; whereas the losses in the high grade material (8.9 wt% Dy) were dominated by classical eddy currents. Kerr microscopy images revealed that the hysteresis losses measured for the low grade magnet can be mainly ascribed to grains at the sample surface with multiple domains. This was further confirmed when the high grade material was subsequently exposed to DC and AC magnetic fields. Here a larger number of surface grains with multiple domains are also present once the step in the demagnetization curve attributed to the surface grain reversal is reached and a rise in the measured hysteresis losses is evident. If in the low grade material the operating point is slightly offset from the remanence point, such that zero field is not bypassed, its AC losses can also be fairly well described with classical eddy current theory. - Highlights: • The eddy current losses of sintered Nd–Fe–B magnets were measured. • Field amplitudes up to 113 mT over the frequency range 50 to 1000 Hz were applied. • The Nd–Fe–B magnets showed significant hysteresis losses at low amplitudes (∼100 mT). • The source of such hysteresis losses in sintered Nd–Fe–B magnets was identified. • Two magnet grades with different dysprosium content were investigated.
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
The Angola Current: Flow and hydrographic characteristics as observed at 11°S
Kopte, R.; Brandt, P.; Dengler, M.; Tchipalanga, P. C. M.; Macuéria, M.; Ostrowski, M.
2017-02-01
The eastern boundary circulation off the coast of Angola has been described only sparsely to date, although it is a key element in the understanding of the highly productive tropical marine ecosystem off Angola. Here, we report for the first time direct velocity observations of the Angola Current (AC) at ˜11°S collected between July 2013 and October 2015 in the depth range from 45 to 450 m. The measurements reveal an alongshore flow that is dominated by intraseasonal to seasonal variability with periodically alternating southward and northward velocities in the range of ±40 cm/s. During the observation period, a weak southward mean flow of 5-8 cm/s at 50 m depth is observed, with the southward current extending down to about 200 m depth. Corresponding mean southward transport of the AC is estimated to be 0.32 ± 0.046 Sv. An extensive set of hydrographic measurements is used to investigate the thermal structure and seasonality in the hydrography of the eastern boundary circulation. Within the depth range of the AC, the superposition of annual and semiannual harmonics explains a significant part of the total variability, although salinity in the near surface layer appears to be also impacted by year-to-year variability and/or short-term freshening events. In the central water layer, temperature and salinity on isopycnals vary only weakly on seasonal to annual time scales. The available data set is further used to evaluate different reanalysis products particularly emphasizing the ocean's role in coupled climate model SST biases in the Eastern Tropical Atlantic.
Spin-related transport phenomena in HgTe-based quantum well structures
International Nuclear Information System (INIS)
Koenig, Markus
2007-12-01
Within the scope of this thesis, spin related transport phenomena have been investigated in HgTe/Hg 0.3 Cd 0.7 Te quantum well structures. In our experiments, the existence of the quantum spin Hall (QSH) state was successfully demonstrated for the first time and the presented results provide clear evidence for the charge transport properties of the QSH state. Our experiments provide the first direct observation of the Aharonov-Casher (AC) effect in semiconductor structures. In conclusion, HgTe quantum well structures have proven to be an excellent template for studying spin-related transport phenomena: The QSH relies on the peculiar band structure of the material and the existence of both the spin Hall effect and the AC effect is a consequence of the substantial spin-orbit interaction. (orig.)
Spin-related transport phenomena in HgTe-based quantum well structures
Energy Technology Data Exchange (ETDEWEB)
Koenig, Markus
2007-12-15
Within the scope of this thesis, spin related transport phenomena have been investigated in HgTe/Hg{sub 0.3}Cd{sub 0.7}Te quantum well structures. In our experiments, the existence of the quantum spin Hall (QSH) state was successfully demonstrated for the first time and the presented results provide clear evidence for the charge transport properties of the QSH state. Our experiments provide the first direct observation of the Aharonov-Casher (AC) effect in semiconductor structures. In conclusion, HgTe quantum well structures have proven to be an excellent template for studying spin-related transport phenomena: The QSH relies on the peculiar band structure of the material and the existence of both the spin Hall effect and the AC effect is a consequence of the substantial spin-orbit interaction. (orig.)
Effect of Alternating Current on the Cathodic Protection and Interface Structure of X80 Steel
Directory of Open Access Journals (Sweden)
Huiru Wang
2017-07-01
Full Text Available This study employs potential-monitoring techniques, cyclic voltammetry tests, alternating current (AC voltammetry methods, and surface characterization to investigate the AC corrosion of cathodically protected X80 pipeline steel. In a non-passive neutral solution at pH 7.2, a sufficiently negative potential completely protects steel at an AC current density of 100 A/m2. In an alkaline solution at pH 9.6, more serious AC corrosion occurs at more negative cathodic protection (CP potential, whereas without CP the steel suffers negligible corrosion. In addition, the interface capacitance increases with AC amplitude. Based on these results, the AC corrosion mechanisms that function under various conditions are analyzed and described.
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
Technical feasibility and reliability of passive safety systems of AC600
International Nuclear Information System (INIS)
Niu, W.; Zeng, X.
1996-01-01
The first step conceptual design of the 600 MWe advanced PWR (AC-600) has been finished by the Nuclear Power Institute of China. Experiments on the passive system of AC-600 are being carried out, and are expected to be completed next year. The main research emphases of AC-600 conceptual design include the advanced core, the passive safety system and simplification. The design objective of AC-600 is that the safety, reliability, maintainability, operation cost and construction period are all improved upon compared to those of PWR plant. One of important means to achieve the objective is using a passive system, which has the following functions whenever its operation is required: providing the reactor core with enough coolant when others fail to make up the lost coolant; reactor residual heat removal; cooling and reducing pressure in the containment and preventing radioactive substances from being released into the environment after occurrence of accident (e.g. LOCA). The system should meet the single failure criterion, and keep operating when a single active component or passive component breaks down during the first 72 hour period after occurrence of accident, or in the long period following the 72 hour period. The passive safety system of AC-600 is composed of the primary safety injection system, the secondary emergency core residual heat removal system and the containment cooling system. The design of the system follows some relevant rules and criteria used by current PWR plant. The system has the ability to bear single failure, two complete separate subsystems are considered, each designed for 100% working capacity. Normal operation is separate from safety operation and avoids cross coupling and interference between systems, improves the reliability of components, and makes it easy to maintain, inspect and test the system. The paper discusses the technical feasibility and reliability of the passive safety system of AC-600, and some issues and test plans are also
Technical feasibility and reliability of passive safety systems of AC600
Energy Technology Data Exchange (ETDEWEB)
Niu, W; Zeng, X [Nuclear Power Inst. of China, Chendu (China)
1996-12-01
The first step conceptual design of the 600 MWe advanced PWR (AC-600) has been finished. Experiments on the passive system of AC-600 are being carried out, and are expected to be completed next year. The main research emphases of AC-600 conceptual design include the advanced core, the passive safety system and simplification. The design objective of AC-600 is that the safety, reliability, maintainability, operation cost and construction period are all improved upon compared to those of PWR plant. One of important means to achieve the objective is using a passive system, which has the following functions whenever its operation is required: providing the reactor core with enough coolant when others fail to make up the lost coolant; reactor residual heat removal; cooling and reducing pressure in the containment and preventing radioactive substances from being released into the environment after occurrence of accident (e.g. LOCA). The system should meet the single failure criterion, and keep operating when a single active component or passive component breaks down during the first 72 hour period after occurrence of accident, or in the long period following the 72 hour period. The passive safety system of AC-600 is composed of the primary safety injection system, the secondary emergency core residual heat removal system and the containment cooling system. The design of the system follows some relevant rules and criteria used by current PWR plant. The system has the ability to bear single failure, two complete separate subsystems are considered, each designed for 100% working capacity. Normal operation is separate from safety operation and avoids cross coupling and interference between systems, improves the reliability of components, and makes it easy to maintain, inspect and test the system. The paper discusses the technical feasibility and reliability of the passive safety system of AC-600, and some issues and test plans are also involved. (author). 3 figs, 1 tab.
The Effects of 10 Hz Transcranial Alternating Current Stimulation on Audiovisual Task Switching
Directory of Open Access Journals (Sweden)
Michael S. Clayton
2018-02-01
Full Text Available Neural oscillations in the alpha band (7–13 Hz are commonly associated with disengagement of visual attention. However, recent studies have also associated alpha with processes of attentional control and stability. We addressed this issue in previous experiments by delivering transcranial alternating current stimulation at 10 Hz over posterior cortex during visual tasks (alpha tACS. As this stimulation can induce reliable increases in EEG alpha power, and given that performance on each of our visual tasks was negatively associated with alpha power, we assumed that alpha tACS would reliably impair visual performance. However, alpha tACS was instead found to prevent both deteriorations and improvements in visual performance that otherwise occurred during sham & 50 Hz tACS. Alpha tACS therefore appeared to exert a stabilizing effect on visual attention. This hypothesis was tested in the current, pre-registered experiment by delivering alpha tACS during a task that required rapid switching of attention between motion, color, and auditory subtasks. We assumed that, if alpha tACS stabilizes visual attention, this stimulation should make it harder for people to switch between visual tasks, but should have little influence on transitions between auditory and visual subtasks. However, in contrast to this prediction, we observed no evidence of impairments in visuovisual vs. audiovisual switching during alpha vs. control tACS. Instead, we observed a trend-level reduction in visuoauditory switching accuracy during alpha tACS. Post-hoc analyses showed no effects of alpha tACS in response time variability, diffusion model parameters, or on performance of repeat trials. EEG analyses also showed no effects of alpha tACS on endogenous or stimulus-evoked alpha power. We discuss possible explanations for these results, as well as their broader implications for current efforts to study the roles of neural oscillations in cognition using tACS.
Influence of the ac magnetic field frequency on the magnetoimpedance of amorphous wire
International Nuclear Information System (INIS)
Chen, A P; Garcia, C; Zhukov, A; Dominguez, L; Blanco, J M; Gonzalez, J
2006-01-01
Experimental and theoretical studies on the influence of ac magnetic field frequency on the axial diagonal (ζ zz ) and off-diagonal (ζ Φz ) components of the magnetoimpedance (MI) tensor in (Co 0.94 Fe 0.06 ) 72.5 Si 12.5 B 15 amorphous wires have been performed. The frequency (f) of an ac current flowing along the wire was varied from 1 to 20 MHz with the current amplitude less than 15 mA. In order to enhance the ζ Φz component, the amorphous wire was submitted to torsion annealing for developing and preserving a helical magnetic anisotropy in the surface of the wire. The experimental measurements show that the value of the impedance is proportional to the square-root of the ac current frequency, √f, in the vicinity of H ex K and this increase is due to the contribution of the resistance (real part of the impedance). The measurements also indicate that the peaks of the MI curve shift slightly towards higher field values with increasing f. In a theoretical study the magnetoimpedance expressions ζ zz and ζ Φz have been deduced using the Faraday law in combination with the solutions of the Maxwell and Landau-Lifshitz-Gilbert (LLG) equations. By analysing quantitatively the spectra of ζ zz and ζ Φz , the phenomenon of the shift in the peaks of the MI curve with f has been considered as a characteristic of the helical anisotropy in the domain structure of the wire surface
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
International Nuclear Information System (INIS)
Gervasini, G.; Lazzaro, E.; Minardi, E.
1996-01-01
In accordance with the conventional ordering of neoclassical theory, poloidal and toroidal accelerations with constant parallel flow can be driven by heat transport in the absence of external momentum input and with vanishing parallel viscous stress. In a transient phase in which the heat transport is the primary source of the time dependence, the torque generating the rotation is provided at third order in the adiabatic expansion by the surface-averaged (non ambipolar) displacement current, which in also responsible for charge build-up and for the radial electric field. The heat transport equation has been solved in a narrow layer interfaced with the intensely heated plasma core through heat flux continuity, assuming neoclassical multi collisional coefficients with self-consistent suppression mechanism of anomalous transport. Starting from low temperature in the edge layer, a strong temperature gradient, a mass poloidal rotation in the ion direction and a strongly negative sheared radial electric field can be generated, in agreement with the observations, and reach a stationary state after a displacement current-dominated triggering phase (intrinsically non-ambipolar) lasting few milliseconds. Momentum input becomes important on longer time scale and is responsible for the toroidal rotation, decoupled from temperature gradient and for a further development of the radial electric field. The results show the ability of edge transport processes to adapt flexibly to a high temperature imposed on the inner side of the edge layer and support the view that the edge processes are a integral part of a more fundamental global process involving possibly an internal bifurcation of state
Defects characterization of arsenic implanted silicon by AC Hall effect measurements
International Nuclear Information System (INIS)
Jaouen, H.; Ghibaudo, G.; Christofides, C.
1986-01-01
AC and DC Hall effects measurements as a function of temperature (77 - 300K) and frequency (1Hz - 100KHz) have been performed to characterize implanted Silicon films. This technique enables the determination of the annihilation processes of defects in such layers as a function of temperature of isochronal annealings (300/sup 0/C to 1100/sup 0/C during 1 hour). The experimental results are discussed with respect to proper transport models based on short and long range disorder considerations in order to find out the features of defects and inhomogeneities arising from implantation and their thermal annihilation after isochronal annealing
Neutron transport assembly calculation with non-zero net current boundary condition
International Nuclear Information System (INIS)
Jo, Chang Keun
1993-02-01
Fuel assembly calculation for the homogenized group constants is one of the most important parts in the reactor core analysis. The homogenized group constants of one a quarter assembly are usually generated for the nodal calculation of the reactor core. In the current nodal calculation, one or a quarter of the fuel assembly corresponds to a unit node. The homogenized group constant calculation for a fuel assembly proceeds through cell spectrum calculations, group condensation and cell homogenization calculations, two dimensional fuel assembly calculation, and then depletion calculations of fuel rods. To obtain the assembly wise homogenized group constants, the two dimensional transport calculation is usually performed. Most codes for the assembly wise homogenized group constants employ a zero net current boundary condition. CASMO-3 is such a code that is in wide use. The zero net current boundary condition is plausible and valid in an infinite reactor composed of the same kind of assemblies. However, the reactor is finite and the core is constructed by different kinds of assemblies. Hence, the assumption of the zero net current boundary condition is not valid in the actual reactor. The objective of this study is to develop a homogenization methodology that can treat any actual boundary condition, i.e. non-zero net current boundary condition. In order to treat the non-zero net current boundary condition, we modify CASMO-3. For the two-dimensional treatment in CASMO-3, a multigroup integral transport routine based on the method of transmission probability is used. The code performs assembly calculation with zero net current boundary condition. CASMO-3 is modified to consider the inhomogeneous source at the assembly boundary surface due to the non-zero net current. The modified version of CASMO-3 is called CASMO-3M. CASMO-3M is applied to several benchmark problems. In order to obtain the inhomogeneous source, the global calculation is performed. The local calculation
Characterization and snubbing of a bidirectional MCT in a resonant ac link converter
Lee, Tony; Elbuluk, Malik E.; Zinger, Donald S.
1993-01-01
The MOS-Controlled Thyristor (MCT) is emerging as a powerful switch that combines the better characteristics of existing power devices. A study of switching stresses on an MCT switch under zero voltage resonant switching is presented. The MCT is used as a bidirectional switch in an ac/ac pulse density modulated inverter for induction motor drive. Current and voltage spikes are observed and analyzed with variations in the timing of the switching. Different snubber circuit configurations are under investigation to minimize the effect of these transients. The results will be extended to study and test the MCT switching in a medium power (5 hp) induction motor drive.
Spectroscopic AC susceptibility imaging (sASI) of magnetic nanoparticles
International Nuclear Information System (INIS)
Ficko, Bradley W.; Nadar, Priyanka M.; Diamond, Solomon G.
2015-01-01
This study demonstrates a method for alternating current (AC) susceptibility imaging (ASI) of magnetic nanoparticles (mNPs) using low cost instrumentation. The ASI method uses AC magnetic susceptibility measurements to create tomographic images using an array of drive coils, compensation coils and fluxgate magnetometers. Using a spectroscopic approach in conjunction with ASI, a series of tomographic images can be created for each frequency measurement set and is termed sASI. The advantage of sASI is that mNPs can be simultaneously characterized and imaged in a biological medium. System calibration was performed by fitting the in-phase and out-of-phase susceptibility measurements of an mNP sample with a hydrodynamic diameter of 100 nm to a Brownian relaxation model (R 2 =0.96). Samples of mNPs with core diameters of 10 and 40 nm and a sample of 100 nm hydrodynamic diameter were prepared in 0.5 ml tubes. Three mNP samples were arranged in a randomized array and then scanned using sASI with six frequencies between 425 and 925 Hz. The sASI scans showed the location and quantity of the mNP samples (R 2 =0.97). Biological compatibility of the sASI method was demonstrated by scanning mNPs that were injected into a pork sausage. The mNP response in the biological medium was found to correlate with a calibration sample (R 2 =0.97, p<0.001). These results demonstrate the concept of ASI and advantages of sASI. - Highlights: • Development of an AC susceptibility imaging model. • Comparison of AC susceptibility imaging (ASI) and susceptibility magnitude imaging (SMI). • Demonstration of ASI and spectroscopic ASI (sASI) using three different magnetic nanoparticle types. • SASI scan separation of three different magnetic nanoparticles samples using 5 spectroscopic frequencies. • Demonstration of biological feasibility of sASI
Critical current characteristics and history dependence in superconducting SmFeAsOF bulk
International Nuclear Information System (INIS)
Ni, B; Ge, J; Kiuchi, M; Otabe, E S; Gao, Z; Wang, L; Qi, Y; Zhang, X; Ma, Y
2010-01-01
The superconducting SmFeAsO 1-x F x (x=0.2) polycrystalline bulks were prepared by the powder-in-tube (PIT) method. The magnetic field and temperature dependences of critical current densities in the samples were investigated by resistive and ac inductive (Campbell's) methods. It was found that a fairly large shielding current density over 10 9 A/m 2 , which is considered to correspond to the local critical current density, flows locally with the perimeter size similar to the average grain size of the bulk samples, while an extremely low transport current density of about 10 5 A/m 2 corresponding to the global critical current density flows through the whole sample. Furthermore, a unique history dependence of global critical current density was observed, i.e., it shows a smaller value in the increasing-field process than that in the decreasing-field process. The history dependence of global critical current characteristic in our case can be ascribed to the existence of the weak-link property between the grains in SmFeAsO 1-x F x bulk.
Pulsed transport critical currents of Bi2212 tapes in pulsed magnetic fields
Energy Technology Data Exchange (ETDEWEB)
Rogacki, K [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, Wroclaw (Poland); Gilewski, A; Klamut, J [International Laboratory of High Magnetic Fields and Low Temperatures, Polish Academy of Sciences, Wroclaw (Poland); Newson, M; Jones, H [Clarendon Laboratory, University of Oxford, Oxford (United Kingdom); Glowacki, B A [IRC in Superconductivity and Department of Materials Science, University of Cambridge, Cambridge (United Kingdom)
2002-07-01
If high-T{sub C} superconductors are ever to be used in high-field applications, it is vital that the critical surfaces can be mapped under high-field conditions. However, the latest superconductors have high currents even at fields over 20 T, making accurate measurements very difficult due to the thermal and mechanical problems. In this paper, we compare measurements on BSCCO-2212 tape using a number of different methods, particularly an innovative pulsed transport current and pulsed field mode. We show how the analysis of the voltage signal from BSCCO-2212 tape in pulsed conditions may be used to extract the critical current in quasi-stationary conditions. The effect of a metallic substrate on the results is also briefly discussed. (author)
Nonequilibrium Distribution of the Microscopic Thermal Current in Steady Thermal Transport Systems
Yukawa, Satoshi; Ogushi, Fumiko; Shimada, Takashi; Ito, Nobuyasu
2010-01-01
Nonequilibrium distribution of the microscopic thermal current is investigated by direct molecular dynamics simulations. The microscopic thermal current in this study is defined by a flow of kinetic energy carried by a single particle. Asymptotic parallel and antiparallel tails of the nonequilibrium distribution to an average thermal current are identical to ones of equilibrium distribution with different temperatures. These temperatures characterizing the tails are dependent on a characteristic length in which a memory of dynamics is completely erased by several particle collisions. This property of the tails of nonequilibrium distribution is confirmed in other thermal transport systems. In addition, statistical properties of a particle trapped by a harmonic potential in a steady thermal conducting state are also studied. This particle feels a finite force parallel to the average thermal current as a consequence of the skewness of the distribution of the current. This force is interpreted as the microscopic origin of thermophoresis.
Efficiency estimation method of three-wired AC to DC line transfer
Solovev, S. V.; Bardanov, A. I.
2018-05-01
The development of power semiconductor converters technology expands the scope of their application to medium voltage distribution networks (6-35 kV). Particularly rectifiers and inverters of appropriate power capacity complement the topology of such voltage level networks with the DC links and lines. The article presents a coefficient that allows taking into account the increase of transmission line capacity depending on the parameters of it. The application of the coefficient is presented by the example of transfer three-wired AC line to DC in various methods. Dependences of the change in the capacity from the load power factor of the line and the reactive component of the resistance of the transmission line are obtained. Conclusions are drawn about the most efficient ways of converting a three-wired AC line to direct current.
Data for spatial characterization of AC signal propagation over primary neuron dendrites
Directory of Open Access Journals (Sweden)
Hojeong Kim
2016-03-01
Full Text Available Action potentials generated near the soma propagate not only into the axonal nerve connecting to the adjacent neurons but also into the dendrites interacting with a diversity of synaptic inputs as well as voltage gated ion channels. Measuring voltage attenuation factors between the soma and all single points of the dendrites in the anatomically reconstructed primary neurons with the same cable properties, we report the signal propagation data showing how the alternating current (AC signal such as action potentials back-propagates over the dendrites among different types of primary neurons. Fitting equations and their parameter values for the data are also presented to quantitatively capture the spatial profile of AC signal propagation from the soma to the dendrites in primary neurons. Our data is supplemental to our original study for the dependency of dendritic signal propagation and excitability, and their relationship on the cell type-specific structure in primary neurons (DOI: 10.1016/j.neulet.2015.10.017 [1]. Keywords: Primary neurons, Dendritic signal processing, AC signal propagation, Voltage attenuation analysis
Directory of Open Access Journals (Sweden)
Fuangpian Phanupong
2016-01-01
Full Text Available Nowadays, using of High Voltage Direct Current (HVDC transmission to maximize the transmission efficiency, bulk power transmission, connection of renewable power source from wind farm to the grid is of prime concern for the utility. However, due to the high electric field stress from Direct Current (DC line, the corona discharge can easily be occurred at the conductor surface leading to transmission loss. Therefore, the polarity effect of DC lines on corona inception and breakdown voltage should be investigated. In this work, the effect of DC polarity and Alternating Current (AC field stress on corona inception voltage and corona discharge is investigated on various test objects, such as High Voltage (HV needle, needle at ground plane, internal defect, surface discharge, underground cable without cable termination, cable termination with simulated defect and bare overhead conductor. The corona discharge is measured by partial discharge measurement device with high-frequency current transformer. Finally, the relationship between supply voltage and discharge intensity on each DC polarity and AC field stress can be successfully determined.
Energy Technology Data Exchange (ETDEWEB)
Hazarika, J.; Kumar, A., E-mail: ask@tezu.ernet.in
2014-08-15
In this paper, we report the 160 MeV Ni{sup 12+} swift heavy ions (SHIs) irradiation effects on AC conductivity and dielectric relaxation properties of polypyrrole (PPy) nanoparticles in the frequency range of 42 Hz–5 MHz. Four ion fluences of 5 × 10{sup 10}, 1 × 10{sup 11}, 5 × 10{sup 11} and 1 × 10{sup 12} ions/cm{sup 2} have been used for the irradiation purpose. Transport properties in the pristine and irradiated PPy nanoparticles have been investigated with permittivity and modulus formalisms to study the polarization effects and conductivity relaxation. With increasing ion fluence, the relaxation peak in imaginary modulus (M{sup ″}) plots shifts toward high frequency suggesting long range motion of the charge carriers. The AC conductivity studies suggest correlated barrier hopping as the dominant transport mechanism. The hopping distance (R{sub ω}) of the charge carriers decreases with increasing the ion fluence. Binding energy (W{sub m}) calculations depict that polarons are the dominant charge carriers.
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
Current drive by EC waves in the presence of magnetic islands and transport
International Nuclear Information System (INIS)
Rosa, P R da S; Ziebell, L F
2008-01-01
In this paper we address the problem of current drive by electron cyclotron (EC) waves in the presence of magnetic islands and transport. Our approach makes use of quasilinear theory by numerically solving the Fokker-Planck equation in cylindrical geometry. We take into account the actual geometry of the islands along the calculations as well as the changes in the plasma density profile due to the action of the radial particle transport. The particle transport is supposed to have a magnetic origin. The waves are assumed to be launched and propagated in the equatorial plane of the tokamak, as in the slab geometry. Our results show that the use of equilibrium profiles as usually done in the studies on neoclassical tearing mode control may not be a better choice and point to the need for taking into account the actual island geometry
International Nuclear Information System (INIS)
Thamilselvan, M.; PremNazeer, K.; Mangalaraj, D.; Narayandass, Sa.K.; Yi, Junsin
2004-01-01
X-ray diffraction analysis of GaSe thin films used in the present investigation showed that the as-deposited and the one deposited at higher substrate temperature are in amorphous and polycrystalline state, respectively. The alternating current (ac) conduction properties of thermally evaporated films of GaSe were studied ex situ employing symmetric aluminium ohmic electrodes in the frequency range of 120-10 5 Hz at various temperature regimes. For the film deposited at elevated substrate temperature (573 K) the ac conductivity was found to increase with improvement of its crystalline structure. The ac conductivity (σ ac ) is found to be proportional to (ω s ) where s m calculated from ac conductivity measurements are compared with optical studies of our previous reported work for a-GaSe and poly-GaSe thin films. The distance between the localized centres (R), activation energy (ΔE σ ) and the number of sites per unit energy per unit volume N(E F ) at the Fermi level were evaluated for both a-GaSe and poly-GaSe thin films. Goswami and Goswami model has been invoked to explain the dependence of capacitance on frequency and temperature
Majorana transport in superconducting nanowire with Rashba and Dresselhaus spin-orbit couplings.
You, Jia-Bin; Shao, Xiao-Qiang; Tong, Qing-Jun; Chan, A H; Oh, C H; Vedral, Vlatko
2015-06-10
The tunneling experiment is a key technique for detecting Majorana fermion (MF) in solid state systems. We use Keldysh non-equilibrium Green function method to study two-lead tunneling in superconducting nanowire with Rashba and Dresselhaus spin-orbit couplings. A zero-bias dc conductance peak appears in our setup which signifies the existence of MF and is in accordance with previous experimental results on InSb nanowire. Interestingly, due to the exotic property of MF, there exists a hole transmission channel which makes the currents asymmetric at the left and right leads. The ac current response mediated by MF is also studied here. To discuss the impacts of Coulomb interaction and disorder on the transport property of Majorana nanowire, we use the renormalization group method to study the phase diagram of the wire. It is found that there is a topological phase transition under the interplay of superconductivity and disorder. We find that the Majorana transport is preserved in the superconducting-dominated topological phase and destroyed in the disorder-dominated non-topological insulator phase.
Majorana transport in superconducting nanowire with Rashba and Dresselhaus spin–orbit couplings
International Nuclear Information System (INIS)
You, Jia-Bin; Shao, Xiao-Qiang; Tong, Qing-Jun; Oh, C H; Vedral, Vlatko; Chan, A H
2015-01-01
The tunneling experiment is a key technique for detecting Majorana fermion (MF) in solid state systems. We use Keldysh non-equilibrium Green function method to study two-lead tunneling in superconducting nanowire with Rashba and Dresselhaus spin–orbit couplings. A zero-bias dc conductance peak appears in our setup which signifies the existence of MF and is in accordance with previous experimental results on InSb nanowire. Interestingly, due to the exotic property of MF, there exists a hole transmission channel which makes the currents asymmetric at the left and right leads. The ac current response mediated by MF is also studied here. To discuss the impacts of Coulomb interaction and disorder on the transport property of Majorana nanowire, we use the renormalization group method to study the phase diagram of the wire. It is found that there is a topological phase transition under the interplay of superconductivity and disorder. We find that the Majorana transport is preserved in the superconducting-dominated topological phase and destroyed in the disorder-dominated non-topological insulator phase. (paper)
International Nuclear Information System (INIS)
Passos, W.A.C.
2016-01-01
This work presents a method to obtain critical current of granular superconductors. We have carried out transport measurements (ρxT curves and VxI curves) in a YBa_2Cu_3O_7_-_δ sample to determine critical current density of it. Some specimens reveal a 'semiconductor-like' behavior (electrical resistivity decreases with increasing temperatures above critical temperature T_c of material) competing with superconductor behavior. Due to high granular fraction of the sample, these competition is clearly noted in ρxT curves. Measurements carried out from 0 to 8500 Oe of applied field show the same behavior, and the critical current density of the samples is shown. (author)
Sheng, Kaixuan; Sun, Yiqing; Li, Chun; Yuan, Wenjing; Shi, Gaoquan
2012-02-01
The recent boom in multifunction portable electronic equipments requires the development of compact and miniaturized electronic circuits with high efficiencies, low costs and long lasting time. For the operation of most line-powered electronics, alternating current (ac) line-filters are used to attenuate the leftover ac ripples on direct current (dc) voltage busses. Today, aluminum electrolytic capacitors (AECs) are widely applied for this purpose. However, they are usually the largest components in electronic circuits. Replacing AECs by more compact capacitors will have an immense impact on future electronic devices. Here, we report a double-layer capacitor based on three-dimensional (3D) interpenetrating graphene electrodes fabricated by electrochemical reduction of graphene oxide (ErGO-DLC). At 120-hertz, the ErGO-DLC exhibited a phase angle of -84 degrees, a specific capacitance of 283 microfaradays per centimeter square and a resistor-capacitor (RC) time constant of 1.35 milliseconds, making it capable of replacing AECs for the application of 120-hertz filtering.
Usefulness of current international air transport statistics
1999-05-01
International air transportation is the fastest growing segment of transportation. It performs a major function in the globalization process and is a significant feature of the late 20th century. Public policy regarding international air transportati...
Comparison of high-voltage ac and pulsed operation of a surface dielectric barrier discharge
Energy Technology Data Exchange (ETDEWEB)
Williamson, James M [Innovative Scientific Solutions, Inc., 2766 Indian Ripple Road, Dayton, Ohio 45440-3638 (United States); Trump, Darryl D [Innovative Scientific Solutions, Inc., 2766 Indian Ripple Road, Dayton, Ohio 45440-3638 (United States); Bletzinger, Peter [Innovative Scientific Solutions, Inc., 2766 Indian Ripple Road, Dayton, Ohio 45440-3638 (United States); Ganguly, Biswa N [Air Force Research Laboratory, Wright-Patterson Air Force Base, Ohio 45433-7919 (United States)
2006-10-21
A surface dielectric barrier discharge (DBD) in atmospheric pressure air was excited either by low frequency (0.3-2 kHz) high-voltage ac or by short, high-voltage pulses at repetition rates from 50 to 600 pulses s{sup -1}. The short-pulse excited discharge was more diffuse and did not have the pronounced bright multiple cathode spots observed in the ac excited discharge. The discharge voltage, current and average power deposited into the discharge were calculated for both types of excitation. As a measure of plasma-chemical efficiency, the ozone number density was measured by UV absorption as a function of average deposited power. The density of ozone produced by ac excitation did not increase so rapidly as that produced by short-pulse excitation as a function of average power, with a maximum measured density of {approx}3 x 10{sup 15} cm{sup -3} at 25 W. The maximum ozone production achieved by short-pulse excitation was {approx}8.5 x 10{sup 15} cm{sup -3} at 20 W, which was four times greater than that achieved by ac excitation at the same power level.
Comparison of high-voltage ac and pulsed operation of a surface dielectric barrier discharge
International Nuclear Information System (INIS)
Williamson, James M; Trump, Darryl D; Bletzinger, Peter; Ganguly, Biswa N
2006-01-01
A surface dielectric barrier discharge (DBD) in atmospheric pressure air was excited either by low frequency (0.3-2 kHz) high-voltage ac or by short, high-voltage pulses at repetition rates from 50 to 600 pulses s -1 . The short-pulse excited discharge was more diffuse and did not have the pronounced bright multiple cathode spots observed in the ac excited discharge. The discharge voltage, current and average power deposited into the discharge were calculated for both types of excitation. As a measure of plasma-chemical efficiency, the ozone number density was measured by UV absorption as a function of average deposited power. The density of ozone produced by ac excitation did not increase so rapidly as that produced by short-pulse excitation as a function of average power, with a maximum measured density of ∼3 x 10 15 cm -3 at 25 W. The maximum ozone production achieved by short-pulse excitation was ∼8.5 x 10 15 cm -3 at 20 W, which was four times greater than that achieved by ac excitation at the same power level
DEFF Research Database (Denmark)
MacAulay, Nanna; Zeuthen, Thomas; Gether, Ulrik
2002-01-01
The rat gamma-aminobutyric acid transporter-1 (GAT-1) was expressed in Xenopus laevis oocytes and the substrate-independent Li(+)-induced leak current was examined using two-electrode voltage clamp. The leak current was not affected by the addition of GABA and was not due to H(+) permeation. The Li......(+)-bound conformation of the protein displayed a lower passive water permeability than that of the Na(+)- and choline (Ch(+))-bound conformations and the leak current did not saturate with increasing amounts of Li(+) in the test solution. The mechanism that gives rise to the leak current did not support active water...... transport in contrast to the mechanism responsible for GABA translocation (approximately 330 water molecules per charge). Altogether, these data support the distinct nature of the leak conductance in relation to the substrate translocation process. It was observed that the leak current was inhibited by low...
Contaminación acústica en sector marítimo normativa e incidencia en la salud. Buque Petroport.
Gómez Tramullas, Hugo
2017-01-01
Estudio de la contaminación acústica en el transporte marítimo e incidencias en la salud en la gente de mar así como la puesta en común de las deficiencias que se puedan encontrar en protección auditiva y sus consecuencias in situ y posteriores a su exposición.
Progress Toward Steady State Tokamak Operation Exploiting the high bootstrap current fraction regime
Ren, Q.
2015-11-01
Recent DIII-D experiments have advanced the normalized fusion performance of the high bootstrap current fraction tokamak regime toward reactor-relevant steady state operation. The experiments, conducted by a joint team of researchers from the DIII-D and EAST tokamaks, developed a fully noninductive scenario that could be extended on EAST to a demonstration of long pulse steady-state tokamak operation. Fully noninductive plasmas with extremely high values of the poloidal beta, βp >= 4 , have been sustained at βT >= 2 % for long durations with excellent energy confinement quality (H98y,2 >= 1 . 5) and internal transport barriers (ITBs) generated at large minor radius (>= 0 . 6) in all channels (Te, Ti, ne, VTf). Large bootstrap fraction (fBS ~ 80 %) has been obtained with high βp. ITBs have been shown to be compatible with steady state operation. Because of the unusually large ITB radius, normalized pressure is not limited to low βN values by internal ITB-driven modes. βN up to ~4.3 has been obtained by optimizing the plasma-wall distance. The scenario is robust against several variations, including replacing some on-axis with off-axis neutral beam injection (NBI), adding electron cyclotron (EC) heating, and reducing the NBI torque by a factor of 2. This latter observation is particularly promising for extension of the scenario to EAST, where maximum power is obtained with balanced NBI injection, and to a reactor, expected to have low rotation. However, modeling of this regime has provided new challenges to state-of-the-art modeling capabilities: quasilinear models can dramatically underpredict the electron transport, and the Sauter bootstrap current can be insufficient. The analysis shows first-principle NEO is in good agreement with experiments for the bootstrap current calculation and ETG modes with a larger saturated amplitude or EM modes may provide the missing electron transport. Work supported in part by the US DOE under DE-FC02-04ER54698, DE-AC52-07NA
Transport Physics Mechanisms in Thin-Film Oxides.
Tierney, Brian D.; Hjalmarson, Harold P.; Jacobs-Gedrim, Robin B.; James, Conrad D.; Marinella, Matthew M.
A physics-based model of electron transport mechanisms in metal-insulating oxide-metal (M-I-M) systems is presented focusing on transport through the metal-oxide interfaces and in the bulk of the oxide. Interface tunneling, such as electron tunneling between the metal and the conduction band, or to oxide defect states, is accounted for via a WKB model. The effects of thermionic emission are also included. In the bulk of the oxide, defect-site hopping is dominant. Corresponding continuum calculations are performed for Ta2O5 M-I-M systems utilizing two different metal electrodes, e.g., platinum and tantalum. Such an asymmetrical M-I-M structure, applicable to resistive memory applications or oxide-based capacitors, reveals that the current can be either bulk or interface limited depending on the bias polarity and concentration of oxygen vacancy defects. Also, the dominance of some transport mechanisms over others is shown to be due to a complex interdependence between the vacancy concentration and bias polarity. Sandia National Laboratories is a multi-mission laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000.
Energy Technology Data Exchange (ETDEWEB)
He, X.; Jiang, G.; Qiu, Y.; Tang, H. [College of Chemistry and Chemical Engineering, Huazhong University of Science and Technology, Wuhan (China); Zhang, G.; Jin, X.; Xiang, Z. [Huazhong Natural Gas Subsidiary of PetroChina Pipeline Company, Wuhan (China); Zhang, Z. [Dwell Company Limited, PetroChina Engineering Company, Ltd, Beijing (China)
2012-06-15
Interference of alternative current (AC) on corrosion of X65 steel was investigated in soil. It was observed that the unfavorable effect of interfering AC was able to be effectively inhibited by increasing the direct current density of the cathodic protection (CP) system. A clear correlation was established between the CP current density and the tolerable AC current density. This led to a new criterion for assuring the effectiveness of CP of buried pipelines being interfered with AC. Field experimental results on a buried pipeline running below a 500 kV transmission line showed that the criterion could satisfactorily predict the risk of AC interfering on the CP system. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Comparison of the converter systems for a high-voltage variable-frequency AC drive
Directory of Open Access Journals (Sweden)
G.G. Zhemerov
2013-12-01
Full Text Available Matlab-models of two converter systems of an 8 MW AC drive are developed, one based on a self-contained current inverter with cut-off diodes, the other based on a multilevel cascade voltage inverter. By applying virtual simulation, qualitative characteristics of these systems are compared.
Energy Technology Data Exchange (ETDEWEB)
Glowacki, B A [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge (United Kingdom); Majoros, M [Interdisciplinary Research Centre in Superconductivity, University of Cambridge, Madingley Road, Cambridge (United Kingdom); Vickers, M [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge (United Kingdom); Eisterer, M [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Toenies, S [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Weber, H W [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Fukutomi, M [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan); Komori, K [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan); Togano, K [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan)
2003-02-01
We discuss the results of a study of MgB{sub 2} multifilamentary conductors and coated conductors from the point of view of their future dc and ac applications. The correlation between the slope of the irreversibility line induced by neutron irradiation defects and in situ structural imperfections and the critical temperature and critical current density is discussed with respect to the conductor performance and applicability. We debate the possible origin of the observed anomalous decrease of ac susceptibility at 50 K in copper clad in situ powder-in-tube MgB{sub 2} wires. Different conductor preparation methods and conductor architectures, and attainable critical current densities are presented. Some numerical results on critical currents, thermal stability and ac losses of future MgB{sub 2} multifilamentary and coated conductors with magnetic cladding of their filaments are also discussed.
Energy Technology Data Exchange (ETDEWEB)
Hong, Z; Jiang, Q; Pei, R; Campbell, A M; Coombs, T A [Engineering Department, University of Cambridge, Trumpington Street, Cambridge CB2 1PZ (United Kingdom)
2007-04-15
A finite element method code based on the critical state model is proposed to solve the AC loss problem in YBCO coated conductors. This numerical method is based on a set of partial differential equations (PDEs) in which the magnetic field is used as the state variable. The AC loss problems have been investigated both in self-field condition and external field condition. Two numerical approaches have been introduced: the first model is configured on the cross-section plane of the YBCO tape to simulate an infinitely long superconducting tape. The second model represents the plane of the critical current flowing and is able to simulate the YBCO tape with finite length where the end effect is accounted. An AC loss measurement has been done to verify the numerical results and shows a good agreement with the numerical solution.
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
DC-Compensated Current Transformer.
Ripka, Pavel; Draxler, Karel; Styblíková, Renata
2016-01-20
Instrument current transformers (CTs) measure AC currents. The DC component in the measured current can saturate the transformer and cause gross error. We use fluxgate detection and digital feedback compensation of the DC flux to suppress the overall error to 0.15%. This concept can be used not only for high-end CTs with a nanocrystalline core, but it also works for low-cost CTs with FeSi cores. The method described here allows simultaneous measurements of the DC current component.
Current transport in graphene/AlGaN/GaN vertical heterostructures probed at nanoscale.
Fisichella, Gabriele; Greco, Giuseppe; Roccaforte, Fabrizio; Giannazzo, Filippo
2014-08-07
Vertical heterostructures combining two or more graphene (Gr) layers separated by ultra-thin insulating or semiconductor barriers represent very promising systems for next generation electronics devices, due to the combination of high speed operation with wide-range current modulation by a gate bias. They are based on the specific mechanisms of current transport between two-dimensional-electron-gases (2DEGs) in close proximity. In this context, vertical devices formed by Gr and semiconductor heterostructures hosting an "ordinary" 2DEG can be also very interesting. In this work, we investigated the vertical current transport in Gr/Al(0.25)Ga(0.75)N/GaN heterostructures, where Gr is separated from a high density 2DEG by a ∼ 24 nm thick AlGaN barrier layer. The current transport from Gr to the buried 2DEG was characterized at nanoscale using conductive atomic force microscopy (CAFM) and scanning capacitance microscopy (SCM). From these analyses, performed both on Gr/AlGaN/GaN and on AlGaN/GaN reference samples using AFM tips with different metal coatings, the Gr/AlGaN Schottky barrier height ΦB and its lateral uniformity were evaluated, as well as the variation of the carrier densities of graphene (ngr) and AlGaN/GaN 2DEG (ns) as a function of the applied bias. A low Schottky barrier (∼ 0.40 eV) with excellent spatial uniformity was found at the Gr/AlGaN interface, i.e., lower compared to the measured values for metal/AlGaN contacts, which range from ∼ 0.6 to ∼ 1.1 eV depending on the metal workfunction. The electrical behavior of the Gr/AlGaN contact has been explained by Gr interaction with AlGaN donor-like surface states located in close proximity, which are also responsible of high n-type Gr doping (∼ 1.3 × 10(13) cm(-2)). An effective modulation of ns by the Gr Schottky contact was demonstrated by capacitance analysis under reverse bias. From this basic understanding of transport properties in Gr/AlGaN/GaN heterostructures, novel vertical field effect
Nonlinear spin current generation in noncentrosymmetric spin-orbit coupled systems
Hamamoto, Keita; Ezawa, Motohiko; Kim, Kun Woo; Morimoto, Takahiro; Nagaosa, Naoto
2017-06-01
Spin current plays a central role in spintronics. In particular, finding more efficient ways to generate spin current has been an important issue and has been studied actively. For example, representative methods of spin-current generation include spin-polarized current injections from ferromagnetic metals, the spin Hall effect, and the spin battery. Here, we theoretically propose a mechanism of spin-current generation based on nonlinear phenomena. By using Boltzmann transport theory, we show that a simple application of the electric field E induces spin current proportional to E2 in noncentrosymmetric spin-orbit coupled systems. We demonstrate that the nonlinear spin current of the proposed mechanism is supported in the surface state of three-dimensional topological insulators and two-dimensional semiconductors with the Rashba and/or Dresselhaus interaction. In the latter case, the angular dependence of the nonlinear spin current can be manipulated by the direction of the electric field and by the ratio of the Rashba and Dresselhaus interactions. We find that the magnitude of the spin current largely exceeds those in the previous methods for a reasonable magnitude of the electric field. Furthermore, we show that application of ac electric fields (e.g., terahertz light) leads to the rectifying effect of the spin current, where dc spin current is generated. These findings will pave a route to manipulate the spin current in noncentrosymmetric crystals.
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.