WorldWideScience

Sample records for ac transport current

  1. Study on ac losses of HTS coil carrying ac transport current

    International Nuclear Information System (INIS)

    Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan

    2005-01-01

    Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses

  2. n value and Jc distribution dependence of AC transport current losses in HTS conductors

    International Nuclear Information System (INIS)

    Ogawa, Jun; Sawai, Yusuke; Nakayama, Haruki; Tsukamoto, Osami; Miyagi, Daisuke

    2004-01-01

    Compared with LTS materials, HTS materials have some peculiarities affecting AC loss characteristics of the conductors. We measured the AC transport current losses in YBCO thin film coated conductors and a Bi2223/Ag sheathed tape. Comparing the measured data with analytical calculations, the dependence of the AC transport current losses on the n value and critical current density distributions are studied. It is shown that, considering the n values and J c distributions, the peculiarities in the HTS materials can be taken into consideration and the transport current losses in HTS conductors can be calculated by the same analytical method used for LTS

  3. AC Transport Current Loss in a Coated Superconductor in the Bean Model

    National Research Council Canada - National Science Library

    Carr, Jr, W. J

    2004-01-01

    A new and straightforward calculation is made of the loss in a very thin superconducting strip of rectangular cross section carrying ac transport current in zero applied magnetic field, with a similar...

  4. Study of structure of HTS coated conductor with ferromagnetic substrate having low AC transport current loss using FEM

    International Nuclear Information System (INIS)

    Miyagi, D.; Amadutsumi, Y.; Takahashi, N.; Tsukamoto, O.

    2007-01-01

    AC transport current losses of coated conductors with ferromagnetic substrates are higher than the loss calculated by the Norris equation. In order to reduce the AC transport current loss we propose in this paper a structure of the coated conductor that has wider substrate than the SC (Superconducting) layer. The current distribution and AC loss of the proposed model are analyzed by means of FEM. The AC transport current loss is reduced due to the change of current density distribution near the edge of SC layer, consequent to the high value of magnetic permeability of the ferromagnetic substrate, that is wider than the SC layer

  5. A simulation of a multifilamentary wire carrying a transport current in an AC applied field

    International Nuclear Information System (INIS)

    Rem, P.C.; Hartmann, R.A.; Dijkstra, D.; Van Beckum, F.P.H.; Van de Klundert, L.J.M.

    1986-01-01

    The problem of calculating the current distribution in a multi-filamentary wire subjected to a time-dependent field becomes difficult as soon as the non-linearity due to the saturation of layers of filaments can be neglected no more. Such a problem can be solved approximately if the shape of the boundaries between unsaturated regions can be prescribed on the basis of general considerations such as symmetry arguments. For cases involving both a transport current and an applied field, however, little is known about the boundaries and their time-dependence behaviour. For such cases a brute force numerical calculation may provide an answer. The results presented below were calculated for a combination of DC transport current and AC applied field

  6. Numerical and theoretical evaluations of AC losses for single and infinite numbers of superconductor strips with direct and alternating transport currents in external AC magnetic field

    Science.gov (United States)

    Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.

    2010-11-01

    AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.

  7. Transport current ac losses and current-voltage curves of multifilamentary Bi-2223/Ag tape with artificial defects

    International Nuclear Information System (INIS)

    Polak, M.; Jansak, L.

    2000-01-01

    We experimentally studied the effects of a single artificial defect and a linear array of artificial defects on I-V curves, critical currents and transport current ac losses of 55 filament untwisted Bi-2223/Ag tapes. The artificial defect was a small hole drilled into the tape. The reduction in the critical current measured on a 1 cm long section due to one hole of diameter 0.9 mm was 33% and that due to a linear array of seven similar holes was 62%. The slopes of the I-V curves, n, measured in this section were 33, 16 and 5.8 in the original sample, in the sample with one defect and the sample with seven defects, respectively. Both I c and the slope reduction were smaller if the distance between the potential taps was increased. The transport current ac losses at 50 Hz and I rms = 10 A in the sample with one defect measured in a 1 cm long section were practically the same as those in the original sample (4.1x10 -4 W m -1 ), but they increased by 83% in the sample with a linear array of seven defects. The measured increase in losses per unit length was the smaller, the larger the distance between the potential taps. A comparison between the measured and calculated losses revealed that a formal application of the Norris equations for loss calculations in samples with local defects leads to an overestimation of the ac losses. A procedure for the calculation of transport current losses in samples with local defects based on the Norris model is proposed and verified. (author)

  8. Superconductive AC current limiter

    International Nuclear Information System (INIS)

    Bekhaled, M.

    1987-01-01

    This patent describes an AC current limiter for a power transport line including a power supply circuit and feeding a load circuit via an overload circuit-breaker member. The limiter comprises a transformer having a primary winding connected in series between the power supply circuit and the load circuit and at least one secondary winding of superconductor material contained in a cryogenic enclosure and short-circuited on itself. The leakage reactance of the transformer as seen from the primary winding is low, and the resistance of the at least one secondary winding when in the non-superconducting state and as seen from the primary is much greater than the nominal impedance of the transformer. The improvement whereby the at least one secondary winding of the transformer comprises an active winding in association with a set of auxiliary windings. The set of auxiliary windings is constituted by an even number of series-connected auxiliary windings wound in opposite directions, with the total number of turns in one direction being equal to the total number of turns in the opposite direction, and with the thermal capacity of the secondary winding as a whole being sufficiently high to limit the expansion thereof to a value which remains small during the time it takes the circuit-breaking member to operate

  9. Study of the Effect of Transport Current and Combined Transverse and Longitudinal Fields on the AC Loss in NET Prototype Conductors

    NARCIS (Netherlands)

    Nijhuis, Arend; ten Kate, Herman H.J.

    1994-01-01

    AC losses in cables carrying DC as well as AC transport currents at different DC background fields up to 2T have been measured on three types of Nb3Sn subcables in a new test facility. In this facility it is possible to apply sinusoidal transverse AC fields up to dB/dt=5T/s and longitudinal AC

  10. Transport AC losses in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

    2007-09-15

    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  11. Hysteresis losses in MgB{sub 2} superconductors exposed to combinations of low AC and high DC magnetic fields and transport currents

    Energy Technology Data Exchange (ETDEWEB)

    Magnusson, N., E-mail: niklas.magnusson@sintef.no [SINTEF Energy Research, NO-7465 Trondheim (Norway); Abrahamsen, A.B. [DTU Wind Energy, Technical University of Denmark, DK-4000 Roskilde (Denmark); Liu, D. [Electrical Power Processing Group, TU Delft, Mekelweg 4, NL-2628 CD Delft (Netherlands); Runde, M. [SINTEF Energy Research, NO-7465 Trondheim (Norway); Polinder, H. [Electrical Power Processing Group, TU Delft, Mekelweg 4, NL-2628 CD Delft (Netherlands)

    2014-11-15

    Highlights: • A method for calculating hysteresis losses in the low AC – high DC magnetic field and transport current range has been shown. • The method can be used in the design of wind turbine generators for calculating the losses in the generator DC rotor. • First estimates indicate tolerable current ripple in the 0.1% range for a 4 T DC MgB{sub 2} generator rotor coil. - Abstract: MgB{sub 2} superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must be evaluated in the design of the generator to ensure a sufficient overall efficiency. A major loss component is the hysteresis losses in the superconductor itself. In the high DC – low AC current and magnetic field region experimental results still lack for MgB{sub 2} conductors. In this article we reason towards a simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting equations use the DC in-field critical current, the geometry of the superconductor and the magnitude of the AC magnetic field component as parameters. This simplified approach can be valuable in the design of MgB{sub 2} DC coils in the 1–4 T range with low AC magnetic field and current ripples.

  12. Quench behavior of Sr{sub 0.6}K{sub 0.4}Fe{sub 2}As{sub 2}/Ag tapes with AC and DC transport currents at different temperature

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Qi [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China); Institute of Science, Information Engineering University, Zhengzhou 450001 (China); Zhang, Guomin, E-mail: gmzhang@mail.iee.ac.cn [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); Yang, Hua [Institute of Science, Information Engineering University, Zhengzhou 450001 (China); Li, Zhenming; Liu, Wei [China Electric Power Research Institute, Beijing 100192 (China); Jing, Liwei [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); Yu, Hui; Liu, Guole [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China)

    2016-09-15

    Highlights: • Quench behavior of Sr{sub 0.6}K{sub 0.4}Fe{sub 2}As{sub 2}/ Ag tape with AC transport current was reported for the first time. • The measurement are performed as a function of different temperature (20 K–30 K), transport current (AC and DC) and operating frequency (50 Hz–250 Hz). • The study is concentrated on the research of quench development, and the discussions of NZPV and MQE values. - Abstract: In applications, superconducting wires may carry AC or DC transport current. Thus, it is important to understand the behavior of normal zone propagation in conductors and magnets under different current conditions in order to develop an effective quench protection system. In this paper, quench behavior of Ag sheathed Sr{sub 0.6}K{sub 0.4}Fe{sub 2}As{sub 2} (Sr-122 in the family of iron-based superconductor) tapes with AC and DC transport current is reported. The measurements are performed as a function of different temperature (20 K–30 K), varying transport current and operating frequency (50 Hz–250 Hz). The focus of the research is the minimum quench energy (MQE), the normal zone propagation velocity (NZPV) and the comparison of the related results with AC and DC transport current.

  13. Proportional-Integral-Resonant AC Current Controller

    Directory of Open Access Journals (Sweden)

    STOJIC, D.

    2017-02-01

    Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

  14. Hysteresis losses in MgB2 superconductors exposed to combinations of low AC and high DC magnetic fields and transport currents

    DEFF Research Database (Denmark)

    Magnusson, N.; Abrahamsen, Asger Bech; Liu, Dawei

    2014-01-01

    MgB2 superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must...... a simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting...

  15. Transcranial alternating current stimulation (tACS

    Directory of Open Access Journals (Sweden)

    Andrea eAntal

    2013-06-01

    Full Text Available Transcranial alternating current stimulation (tACS seems likely to open a new era of the field of noninvasive electrical stimulation of the human brain by directly interfering with cortical rhythms. It is expected to synchronize (by one single resonance frequency or desynchronize (e.g. by the application of several frequencies cortical oscillations. If applied long enough it may cause neuroplastic effects. In the theta range it may improve cognition when applied in phase. Alpha rhythms could improve motor performance, whereas beta intrusion may deteriorate them. TACS with both alpha and beta frequencies has a high likelihood to induce retinal phosphenes. Gamma intrusion can possibly interfere with attention. Stimulation in the ripple range induces intensity dependent inhibition or excitation in the motor cortex most likely by entrainment of neuronal networks, whereas stimulation in the low kHz range induces excitation by neuronal membrane interference. TACS in the 200 kHz range may have a potential in oncology.

  16. Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

    Directory of Open Access Journals (Sweden)

    Amir V. Tavakoli

    2017-09-01

    Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

  17. A method for decreasing transport ac losses in multifilamentary and multistrip superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Glowacki, B A [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom); IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Majoros, M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom)

    2000-07-01

    A new method is proposed for decreasing transport ac losses in multifilamentary superconductors by the decoupling of the filaments using a magnetic material in the form of thin layers surrounding the individual filaments. For a superconductor with an elliptical cross section, the magnetic material surrounding the filaments affects the local magnetic field distribution that both reduces the critical current of the filaments and induces the transport ac losses in the magnetic material. Even by taking into account any detrimental influences of the presence of the magnetic material around the filaments, the analysis of the experimental data supported by computer modelling confirmed that for a Bi2223 tape with 100 filaments individually covered by magnetic material, such as iron powder, the transport ac losses should be 65 times lower than for the same multifilamentary conductor without the magnetic coating on the filaments. With an increasing number of filaments, the ac loss decrease would be even larger. (author)

  18. Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential

    Science.gov (United States)

    Frank, A.; Heller, R.; Goldacker, W.; Kling, A.; Schmidt, C.

    2008-02-01

    Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability.

  19. Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential

    International Nuclear Information System (INIS)

    Frank, A; Heller, R; Goldacker, W; Kling, A; Schmidt, C

    2008-01-01

    Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability

  20. A.C. losses in current-carrying superconductors

    International Nuclear Information System (INIS)

    Reuver, J.L. de.

    1985-01-01

    The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)

  1. Geometry dependence of magnetic and transport AC losses in Bi-2223/Ag tapes with different aspect ratios

    Energy Technology Data Exchange (ETDEWEB)

    Fang, J [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Luo, X M [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Chen, D X [ICREA and Grup Electromagnetisme, Departament de Fisica, Universitat Autonoma Barcelona, 08193 Bellaterra (Spain); Alamgir, A K M [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Collings, E W [MSE, Ohio State University, Columbus, OH 43210 (United States); Lee, E [MSE, Ohio State University, Columbus, OH 43210 (United States); Sumption, M D [MSE, Ohio State University, Columbus, OH 43210 (United States); Fang, J G [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Yi, H P [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Song, X H [Innova Superconductor Technology Co., Ltd, 7 Rongchang Dongjie, Longsheng Industrial Park, Beijing Economic and Technological Development Area, 100176 (China); Guo, S Q [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Liu, M L [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Xin, Y [Innopower Superconductor Cable Co., Ltd, 7 Rongchang Dongjie, Longsheng Industrial Park, Beijing Economic and Technological Development Area, 100176 (China); Han, Z [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)

    2004-10-01

    On five Bi-2223/Ag tapes with different aspect ratios from 5 to 26, AC losses have been measured at 77 K while a parallel AC magnetic field or a perpendicular AC magnetic field or a longitudinal AC transport current is applied. It has been found that at any frequency the perpendicular magnetic losses per cycle increase, but the parallel magnetic losses per cycle and the transport losses per cycle decrease as the aspect ratio increases. These experimental results are in accord with theoretical results. Meanwhile, we investigated the geometry dependence of the decay time constant of coupling current and that of full penetration field.

  2. Geometry dependence of magnetic and transport AC losses in Bi-2223/Ag tapes with different aspect ratios

    International Nuclear Information System (INIS)

    Fang, J; Luo, X M; Chen, D X; Alamgir, A K M; Collings, E W; Lee, E; Sumption, M D; Fang, J G; Yi, H P; Song, X H; Guo, S Q; Liu, M L; Xin, Y; Han, Z

    2004-01-01

    On five Bi-2223/Ag tapes with different aspect ratios from 5 to 26, AC losses have been measured at 77 K while a parallel AC magnetic field or a perpendicular AC magnetic field or a longitudinal AC transport current is applied. It has been found that at any frequency the perpendicular magnetic losses per cycle increase, but the parallel magnetic losses per cycle and the transport losses per cycle decrease as the aspect ratio increases. These experimental results are in accord with theoretical results. Meanwhile, we investigated the geometry dependence of the decay time constant of coupling current and that of full penetration field

  3. Current Control of Grid Converters Connected with Series AC Capacitor

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Blaabjerg, Frede; Loh, Poh Chiang

    2015-01-01

    The series ac capacitor has recently been used with the transformerless grid-connected converters in the distribution power grids. The capacitive characteristic of the resulting series LC filter restricts the use of conventional synchronous integral or stationary resonant current controllers. Thus...... this paper proposes a fourth-order resonant controller in the stationary frame, which guarantees a zero steady-state current tracking error for the grid converters with series LC filter. This method is then implemented in a three-phase experimental system for verification, where the current harmonics below...... the LC filter resonance frequency are effectively eliminated. Experimental results confirm the validity of the proposed current control scheme....

  4. AC/DC current ratio in a current superimposition variable flux reluctance machine

    Science.gov (United States)

    Kohara, Akira; Hirata, Katsuhiro; Niguchi, Noboru; Takahara, Kazuaki

    2018-05-01

    We have proposed a current superimposition variable flux reluctance machine for traction motors. The torque-speed characteristics of this machine can be controlled by increasing or decreasing the DC current. In this paper, we discuss an AC/DC current ratio in the current superimposition variable flux reluctance machine. The structure and control method are described, and the characteristics are computed using FEA in several AC/DC ratios.

  5. International comparison of AC-DC current transfer standards

    Science.gov (United States)

    Heine, G.; Garcocz, M.; Waldmann, W.

    2017-01-01

    The measurements of the international comparison of ac-dc current transfer standards identified as EURAMET.EM-K12 started in June 2012 and were completed in December 2014. Twenty NMIs in the EURAMET region and one NMI in the AFRIMET region took part: BEV (Austria), CMI (Czech Republic), PTB (Germany), METAS (Switzerland), JV (Norway), UME (Turkey), GUM (Poland), IPQ (Portugal), CEM (Spain), INRIM (Italy), SP (Sweden), DANIAmet-MI-Trescal (Denmark), BIM (Bulgaria), MKEH (Hungary), SIQ (Slovenia), LNE (France), NSAI NML (Ireland), VSL (The Netherlands), NPL (United Kingdom), Metrosert (Estonia), NIS (Egypt). The comparison was proposed to link the National Metrology Institutes organised in EURAMET to the key comparison CCEM-K12. The ac-dc current transfer difference of each travelling standard had been measured at its nominal current 10 mA and 5 A at the following frequencies: 10 Hz, 55 Hz, 1 kHz, 10 kHz, 20 kHz, 50 kHz, 100 kHz. The test points were selected to link the results with the equivalent CCEM Key Comparison (CCEM-K12), through five NMIs participating in both EURAMET and CCEM key comparisons (PTB, JV, NPL, SP and BEV). The report shows the degree of equivalence in the EURAMET region and also the degree of equivalence with the corresponding CCEM reference value. Main text To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCEM, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).

  6. AC losses in a type II superconductor strip with inhomogeneous critical current distribution

    International Nuclear Information System (INIS)

    Tsukamoto, Osami

    2005-01-01

    Analytical formulae derived by Brandt and Indenbom (1993 Phys. Rev. B 48 12893-906) and Norris (1970 J. Phys. D: Appl. Phys. 3 489-507) are often used to calculate the magnetization and AC transport current losses in HTS strip conductors, respectively. In these formulae, homogeneous distribution of critical sheet current density σ c in the strip is assumed. However, it is considered that σ c distributions are inhomogeneous in actual HTS strips and that the inhomogeneous σ c distributions cause deviations of the measured AC loss data of actual HTS strips from those formulae. A semi-analytical method to calculate AC transport current and magnetization losses is derived for a type II superconductor strip with inhomogeneous distribution of σ c in the direction of the strip width. The method is derived modifying the analysis of Brandt et al. The validity of the semi-analytical method is shown by comparing the results calculated by this method with those calculated by the Norris and Brandt formulae and by a different method of our previous work and also with experimental data. Moreover, it is shown that the deviation of the measured data from the Norris and Brandt models can be estimated by assuming proper σ c distributions

  7. AC magnetic transport on heterogeneous ferromagnetic wires and tubes

    International Nuclear Information System (INIS)

    Sinnecker, J.P.; Pirota, K.R.; Knobel, M.; Kraus, L.

    2002-01-01

    The AC current density radial distribution is calculated on heterogeneous composite materials with cylindrical geometry. The composites have an inner core and thin outer shell that can be either from the same material (homogenous material like simple wires) or from different materials with different physical properties. The case in which a non-magnetic inner core is surrounded by a magnetic layer, like electrodeposited wires, is mainly studied. The effect of frequency and applied magnetic field is simulated. The current density distribution as a function of frequency and applied field, as well as the total current over the inner core and outer shells are calculated. The results agree substantially well with the experimentally observed data for simple electrodeposited wires

  8. Low field critical currents and ac losses of thin film niobium--tin superconductors

    International Nuclear Information System (INIS)

    Howard, R.E.

    1977-01-01

    The results of a study of the low field critical current and ac loss properties of niobium-tin thin films and layered composites fabricated by electron-beam coevaporation are presented. Particular emphasis is placed upon determining the suitability of this material for use as a conductor in a superconducting power transmission line. Chapter I contains a summary of this work and its major results together with an introduction to the scientific and engineering concepts associated with a superconducting power transmission line. Chapter II is a discussion of the physics of current transport and the associated loss mechanisms in a type-II superconductor. Chapter III gives the details of the electron-beam coevaporation technique developed to fabricate the samples for this study. Also discussed in this chapter are the effects of the evaporation conditions on the growth morphology of the niobium-tin films. Chapter IV presents the details of the experimental techniques developed to measure the ac loss and critical current in these samples as a function of temperature. Chapter V shows the dependence of the critical current of these films and composites on temperature, magnetic field, and on the number of artificially introduced pinning centers in the layered composites. Experimental results are also presented concerning the stability of these conductors against flux jumps. Chapter VI is a discussion of the ac losses in these samples. Detailed comparisons are made between the measured loss and the predictions of the critical state model

  9. Transport ac loss studies of YBCO coated conductors with nickel alloy substrates

    International Nuclear Information System (INIS)

    Duckworth, R C; Thompson, J R; Gouge, M J; Lue, J W; Ijaduola, A O; Yu, D; Verebelyi, D T

    2003-01-01

    Transport alternating current (ac) loss measurements were performed on a series of rolling-assisted biaxially textured substrate (RABiTS) processed YBa 2 Cu 3 O x (YBCO) coated conductors at 77 K. While each sample possessed a 1 μm layer of YBCO and a 3 μm silver cap layer, two different nickel alloy substrates were used and their impact on the ac loss was examined. Both substrates possessed a 75 μm Ni-5 at%W base, but one substrate also had a 2 μm nickel overlayer as part of the buffer layer architecture. The ac losses, which were determined by thermal and electrical measurements, contained two dominant contributions: superconductive hysteresis in the YBCO and ferromagnetic hysteresis in the substrates. The superconductive component followed the Norris elliptic model for the substrate with the nickel overlayer and the Norris thin strip model for the substrate without the nickel overlayer. The substrates' ferromagnetic loss was determined separately through magnetization measurements, which showed that this loss contribution was independent of the presence of the nickel overlayer for effective ac currents less than 50 A. While the overall loss was lower for the thin-strip-like conductor with no nickel overlayer, further research is necessary to strengthen this connection

  10. Reducing AC-Winding Losses in High-Current High-Power Inductors

    DEFF Research Database (Denmark)

    Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.

    2009-01-01

    Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper ...

  11. Transport ac loss in a rectangular thin strip with power-law E(J) relation

    International Nuclear Information System (INIS)

    Li, Shuo; Chen, Du-Xing; Fan, Yu; Fang, Jin

    2015-01-01

    Highlights: • Transport ac loss in a thin strip with power-law E(J) is systematically computed. • The scaled results can be accurately used for strips with any critical current and frequency. • Experiments may be unambiguously compared with modeling results at a critical frequency. - Abstract: Transport ac losses of a rectangular thin strip obeying relation E/E c =(J/J c ) n with a fixed critical current I c and n=5,10,20,30, and 40 are accurately computed at a fixed frequency f as functions of the current amplitude I m . The results may be interpolated and scaled to those at any values of I c ,f, and 5⩽n⩽40. Normalized in the same way as that in Norris’ analytical formula derived from the critical-state model and converting f to a critical frequency f c , the modeling results may be better compared with the Norris formula and experimental data. A complete set of calculated modeling data are given with necessary formulas to be easily used by experimentalists in any particular case

  12. Interlink Converter with Linear Quadratic Regulator Based Current Control for Hybrid AC/DC Microgrid

    Directory of Open Access Journals (Sweden)

    Dwi Riana Aryani

    2017-11-01

    Full Text Available A hybrid alternate current/direct current (AC/DC microgrid consists of an AC subgrid and a DC subgrid, and the subgrids are connected through the interlink bidirectional AC/DC converter. In the stand-alone operation mode, it is desirable that the interlink bidirectional AC/DC converter manages proportional power sharing between the subgrids by transferring power from the under-loaded subgrid to the over-loaded one. In terms of system security, the interlink bidirectional AC/DC converter takes an important role, so proper control strategies need to be established. In addition, it is assumed that a battery energy storage system is installed in one subgrid, and the coordinated control of interlink bidirectional AC/DC converter and battery energy storage system converter is required so that the power sharing scheme between subgrids becomes more efficient. For the purpose of designing a tracking controller for the power sharing by interlink bidirectional AC/DC converter in a hybrid AC/DC microgrid, a droop control method generates a power reference for interlink bidirectional AC/DC converter based on the deviation of the system frequency and voltages first and then interlink bidirectional AC/DC converter needs to transfer the power reference to the over-loaded subgrid. For efficiency of this power transferring, a linear quadratic regulator with exponential weighting for the current regulation of interlink bidirectional AC/DC converter is designed in such a way that the resulting microgrid can operate robustly against various uncertainties and the power sharing is carried out quickly. Simulation results show that the proposed interlink bidirectional AC/DC converter control strategy provides robust and efficient power sharing scheme between the subgrids without deteriorating the secure system operation.

  13. Complex study of transport AC loss in various 2G HTS racetrack coils

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Yiran, E-mail: yc315@cam.ac.uk [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Zhang, Min; Chudy, Michal; Matsuda, Koichi; Coombs, Tim [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom)

    2013-04-15

    Highlights: ► Comparing transport AC losses of two types of 2G HTS racetrack coils. ► The magnetic substrate in the MAG RABITS coil is the main difference. ► Experimental data agree well with simulation results. ► The transport AC loss in the MAG RABITS coil is 36% higher than that in the IBAD coil. ► It is better to keep all the substrate non-magnetic. -- Abstract: HTS racetrack coils are becoming important elements of an emerging number of superconducting devices such as generators or motors. In these devices the issue of AC loss is crucial, as performance and cooling power are derived from this quantity. This paper presents a comparative study of transport AC loss in two different types of 2G HTS racetrack coils. In this study, both experimental measurements and computer simulation approaches were employed. All the experiments were performed using classical AC electrical method. The finite-element computer model was used to estimate electromagnetic properties and calculate transport AC loss. The main difference between the characterized coils is covered inside tape architectures. While one coil uses tape based on RABITS magnetic substrate, the second coil uses a non-magnetic tape. Ferromagnetic loss caused by a magnetic substrate is an important issue involved in the total AC loss. As a result, the coil with the magnetic substrate surprised with high AC loss and rather low performance.

  14. DC Vs AC - War Of Currents For Future Power Systems A HVDC Technology Overview

    Directory of Open Access Journals (Sweden)

    Anil K. Rai

    2015-08-01

    Full Text Available DC vs AC discussion began in 1880s with development of first commercial power transmission in Wall Street New York. Later when AC technology came into notice by efforts of inventor and researcher Sir Nicola Tesla soon the advantages of AC transmission and AC devices overtook the DC technology. It was hoped that DC technology had lost battle of currents. Today with researches going on FACTS devices and bulk power transmission HVDC has again gained a reputation in power sector. Solution of this centuries old debate is to develop HVDC systems that assists HVAC systems for better performance stability and control

  15. Self-field AC losses and critical currents in multi-tube Ag-Bi-2223 conductors

    Energy Technology Data Exchange (ETDEWEB)

    Ciszek, M; Ashworth, S P; Campbell, A M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); James, M P; Glowacki, B A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom); Garre, R; Conti, S [Centro Ricerche Europa Metalli, Fornaci di Barga, LU (Italy)

    1996-05-01

    The purpose of this work was to investigate the influence of different technological treatments of silver sheathed Bi-2223 tapes on the critical current density and the AC transport losses. The tapes were produced using the 'tube-in-tube' technique, by including a silver rod in the centre of the superconducting powder during packing of the silver tube. The aim of the process is to increase the silver to superconductor surface area and thus also the alignment at the centre of the conductor ceramic core. AC transport losses were measured by means of an electrical method using sinusoidally varying currents in the frequency range 30-180 Hz. In this range the power losses are hysteretic. The measured variation in losses from those predicted by a critical state model is attributed to the complex geometry of superconducting regions existing in these tapes. (author)

  16. Entropic transport of active particles driven by a transverse ac force

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Jian-chun, E-mail: wjchun2010@163.com; Chen, Qun; Ai, Bao-quan, E-mail: aibq@scnu.edu.cn

    2015-12-18

    Transport of active particles is numerically investigated in a two-dimensional period channel. In the presence of a transverse ac force, the directed transport of active particles demonstrates striking behaviors. By adjusting the amplitude and the frequency of the transverse ac force, the average velocity will be influenced significantly and the direction of the transport can be reversed several times. Remarkably, it is also found that the direction of the transport varies with different self-propelled speeds. Therefore, particles with different self-propelled speeds will move to the different directions, which is able to separate particles of different self-propelled speeds. - Highlights: • A transverse ac force strongly influence the transport of active particles. • The direction of the transport can be reversed several times. • Active particles with different self-propelled speeds can be separated.

  17. Critical current density measurement of thin films by AC susceptibility based on the penetration parameter h

    DEFF Research Database (Denmark)

    Li, Xiao-Fen; Grivel, Jean-Claude; Abrahamsen, Asger B.

    2012-01-01

    We have numerically proved that the dependence of AC susceptibility χ of a E(J) power law superconducting thin disc on many parameters can be reduced to one penetration parameter h, with E the electric field and J the current density. Based on this result, we propose a way of measuring the critical...... current density Jc of superconducting thin films by AC susceptibility. Compared with the normally used method based on the peak of the imaginary part, our method uses a much larger range of the AC susceptibility curve, thus allowing determination of the temperature (T) dependence of Jc from a normally...

  18. Magnetic Particle inspection by DC and AC magnetization current

    International Nuclear Information System (INIS)

    Lim, Zhong Soo; Kim, Goo Hwa

    1996-01-01

    Dry magnetic particle inspection was performed to detect the surface defects of the steel billets. The detectability was evaluated according to magnetizing current, temperature, and amount of the magnetic particles on material. We selected a certain set of steel compositions for target materials. Their magnetic properties are measured with B-H hysteresis graph. Results of the magnetic particle inspection(MPI) by direct magnetizing current was compared with results of the finite element method calculations, which were verified by measurement of the magnetic leakage flux above the surface of material. For square rod materials, the magnetic flux density at the corner was about 30% of that at the face center with sufficiently large direct magnetizing current, while it is about 70% with alternating magnetizing current. Alternating magnetizing current generates rather uniform magnetic flux density running from the center to the corner except for the region of about 10 mm extending from the corner.

  19. Transport ac losses in Bi-2223 multifilamentary tapes - conductor materials aspect

    Energy Technology Data Exchange (ETDEWEB)

    Glowacki, B A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge BC2 3QZ (United Kingdom); Majoros, M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Institute of Electrical Engineering, SAS, Bratislava (Slovakia)

    2000-05-01

    Transport ac losses in technical superconductors based on Bi-2223 tape material are influenced by many parameters. The major factors that define the ac performance of such conductors are the following: the size and number of filaments, their geometrical arrangement in the cross-section of the conductor, the twist pitch length, the resistivity of the matrix, the presence of oxide barriers around the filaments and deformation procedures such as sequential pressing or rolling followed by appropriate thermal treatment. In the present paper the above aspects are addressed from the viewpoint of the materials science of technical conductor design. Transport ac losses at power frequencies in different types of Bi-2223 conductor are presented and analysed. The results of conductor design analysis with respect to the coexistence of the superconductor with other materials in the conductor structure are presented. New concepts for minimization of the transport ac losses are discussed in detail. (author)

  20. Calculating transport AC losses in stacks of high temperature superconductor coated conductors with magnetic substrates using FEM

    International Nuclear Information System (INIS)

    Ainslie, Mark D.; Flack, Tim J.; Campbell, Archie M.

    2012-01-01

    Properties of stacks of HTS coated conductors with and without a magnetic substrate. Non-magnetic substrate model is consistent with existing methods. Presence of a magnetic substrate increases the total AC loss of the stack. Differences and similarities between certain tapes within stacks are explained. Ferromagnetic loss of substrate negligible in most cases except small currents/fields. In this paper, the authors investigate the electromagnetic properties of stacks of high temperature superconductor (HTS) coated conductors with a particular focus on calculating the total transport AC loss. The cross-section of superconducting cables and coils is often modeled as a two-dimensional stack of coated conductors, and these stacks can be used to estimate the AC loss of a practical device. This paper uses a symmetric two dimensional (2D) finite element model based on the H formulation, and a detailed investigation into the effects of a magnetic substrate on the transport AC loss of a stack is presented. The number of coated conductors in each stack is varied from 1 to 150, and three types of substrate are compared: non-magnetic weakly magnetic and strongly magnetic. The non-magnetic substrate model is comparable with results from existing models for the limiting cases of a single tape (Norris) and an infinite stack (Clem). The presence of a magnetic substrate increases the total AC loss of the stack, due to an increased localized magnetic flux density, and the stronger the magnetic material, the further the flux penetrates into the stack overall. The AC loss is calculated for certain tapes within the stack, and the differences and similarities between the losses throughout the stack are explained using the magnetic flux penetration and current density distributions in those tapes. The ferromagnetic loss of the substrate itself is found to be negligible in most cases, except for small magnitudes of current. Applying these findings to practical applications, where AC

  1. Transport, shot noise, and topology in AC-driven dimer arrays

    Science.gov (United States)

    Niklas, Michael; Benito, Mónica; Kohler, Sigmund; Platero, Gloria

    2016-11-01

    We analyze an AC-driven dimer chain connected to a strongly biased electron source and drain. It turns out that the resulting transport exhibits fingerprints of topology. They are particularly visible in the driving-induced current suppression and the Fano factor. Thus, shot noise measurements provide a topological phase diagram as a function of the driving parameters. The observed phenomena can be explained physically by a mapping to an effective time-independent Hamiltonian and the emergence of edge states. Moreover, by considering quantum dissipation, we determine the requirements for the coherence properties in a possible experimental realization. For the computation of the zero-frequency noise, we develop an efficient method based on matrix-continued fractions.

  2. Modeling A.C. Electronic Transport through a Two-Dimensional Quantum Point Contact

    International Nuclear Information System (INIS)

    Aronov, I.E.; Beletskii, N.N.; Berman, G.P.; Campbell, D.K.; Doolen, G.D.; Dudiy, S.V.

    1998-01-01

    We present the results on the a.c. transport of electrons moving through a two-dimensional (2D) semiconductor quantum point contact (QPC). We concentrate our attention on the characteristic properties of the high frequency admittance (ωapproximately0 - 50 GHz), and on the oscillations of the admittance in the vicinity of the separatrix (when a channel opens or closes), in presence of the relaxation effects. The experimental verification of such oscillations in the admittance would be a strong confirmation of the semi-classical approach to the a.c. transport in a QPC, in the separatrix region

  3. A Floquet-Green's function approach to mesoscopic transport under ac bias

    International Nuclear Information System (INIS)

    Wu, B H; Cao, J C

    2008-01-01

    The current response of a mesoscopic system under a periodic ac bias is investigated by combining the Floquet theorem and the nonequilibrium Green's function method. The band structure of the lead under ac bias is fully taken into account by using appropriate self-energies in an enlarged Floquet space. Both the retarded and lesser Green's functions are obtained in the Floquet basis to account for the interference and interaction effects. In addition to the external ac bias, the time-varying Coulomb interaction, which is treated at the self-consistent Hartree-Fock level, provides another internal ac field. The numerical results show that the time-varying Coulomb field yields decoherence and reduces the ringing behavior of the current response to a harmonic bias

  4. AC over-current test results of YBCO conductor for YBCO power transformer with fault current limiting function

    International Nuclear Information System (INIS)

    Tomioka, A.; Otonari, T.; Ogata, T.; Iwakuma, M.; Okamoto, H.; Hayashi, H.; Iijima, Y.; Saito, T.; Gosho, Y.; Tanabe, K.; Izumi, T.; Shiohara, Y.

    2011-01-01

    The single-layer coils with a diameter of 250 mm and 12 turns were manufactured with YBCO tapes with a CuNi- or Cu-Tape. The AC over-current tests were carried out in subcooled liquid nitrogen at 66 K and 74 K to develop power transformers with current limiting function. The AC over-current was two to seven times larger than the I c of conductor and it was reduced to the same level of I c . The I c of model coils did not degrade. The test results showed the possibility of YBCO superconducting transformers with current limiting function. We are developing elemental technology for 66 kV/6.9 kV 20 MVA-class YBCO power transformer. The YBCO transformer is considered to have a possibility to stabilize the power system by improving function of fault current limiting. Current limiting behavior functions over critical current flows. There is a possibility that superconducting characteristic may be damaged due to increase in temperature of YBCO tapes. Therefore, we have taken a measure to combine YBCO tape with CuNi tape or Cu Tape. We manufactured model coils using these conductors and conducted the AC over-current tests. The test current was two to seven times larger than the I c of conductor and it was damped with time from its maximum value according to the generation of conductor resistance. We verified the effectiveness of current limiting characteristics. In these tests, the I c of model coil did not degrade. We consider this conductor to be able to withstand AC over-current with the function of current limiting.

  5. Pumping $ac$ Josephson current in the Single Molecular Magnets by spin nutation

    OpenAIRE

    Abdollahipour, B.; Abouie, J.; Rostami, A. A.

    2012-01-01

    We demonstrate that an {\\it ac} Josephson current is pumped through the Single Molecular Magnets (SMM) by the spin nutation. The spin nutation is generated by applying a time dependent magnetic field to the SMM. We obtain the flowing charge current through the junction by working in the tunneling limit and employing Green's function technique. At the resonance conditions some discontinuities and divergencies are appeared in the normal and Josephson currents, respectively. Such discontinuities...

  6. Experiment of enhancing critical current and reducing ac loss in pancake coil comprised of Ni-coated Bi-2223/Ag tape

    International Nuclear Information System (INIS)

    Alamgir, A.K.M.; Gu, C.; Han, Z.

    2006-01-01

    An approach of realizing high performance HTS coil comprised of ferromagnetic material-coated BSCCO tape is proposed. The concept of influencing critical current and ac loss is based on the magnetic shielding effect resulting in redirection of self-field flux-lines. In the previous article, ac performance of Ni-coated tape was demonstrated where the Ni-coating was introduced at the edge-regime of the finished tape in order to redirect the perpendicular component of self-field lines. In order to investigate the shielding effect on ac performance in HTS coil, a two-turn pancake coil comprised of Ni-coated Bi-2223/Ag tape is demonstrated in the present article. About 6.4% of critical current was enhanced and 30% of transport current ac loss was reduced by means of 40 μm thick and 0.3 mm long (from the edge toward center of the tape) Ni-coating. This result suggests that additional ferromagnetic loss could be compensated well by the shielding effect of the partial Ni-coating. The degree of enhancement in critical current as well as ferromagnetic impact on ac losses depend on the volume and geometry of ferromagnetic coating introduced. Therefore, it is very important to control the parameter of ferromagnetic coating of the tape in order to balance the critical current and ac loss for optimum coil performance

  7. Experiment of enhancing critical current and reducing ac loss in pancake coil comprised of Ni-coated Bi-2223/Ag tape

    Energy Technology Data Exchange (ETDEWEB)

    Alamgir, A.K.M. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)]. E-mail: alam643@hotmail.com; Gu, C. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Han, Z. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)

    2006-07-01

    An approach of realizing high performance HTS coil comprised of ferromagnetic material-coated BSCCO tape is proposed. The concept of influencing critical current and ac loss is based on the magnetic shielding effect resulting in redirection of self-field flux-lines. In the previous article, ac performance of Ni-coated tape was demonstrated where the Ni-coating was introduced at the edge-regime of the finished tape in order to redirect the perpendicular component of self-field lines. In order to investigate the shielding effect on ac performance in HTS coil, a two-turn pancake coil comprised of Ni-coated Bi-2223/Ag tape is demonstrated in the present article. About 6.4% of critical current was enhanced and 30% of transport current ac loss was reduced by means of 40 {mu}m thick and 0.3 mm long (from the edge toward center of the tape) Ni-coating. This result suggests that additional ferromagnetic loss could be compensated well by the shielding effect of the partial Ni-coating. The degree of enhancement in critical current as well as ferromagnetic impact on ac losses depend on the volume and geometry of ferromagnetic coating introduced. Therefore, it is very important to control the parameter of ferromagnetic coating of the tape in order to balance the critical current and ac loss for optimum coil performance.

  8. Compensation methods applied in current control schemes for large AC drive systems

    DEFF Research Database (Denmark)

    Rus, D. C.; Preda, N. S.; Teodorescu, Remus

    2012-01-01

    The paper deals with modified PI current control structures for large AC drive systems which use surface mounted permanent magnet synchronous machines or squirrel-cage induction motors supplied with voltage source inverters. In order to reduce the power losses caused by high frequency switching...

  9. Accounting for Dark Current Accumulated during Readout of Hubble's ACS/WFC Detectors

    Science.gov (United States)

    Ryon, Jenna E.; Grogin, Norman A.; Coe, Dan A.; ACS Team

    2018-06-01

    We investigate the properties of excess dark current accumulated during the 100-second full-frame readout of the Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) detectors. This excess dark current, called "readout dark", gives rise to ambient background gradients and hot columns in each ACS/WFC image. While readout dark signal is removed from science images during the bias correction step in CALACS, the additional noise from the readout dark is currently not taken into account. We develop a method to estimate the readout dark noise properties in ACS/WFC observations. We update the error (ERR) extensions of superbias images to include the appropriate noise from the ambient readout dark gradient and stable hot columns. In recent data, this amounts to about 5 e-/pixel added variance in the rows farthest from the WFC serial registers, and about 7 to 30 e-/pixel added variance along the stable hot columns. We also flag unstable hot columns in the superbias data quality (DQ) extensions. The new reference file pipeline for ACS/WFC implements these updates to our superbias creation process.

  10. AC losses in superconductors: a multi-scale approach for the design of high current cables

    International Nuclear Information System (INIS)

    Escamez, Guillaume

    2016-01-01

    The work reported in this PhD deals with AC losses in superconducting material for large scale applications such as cables or magnets. Numerical models involving FEM or integral methods have been developed to solve the time transient electromagnetic distributions of field and current densities with the peculiarity of the superconducting constitutive E-J equation. Two main conductors have been investigated. First, REBCO superconductors for applications operating at 77 K are studied and a new architecture of conductor (round wires) for 3 kA cables. Secondly, for very high current cables, 3-D simulations on MgB_2 wires are built and solved using FEM modeling. The following chapter introduced new development used for the calculation of AC losses in DC cables with ripples. The thesis ends with the use of the developed numerical model on a practical example in the european BEST-PATHS project: a 10 kA MgB_2 demonstrator [fr

  11. Study of plasma equilibrium during the AC current reversal phase in STOR-M

    International Nuclear Information System (INIS)

    Xiao, C.

    2002-01-01

    Alternating current (AC) tokamak operation and equilibrium studies have been performed on the STOR-M tokamak. The recent experiments have achieved consistent smooth current reversal through the implementation of a hybrid digital-analog position controller and by careful density control. In order to study the plasma equilibrium during the current reversal phase with negligible rotational transform, a segmented limiter with four isolated conducting plates has been installed. The plates can be connected outside the vacuum vessel, which allows measurements of currents flowing between limiter plates. When the current reversal is smooth with zero dwell time, the hydrogen line emission level and electron density remain finite, indicating a finite particle confinement. The current from the top to the bottom limiter plate is also finite and its direction is consistent with that of the grad-B drift. The observation suggests that the limiter and other conducting structures surrounding the plasmas plays the role, during the current reversal phase of AC tokamak operation, to short out the charge separation arising from the grad-B drift and to maintain a finite particle confinement. (author)

  12. An Annotated Bibliography of High-Voltage Direct-Current Transmission and Flexible AC Transmission (FACTS) Devices, 1991-1993.

    Energy Technology Data Exchange (ETDEWEB)

    Litzenberger, Wayne; Lava, Val

    1994-08-01

    References are contained for HVDC systems, converter stations and components, overhead transmission lines, cable transmission, system design and operations, simulation of high voltage direct current systems, high-voltage direct current installations, and flexible AC transmission system (FACTS).

  13. Finite element modelling of electric currents in AC submerged arc furnaces

    CSIR Research Space (South Africa)

    Mc Dougall, I

    2007-01-01

    Full Text Available and the power ratings is not a hindrance. 2. MATHEMATICAL FORMULATION As the frequency of the current is low, the quasi-static form of Maxwell’s equations is solved. (1) (2) (3) (4) where E denotes the electric field intensity, H the magnetic field... of Electric Currents in AC Submerged Arc Furnaces 637 REFERENCES [1] Bermudez, A., Muniz, M.C., Pena, F. , Bullon, J., “ Numerical Computation of the Electromagnetic Field in the Electrodes of a Three-Phase Arc Furnace”, Int. Jnl for Numerical Methods...

  14. A MEMS AC current sensor for residential and commercial electricity end-use monitoring

    International Nuclear Information System (INIS)

    Leland, E S; Wright, P K; White, R M

    2009-01-01

    This paper presents a novel prototype MEMS sensor for alternating current designed for monitoring electricity end-use in residential and commercial environments. This new current sensor design is comprised of a piezoelectric MEMS cantilever with a permanent magnet mounted on the cantilever's free end. When placed near a wire carrying AC current, the magnet is driven sinusoidally, producing a voltage in the cantilever proportional to the current being measured. Analytical models were developed to predict the applicable magnetic forces and piezoelectric voltage output in order to guide the design of a sensor prototype. This paper also details the fabrication process for this sensor design. Released piezoelectric MEMS cantilevers have been fabricated using a four-mask process and aluminum nitride as the active piezoelectric material. Dispenser-printed microscale composite permanent magnets have been integrated, resulting in the first MEMS-scale prototypes of this current sensor design

  15. Experimental Study on the Influence of AC Stray Current on the Cathodic Protection of Buried Pipe

    Directory of Open Access Journals (Sweden)

    Qingmiao Ding

    2016-01-01

    Full Text Available The size of the damaged area of the coating and its position on the pipeline impacted the cathodic protection potential, and there was a damaged area of the greatest impact value. When damaged area was 300 mm2, the IR drop was the largest, and this situation could easily lead to inadequate protection; when the parallel spacing between pipeline and interference source was unchanged, the measured value curves of cathodic protection potential presented “U” shaped trend with the increasing stray current interference intensity. Under certain parallel spacing between pipeline and interference source, high alternating stray current intensity would cause serious negative offsets, so that the overprotection of the pipeline occurred, and make the coating crack; there was a parallel threshold length. When less than the threshold, the pipe-ground potential increases rapidly with the parallel length increasing. In order to judge whether a pipeline was interference by AC stray current and the risk of stray current corrosion, we should make a comprehensive analysis of the cathodic protection energizing potential, the switch-off potential, AC pipe-soil potential, IR drops, and so on.

  16. Complex state variable- and disturbance observer-based current controllers for AC drives

    DEFF Research Database (Denmark)

    Dal, Mehmet; Teodorescu, Remus; Blaabjerg, Frede

    2013-01-01

    In vector-controlled AC drives, the design of current controller is usually based on a machine model defined in synchronous frame coordinate, where the drive performance may be degraded by both the variation of the machine parameters and the cross-coupling between the d- and q-axes components...... of the stator current. In order to improve the current control performance an alternative current control strategy was proposed previously aiming to avoid the undesired cross-coupling and non-linearities between the state variables. These effects are assumed as disturbances arisen in the closed-loop path...... of the parameter and the cross-coupling effect. Moreover, it provides a better performance, smooth and low noisy operation with respect to the complex variable controller....

  17. An improved FEM model for computing transport AC loss in coils made of RABiTS YBCO coated conductors for electric machines

    International Nuclear Information System (INIS)

    Ainslie, Mark D; Yuan Weijia; Flack, Timothy J; Coombs, Timothy A; Rodriguez-Zermeno, Victor M; Hong Zhiyong

    2011-01-01

    AC loss can be a significant problem for any applications that utilize or produce an AC current or magnetic field, such as an electric machine. The authors investigate the electromagnetic properties of high temperature superconductors with a particular focus on the AC loss in superconducting coils made from YBCO coated conductors for use in an all-superconducting electric machine. This paper presents an improved 2D finite element model for the cross-section of such coils, based on the H formulation. The model is used to calculate the transport AC loss of a racetrack-shaped coil using constant and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC Superconductivity Group's all-superconducting permanent magnet synchronous motor design. To validate the modeling results, the transport AC loss of a stator coil is measured using an electrical method based on inductive compensation by means of a variable mutual inductance. Finally, the implications of the findings on the performance of the motor are discussed.

  18. An improved FEM model for computing transport AC loss in coils made of RABiTS YBCO coated conductors for electric machines

    Energy Technology Data Exchange (ETDEWEB)

    Ainslie, Mark D; Yuan Weijia; Flack, Timothy J; Coombs, Timothy A [Department of Engineering, University of Cambridge, 9 J J Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Rodriguez-Zermeno, Victor M [Department of Mathematics, Technical University of Denmark, Kongens Lyngby 2800 (Denmark); Hong Zhiyong, E-mail: mda36@cam.ac.uk [School of Electronic, Information and Electrical Engineering, Shanghai Jiao Tong University, Shanghai (China)

    2011-04-15

    AC loss can be a significant problem for any applications that utilize or produce an AC current or magnetic field, such as an electric machine. The authors investigate the electromagnetic properties of high temperature superconductors with a particular focus on the AC loss in superconducting coils made from YBCO coated conductors for use in an all-superconducting electric machine. This paper presents an improved 2D finite element model for the cross-section of such coils, based on the H formulation. The model is used to calculate the transport AC loss of a racetrack-shaped coil using constant and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC Superconductivity Group's all-superconducting permanent magnet synchronous motor design. To validate the modeling results, the transport AC loss of a stator coil is measured using an electrical method based on inductive compensation by means of a variable mutual inductance. Finally, the implications of the findings on the performance of the motor are discussed.

  19. ac loss and dc critical current densities of Nb3Sn tapes by the solid state diffusion process

    International Nuclear Information System (INIS)

    Suenaga, M.; Klamut, C.; Bussiere, J.F.

    1976-01-01

    The effects of metallurgical processing on 60 Hz ac losses and dc critical currents in Nb 3 Sn tapes fabricated by the solid state diffusion technique were investigated. An addition of Al to the Cu--Sn alloy for the matrix resulted in large reduction in the ac losses of Nb 3 Sn tapes, but the highest linear critical current densities were observed in Nb 3 Sn tapes produced with a Nb-1 wt percent Zr core in a Cu-13 wt percent Sn matrix. Values of the losses and the critical currents in these tapes can meet the present requirements for the ac superconducting power cables

  20. ac electrokinetic micropumps: The effect of geometrical confinement, Faradaic current injection, and nonlinear surface capacitance

    DEFF Research Database (Denmark)

    Olesen, Laurits Højgaard; Bruus, Henrik; Ajdari, A.

    2006-01-01

    therefore extend the latter theories to account for three experimentally relevant effects: (i) vertical confinement of the pumping channel, (ii) Faradaic currents from electrochemical reactions at the electrodes, and (iii) nonlinear surface capacitance of the Debye layer. We report here that these effects......Recent experiments have demonstrated that ac electrokinetic micropumps permit integrable, local, and fast pumping (velocities similar to mm/s) with low driving voltage of a few volts only. However, they also displayed many quantitative and qualitative discrepancies with existing theories. We...

  1. Current-voltage characteristics of a superconducting slab under a superimposed small AC magnetic field

    International Nuclear Information System (INIS)

    Matsushita, Teruo; Yamafuji, Kaoru; Sakamoto, Nobuyoshi.

    1977-01-01

    In case of applying superconductors to electric machinery or high intensity field magnets for fusion reactors, the superconductors are generally expected to be sensible to small field fluctuation besides DC magnetic field. The behavior of superconductors in DC magnetic field superimposed with small AC magnetic field has been investigated often experimentally, and the result has been obtained that the critical current at which DC flow voltage begins to appear extremely decreased or disappeared. Some theoretical investigations have been carried out on this phenomenon so far, however, their application has been limited to the region where frequency is sufficiently low or which is close to the critical magnetic field. Purpose of this report is to deal with the phenomenon in more unified way by analyzing the behavior of magnetic flux lines in a superconductor under a superimposed small AC field using the criticalstate model including viscous force. In order to solve the fundamental equation in this report, first the solution has been obtained in the quasi-static state neglecting viscous force, then about the cases that current density J is not more than Jc and J is larger than Jc, concerning the deviation from the quasi-static limit by employing successive approximation. Current-voltage characteristics have been determined by utilizing the above results. This method seems to be most promising at present except the case of extremely high frequency. (Wakatsuki, Y.)

  2. Analysis of the ac SQUID with low inductance and low critical current

    DEFF Research Database (Denmark)

    Sørensen, O. H.

    1976-01-01

    The properties of the ac SQUID magnetometer has been analyzed. The results are valid in the low-inductance low-critical-current regime, where the Lri0 producted is belowthe value at which the relation between the enclosed and externally applied magnetic dc flux becomes reentrant. The effects...... of the screening current circulating in the SQUID ring as well as of the SQUID-ring time constant, tau-Lr/R9 are taken into account. Here LR IS THE SQUID-ring inductance, and R is the shunt resistance in the shunted junction model assumed to describe the weak link. It is shown that for finite values of omegatau...... constriuctively with the result that the optimal response occurs at a definite and finite value of omegatau. If omegatau is increased beyond this optimal value the weak link behavior is dominated by the Ohmic current channel implying that only if the shunt conductance contains a term depending...

  3. Measuring ac losses in superconducting cables using a resonant circuit:Resonant current experiment (RESCUE)

    DEFF Research Database (Denmark)

    Däumling, Manfred; Olsen, Søren Krüger; Rasmussen, Carsten

    1998-01-01

    be recorded using, for example, a digital oscilloscope. The amplitude decay of the periodic voltage or current accurately reflects the power loss in the system. It consists of two components-an ohmic purely exponential one (from leads, contacts, etc.), and a nonexponential component originating from......A simple way to obtain true ac losses with a resonant circuit containing a superconductor, using the decay of the circuit current, is described. For the measurement a capacitor is short circuited with a superconducting cable. Energy in the circuit is provided by either charging up the capacitors...... with a certain voltage, or letting a de flow in the superconductor. When the oscillations are started-either by opening a switch in case a de is flowing or by closing a switch to connect the charged capacitors with the superconductor-the current (via a Rogowski coil) or the voltage on the capacitor can...

  4. An ABC transporter mutation is correlated with insect resistance to Bacillus thuringiensis Cry1Ac toxin.

    Directory of Open Access Journals (Sweden)

    Linda J Gahan

    2010-12-01

    Full Text Available Transgenic crops producing insecticidal toxins from Bacillus thuringiensis (Bt are commercially successful in reducing pest damage, yet knowledge of resistance mechanisms that threaten their sustainability is incomplete. Insect resistance to the pore-forming Cry1Ac toxin is correlated with the loss of high-affinity, irreversible binding to the mid-gut membrane, but the genetic factors responsible for this change have been elusive. Mutations in a 12-cadherin-domain protein confer some Cry1Ac resistance but do not block this toxin binding in in vitro assays. We sought to identify mutations in other genes that might be responsible for the loss of binding. We employed a map-based cloning approach using a series of backcrosses with 1,060 progeny to identify a resistance gene in the cotton pest Heliothis virescens that segregated independently from the cadherin mutation. We found an inactivating mutation of the ABC transporter ABCC2 that is genetically linked to Cry1Ac resistance and is correlated with loss of Cry1Ac binding to membrane vesicles. ABC proteins are integral membrane proteins with many functions, including export of toxic molecules from the cell, but have not been implicated in the mode of action of Bt toxins before. The reduction in toxin binding due to the inactivating mutation suggests that ABCC2 is involved in membrane integration of the toxin pore. Our findings suggest that ABC proteins may play a key role in the mode of action of Bt toxins and that ABC protein mutations can confer high levels of resistance that could threaten the continued utilization of Bt-expressing crops. However, such mutations may impose a physiological cost on resistant insects, by reducing export of other toxins such as plant secondary compounds from the cell. This weakness could be exploited to manage this mechanism of Bt resistance in the field.

  5. An ABC transporter mutation is correlated with insect resistance to Bacillus thuringiensis Cry1Ac toxin.

    Science.gov (United States)

    Gahan, Linda J; Pauchet, Yannick; Vogel, Heiko; Heckel, David G

    2010-12-16

    Transgenic crops producing insecticidal toxins from Bacillus thuringiensis (Bt) are commercially successful in reducing pest damage, yet knowledge of resistance mechanisms that threaten their sustainability is incomplete. Insect resistance to the pore-forming Cry1Ac toxin is correlated with the loss of high-affinity, irreversible binding to the mid-gut membrane, but the genetic factors responsible for this change have been elusive. Mutations in a 12-cadherin-domain protein confer some Cry1Ac resistance but do not block this toxin binding in in vitro assays. We sought to identify mutations in other genes that might be responsible for the loss of binding. We employed a map-based cloning approach using a series of backcrosses with 1,060 progeny to identify a resistance gene in the cotton pest Heliothis virescens that segregated independently from the cadherin mutation. We found an inactivating mutation of the ABC transporter ABCC2 that is genetically linked to Cry1Ac resistance and is correlated with loss of Cry1Ac binding to membrane vesicles. ABC proteins are integral membrane proteins with many functions, including export of toxic molecules from the cell, but have not been implicated in the mode of action of Bt toxins before. The reduction in toxin binding due to the inactivating mutation suggests that ABCC2 is involved in membrane integration of the toxin pore. Our findings suggest that ABC proteins may play a key role in the mode of action of Bt toxins and that ABC protein mutations can confer high levels of resistance that could threaten the continued utilization of Bt-expressing crops. However, such mutations may impose a physiological cost on resistant insects, by reducing export of other toxins such as plant secondary compounds from the cell. This weakness could be exploited to manage this mechanism of Bt resistance in the field.

  6. A Robust Suboptimal Current Control of an Interlink Converter for a Hybrid AC/DC Microgrid

    Directory of Open Access Journals (Sweden)

    Ismi Rosyiana Fitri

    2018-05-01

    Full Text Available A hybrid AC/DC microgrid is established with the aim of exploiting numerous types of renewable energy to meet the needs of different loads. The microgrid is decomposed by AC DC sub-grids which are connected by an interlink converter (IC. To maintain the security and reliability of the microgrid, an automatic controller for the interlink converter is needed. In this paper, we propose a Linear Matrix Inequalities (LMI-based current control method for the interlink converter. As the main features here, the interlink converter permits bidirectional power exchange between both sub-grids when a power–demand imbalance occurs in one sub-grid regardless of the converter system parameters. Simulations with various filter parameters are performed using the Matlab/Simulink software to validate the effectiveness of the proposed controller. In comparison with the existing Linear Quadratic Regulator (LQR-based current control, the proposed method is more robust against unknown system parameters and high load perturbation.

  7. Fractional Modeling of the AC Large-Signal Frequency Response in Magnetoresistive Current Sensors

    Directory of Open Access Journals (Sweden)

    Sergio Iván Ravelo Arias

    2013-12-01

    Full Text Available Fractional calculus is considered when derivatives and integrals of non-integer order are applied over a specific function. In the electrical and electronic domain, the transfer function dependence of a fractional filter not only by the filter order n, but additionally, of the fractional order α is an example of a great number of systems where its input-output behavior could be more exactly modeled by a fractional behavior. Following this aim, the present work shows the experimental ac large-signal frequency response of a family of electrical current sensors based in different spintronic conduction mechanisms. Using an ac characterization set-up the sensor transimpedance function  is obtained considering it as the relationship between sensor output voltage and input sensing current,[PLEASE CHECK FORMULA IN THE PDF]. The study has been extended to various magnetoresistance sensors based in different technologies like anisotropic magnetoresistance (AMR, giant magnetoresistance (GMR, spin-valve (GMR-SV and tunnel magnetoresistance (TMR. The resulting modeling shows two predominant behaviors, the low-pass and the inverse low-pass with fractional index different from the classical integer response. The TMR technology with internal magnetization offers the best dynamic and sensitivity properties opening the way to develop actual industrial applications.

  8. Hybrid superconducting a.c. current limiter extrapolation 63 kV-1 250 A

    Science.gov (United States)

    Tixador, P.; Levêque, J.; Brunet, Y.; Pham, V. D.

    1994-04-01

    Following the developement of a.c. superconducting wires a.c. current superconducting limiters have emerged. These limiters limit the fault currents nearly instantaneously, without detection nor order giver and may be suitable for high voltages. They are based on the natural transition from the superconducting state to the normal resistive state by overstepping the critical current of a superconducting coil which limits or triggers the limitation. Our limiter device consists essentially of two copper windings coupled through a saturable magnetic circuit and of a non inductively wound superconducting coil with a reduced current compared to the line current. This design allows a simple superconducting cable and reduced cryogenic losses but the dielectric stresses are high during faults. A small model (150 V/50 A) has experimentally validated our design. An industrial scale current limiter is designed and the comparisons between this design and other superconducting current limiters are given. Les courants de court-circuit sur les grands réseaux électriques ne cessent d'augmenter. Dans ce contexte sont apparus les limiteurs supraconducteurs de courant suite au développement des brins supraconducteurs alternatifs. Ces limiteurs peuvent limiter les courants de défaut presque instantanément, sans détection de défaut ni donneur d'ordre et ils sont extrapolables aux hautes tensions. Ils sont fondés sur la transition naturelle de l'état supraconducteur à l'état normal très résistif par dépassement du courant critique d'un enroulement supraconducteur qui limite ou déclenche la limitation. Notre limiteur est composé de deux enroulements en cuivre couplés par un circuit magnétique saturable et d'une bobine supraconductrice à courant réduit par rapport au courant de la ligne. Cette conception permet un câble supraconducteur simple et des pertes cryogéniques réduites mais les contraintes diélectriques en régime de défaut sont importantes. Une maquette

  9. Nanoscale capacitance imaging with attofarad resolution using ac current sensing atomic force microscopy

    International Nuclear Information System (INIS)

    Fumagalli, L; Ferrari, G; Sampietro, M; Casuso, I; MartInez, E; Samitier, J; Gomila, G

    2006-01-01

    Nanoscale capacitance imaging with attofarad resolution (∼1 aF) of a nano-structured oxide thin film, using ac current sensing atomic force microscopy, is reported. Capacitance images are shown to follow the topographic profile of the oxide closely, with nanometre vertical resolution. A comparison between experimental data and theoretical models shows that the capacitance variations observed in the measurements can be mainly associated with the capacitance probed by the tip apex and not with positional changes of stray capacitance contributions. Capacitance versus distance measurements further support this conclusion. The application of this technique to the characterization of samples with non-voltage-dependent capacitance, such as very thin dielectric films, self-assembled monolayers and biological membranes, can provide new insight into the dielectric properties at the nanoscale

  10. Nanoscale capacitance imaging with attofarad resolution using ac current sensing atomic force microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Fumagalli, L [Dipartimento di Elettronica e Informazione, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 (Italy); Ferrari, G [Dipartimento di Elettronica e Informazione, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 (Italy); Sampietro, M [Dipartimento di Elettronica e Informazione, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 (Italy); Casuso, I [Departament d' Electronica, Universitat de Barcelona, C/MartIi Franques 1, 08028 Barcelona (Spain); MartInez, E [Plataforma de Nanotecnologia, Parc Cientific de Barcelona, C/ Josep Samitier 1-5, 08028-Barcelona (Spain); Samitier, J [Departament d' Electronica, Universitat de Barcelona, C/MartIi Franques 1, 08028 Barcelona (Spain); Gomila, G [Departament d' Electronica, Universitat de Barcelona, C/MartIi Franques 1, 08028 Barcelona (Spain)

    2006-09-28

    Nanoscale capacitance imaging with attofarad resolution ({approx}1 aF) of a nano-structured oxide thin film, using ac current sensing atomic force microscopy, is reported. Capacitance images are shown to follow the topographic profile of the oxide closely, with nanometre vertical resolution. A comparison between experimental data and theoretical models shows that the capacitance variations observed in the measurements can be mainly associated with the capacitance probed by the tip apex and not with positional changes of stray capacitance contributions. Capacitance versus distance measurements further support this conclusion. The application of this technique to the characterization of samples with non-voltage-dependent capacitance, such as very thin dielectric films, self-assembled monolayers and biological membranes, can provide new insight into the dielectric properties at the nanoscale.

  11. Current density fluctuations and ambipolarity of transport

    International Nuclear Information System (INIS)

    Shen, W.; Dexter, R.N.; Prager, S.C.

    1991-10-01

    The fluctuation in the plasma current density is measured in the MIST reversed field pinch experiment. Such fluctuations, and the measured radial profile of the k spectrum of magnetic fluctuations, supports the view and that low frequency fluctuations (f r >) demonstrates that radial particle transport from particle motion parallel to a fluctuating magnetic field is ambipolar over the full frequency range

  12. RF Current Drive in Internal Transport Barrier

    Energy Technology Data Exchange (ETDEWEB)

    Peysson, Y.; Basiuk, V.; Huysmans, G. [Association EURATOM-CEA, CEA/DSM/DRFC, CEA-Cadarache, 13 - St Paul-lez-Durance (France); Decker, J.; Bers, A.; Ram, A.K. [Plasma Science and Fusion Center, Massachusetts Institute of Technology, Cambridge, MA (United States)

    2005-07-01

    The current drive problem in regimes with internal transport barrier is addressed using a fast solver of the electron drift kinetic equation which may be used for arbitrary tokamak plasma magnetic equilibrium and any type of electron radio-frequency wave. Parametric studies are performed for the Lower Hybrid and Electron Cyclotron waves. (authors)

  13. Current trends in nuclear material transportation

    International Nuclear Information System (INIS)

    Ravenscroft, Norman; Oshinowo, Franchone

    1997-01-01

    The business of radioactive material transportation has evolved considerably in the past 40 years. Current practices reflect extensive international experience in handling radioactive cargo within a mature and tested regulatory framework. Nevertheless, new developments continue to have an impact on how shipments of nuclear material are planned and carried out. Entities involved in the transport of radioactive materials must keep abreast of these developments and work together to find innovative solutions to ensure that safe, smooth transport activities may continue. Several recent trends in the regulatory environment and political atmosphere require attention. There are four key trends that we'll be examining today: 1) the reduction in the pool of available commercial carriers; 2) routing restrictions; 3) package validation issues; and 4) increasing political sensitivities. Careful planning and cooperative measures are necessary to alleviate problems in each of these areas. (author)

  14. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  15. AC impedance behavior of a practical-size single-cell SOFC under DC current

    Energy Technology Data Exchange (ETDEWEB)

    Momma, Akihiko; Kaga, Yasuo; Takano, Kiyonami; Nozaki, Ken; Negishi, Akira; Kato, Ken; Kato, Tohru [Fuel Cell Group, Energy Electronics Institute, National Institute of Advanced Industrial Science and Technology, Umezono Tsukuba-shi, Ibaraki 305-8568 (Japan); Inagaki, Toru; Yoshida, Hiroyuki [Energy Use R and D Center, The Kansai Electric Power Company, Inc., 11-20 Nakoji, 3-Chome, Amagasaki, Hyogo 661-0974 (Japan); Hosoi, Kei; Hoshino, Koji; Akbay, Taner; Akikusa, Jun; Yamada, Masaharu; Chitose, Norihisa [Central Research Institute, Naka Research Center, Mitsubishi Materials Corp. 1002-14 Mukohyama, Naka-machi, Naka-gun, Ibaraki 311-0102 (Japan)

    2004-10-29

    AC impedance measurements were carried out using practical-size planar disc-type SOFC which employs lanthanum gallate as a solid electrolyte. The data were obtained under practical conditions of gas flow rate and DC current. Under these conditions, the gas conversion impedance (GCI), which originates from the change of the electromotive force (EMF) caused by the change in anodic gaseous concentrations along the flow direction, was observed in the low-frequency range of the data obtained. The overlapping impedance together with GCI on the low-frequency arc was also estimated. Experimentally obtained GCI was in good agreement with that calculated. It was concluded that GCI was predominant in the impedance data obtained under practical conditions. The shift of the high-frequency intercept in the complex impedance diagrams was shown to appear as a result of the change in the distribution of gaseous composition in the anode. The dependency of the low-frequency arc on temperature was also shown, and it was assumed that the overlapped impedance varies as the temperature changes. The validity of the impedance measurement, as a diagnostic means to evaluate the gas flow in SOFC stack, was suggested.

  16. Macrofilament simulation of high current beam transport

    International Nuclear Information System (INIS)

    Hayden, R.J.; Jakobson, M.J.

    1985-01-01

    Macrofilament simulation of high current beam transport through a series of solenoids has been used to investigate the sensitivity of such calculations to the initial beam distribution and to the number of filaments used in the simulation. The transport line was tuned to approximately 105 0 phase advance per cell at zero current with a tune depression of 65 0 due to the space charge. Input distributions with the filaments randomly uniform throughout a four dimensional ellipsoid and K-V input distributions have been studied. The behavior of the emittance is similar to that published for quadrupoles with like tune depression. The emittance demonstrated little growth in the first twelve solenoids, a rapid rate of growth for the next twenty, and a subsequent slow rate of growth. A few hundred filaments were sufficient to show the character of the instability. The number of filaments utilized is an order of magnitude fewer than has been utilized previously for similar instabilities. The previously published curves for simulations with less than a thousand particles show a rather constant emittance growth. If the solenoid transport line magnetic field is increased a few percent, emittance growth curves are obtained not unlike those curves. Collision growth effects are less important than indicated in the previously published results for quadrupoles

  17. High current beam transport experiments at GSI

    International Nuclear Information System (INIS)

    Klabunde, J.; Schonlein, A.; Spadtke, P.

    1985-01-01

    The status of the high current ion beam transport experiment is reported. 190 keV Ar 1+ ions were injected into six periods of a magnetic quadrupole channel. Since the pulse length is > 0.5 ms partial space charge neutralization occurs. In our experiments, the behavior of unneutralized and partially space charge compensated beams is compared. With an unneutralized beam, emittance growth has been measured for high intensities even in case of the zero-current phase advance sigma 0 0 . This initial emittance growth at high tune depression we attribute to the homogenization effect of the space charge density. An analytical formula based on this assumption describes the emittance growth very well. Furthermore the predicted envelope instabilities for sigma 0 > 90 0 were observed even after 6 periods. In agreement with the theory, unstable beam transport was also experimentally found if a beam with different emittances in the two transverse phase planes was injected into the transport channel. Although the space charge force is reduced for a partially neutralized beam a deterioration of the beam quality was measured in a certain range of beam parameters. Only in the range where an unneutralized beam shows the initial emittance growth, the partial neutralization reduces this effect, otherwise the partially neutralized beam is more unstable

  18. Methods, systems and apparatus for controlling operation of two alternating current (AC) machines

    Science.gov (United States)

    Gallegos-Lopez, Gabriel [Torrance, CA; Nagashima, James M [Cerritos, CA; Perisic, Milun [Torrance, CA; Hiti, Silva [Redondo Beach, CA

    2012-02-14

    A system is provided for controlling two AC machines. The system comprises a DC input voltage source that provides a DC input voltage, a voltage boost command control module (VBCCM), a five-phase PWM inverter module coupled to the two AC machines, and a boost converter coupled to the inverter module and the DC input voltage source. The boost converter is designed to supply a new DC input voltage to the inverter module having a value that is greater than or equal to a value of the DC input voltage. The VBCCM generates a boost command signal (BCS) based on modulation indexes from the two AC machines. The BCS controls the boost converter such that the boost converter generates the new DC input voltage in response to the BCS. When the two AC machines require additional voltage that exceeds the DC input voltage required to meet a combined target mechanical power required by the two AC machines, the BCS controls the boost converter to drive the new DC input voltage generated by the boost converter to a value greater than the DC input voltage.

  19. Modeling And Simulation Of Electrical Prevenion System Using Arduino Uno,Gsm Modem, And Acs712 Current Sensor

    Science.gov (United States)

    Khair, Ummul; Jabbar Lubis, Abdul; Agustha, Indra; Dharmawati; Zulfin, M.

    2017-12-01

    The current electricity needs is very primary, all objects including electronics require power, it encourages people not to be able to save electricity so the theft of electric power would be done. The use of ACS712 current sensor as the sensor with arduino uno would find out the power consumption continuously and prevent the theft of electricity because of the use of electricity which has been determined by PLN and the people fetl that it is not enough for every house, so the author made a tool for prevention of theft of electric power by using the arduino uno, buzzer, ACS712 current sensor, lcd, and relay then the power usage can be controlled according to the use to prevent the occurrence of theft of electricity so the use can be seen directly on the lcd 16x2and GSM modem to give information to employees of PLN so that it can reduceelectrical theft by the public.

  20. Quasienergy spectrum and tunneling current in ac-driven triple quantum dot shuttles

    Energy Technology Data Exchange (ETDEWEB)

    Villavicencio, J [Facultad de Ciencias, Universidad Autonoma de Baja California, Ensenada (Mexico); Maldonado, I [Centro de Investigacion Cientifica y de Educacion Superior de Ensenada (Mexico); Cota, E [Centro de Nanociencias y Nanotecnologia, Universidad Nacional Autonoma de Mexico, Ensenada (Mexico); Platero, G, E-mail: villavics@uabc.edu.mx [Instituto de Ciencia de Materiales de Madrid (CSIC), Cantoblanco, 28049 Madrid (Spain)

    2011-02-15

    The dynamics of electrons in ac-driven double quantum dots have been extensively analyzed by means of Floquet theory. In these systems, coherent destruction of tunneling has been shown to occur for certain ac field parameters. In this work we analyze, by means of Floquet theory, the electron dynamics of a triple quantum dot in series attached to electric contacts, where the central dot position oscillates. In particular, we analyze the quasienergy spectrum of this ac-driven nanoelectromechanical system as a function of the intensity and frequency of the ac field and of external dc voltages. For strong driving fields, we derive, by means of perturbation theory, analytical expressions for the quasienergies of the driven oscillator system. From this analysis, we discuss the conditions for coherent destruction of tunneling (CDT) to occur as a function of detuning and field parameters. For zero detuning, and from the invariance of the Floquet Hamiltonian under a generalized parity transformation, we find analytical expressions describing the symmetry properties of the Fourier components of the Floquet states under such a transformation. By using these expressions, we show that in the vicinity of the CDT condition, the quasienergy spectrum exhibits exact crossings which can be characterized by the parity properties of the corresponding eigenvectors.

  1. Achromatic beam transport of High Current Injector

    International Nuclear Information System (INIS)

    Kumar, Sarvesh; Mandal, A.

    2016-01-01

    The high current injector (HCI) provides intense ion beams of high charge state using a high temperature superconducting ECR ion source. The ion beam is accelerated upto a final energy of 1.8 MeV/u due to an electrostatic potential, a radio frequency quadrupole (RFQ) and a drift tube linac (DTL). The ion beam has to be transported to superconducting LINAC which is around 50 m away from DTL. This section is termed as high energy beam transport section (HEBT) and is used to match the beam both in transverse and longitudinal phase space to the entrance of LINAC. The HEBT section is made up of four 90 deg. achromatic bends and interconnecting magnetic quadrupole triplets. Two RF bunchers have been used for longitudinal phase matching to the LINAC. The ion optical design of HEBT section has been simulated using different beam dynamics codes like TRACEWIN, GICOSY and TRACE 3D. The field computation code OPERA 3D has been utilized for hardware design of all the magnets. All the dipole and quadrupole magnets have been field mapped and their test results such as edge angles measurements, homogeneity and harmonic analysis etc. are reported. The whole design of HEBT section has been performed such that the most of the beam optical components share same hardware design and there is ample space for beam diagnostics as per geometry of the building. Many combination of achromatic bends have been simulated to transport the beam in HEBT section but finally the four 90 deg. achromatic bend configuration is found to be the best satisfying all the geometrical constraints with simplified beam tuning process in real time

  2. Voltage-probe-position dependence and magnetic-flux contribution to the measured voltage in ac transport measurements: which measuring circuit determines the real losses?

    International Nuclear Information System (INIS)

    Pe, T.; McDonald, J.; Clem, J.R.

    1995-01-01

    The voltage V ab measured between two voltage taps a and b during magnetic flux transport in a type-II superconductor carrying current I is the sum of two contributions, the line integral from a to b of the electric field along an arbitrary path C s through the superconductor and a term proportional to the time rate of change of magnetic flux through the area bounded by the path C s and the measuring circuit leads. When the current I(t) is oscillating with time t, the apparent ac loss (the time average of the product IV ab ) depends upon the measuring circuit used. Only when the measuring-circuit leads are brought out far from the surface does the apparent power dissipation approach the real (or true) ac loss associated with the length of sample probed. Calculations showing comparisons between the apparent and real ac losses in a flat strip of rectangular cross section will be presented, showing the behavior as a function of the measuring-circuit dimensions. Corresponding calculations also are presented for a sample of elliptical cross section

  3. Alternating-current transport losses of melt-cast processed Bi-2212 bulk superconductor bars

    International Nuclear Information System (INIS)

    Tsukamoto, T; Inada, R; Inagaki, N; Andoh, H; Sugiura, T; Oota, A

    2003-01-01

    Using a melt-casting method, we have fabricated two pieces of Bi-2212 bulk superconductor bar with square and rectangular cross-sections, and we have investigated the alternating-current (ac) transport self-field losses at 77 K. Despite the main contribution of hysteresis loss of the superconductor, there is some difference in the loss behaviour between these two samples. To elucidate the origin, we make numerical calculations on the ac transport self-field losses as a function of current amplitude I 0 below the critical current I c . At a fixed I 0 , the calculated values using the uniform J c distribution and the actual cross-sectional geometry are much higher than the experimental data for the sample with a square cross-section 7.5 x 7.5 mm 2 , while there is good agreement between the calculation and the experiment for the sample with a rectangular cross-section 4.5 x 13.6 mm 2 . The discrepancy appearing in the sample with a square cross-section is ascribed to the actual J c distribution, which is confirmed by critical current measurements when scraping off the sample. The local J c value decreases significantly in going from the surface to the interior of the sample. This suppresses the extension of the flux-penetration region to the interior under ac current transmission and lowers the loss generation compared with the calculated results obtained by the uniform J c distribution

  4. A Circulating-Current Suppression Method for Parallel-Connected Voltage-Source Inverters With Common DC and AC Buses

    DEFF Research Database (Denmark)

    Wei, Baoze; Guerrero, Josep M.; Quintero, Juan Carlos Vasquez

    2017-01-01

    This paper presents a theoretical study with experimental validation of a circulating-current suppression method for parallel operation of three-phase voltage source inverters (VSI), which may be suitable for modular parallel uninterruptible power supply systems or hybrid AC/DC microgrid applicat......This paper presents a theoretical study with experimental validation of a circulating-current suppression method for parallel operation of three-phase voltage source inverters (VSI), which may be suitable for modular parallel uninterruptible power supply systems or hybrid AC/DC microgrid......, and added into the conventional droop plus virtual impedance control. In the control architecture, the reference voltages of the inverters are generated by the primary control loop which consists of a droop control and a virtual impedance. The secondary control is used to compensate the voltage drop...

  5. Usefulness of current international air transport statistics

    Science.gov (United States)

    1999-05-01

    International air transportation is the fastest growing segment of transportation. It performs a major function in the globalization process and is a significant feature of the late 20th century. Public policy regarding international air transportati...

  6. Finite element model predicts current density distribution for clinical applications of tDCS and tACS

    Directory of Open Access Journals (Sweden)

    Toralf eNeuling

    2012-09-01

    Full Text Available Transcranial direct current stimulation (tDCS has been applied in numerous scientific studies over the past decade. However, the possibility to apply tDCS in therapy of neuropsychiatric disorders is still debated. While transcranial magnetic stimulation (TMS has been approved for treatment of major depression in the United States by the Food and Drug Administration (FDA, tDCS is not as widely accepted. One of the criticisms against tDCS is the lack of spatial specificity. Focality is limited by the electrode size (35 cm2 are commonly used and the bipolar arrangement. However, a current flow through the head directly from anode to cathode is an outdated view. Finite element (FE models have recently been used to predict the exact current flow during tDCS. These simulations have demonstrated that the current flow depends on tissue shape and conductivity. Toface the challenge to predict the location, magnitude and direction of the current flow induced by tDCS and transcranial alternating current stimulation (tACS, we used a refined realistic FE modeling approach. With respect to the literature on clinical tDCS and tACS, we analyzed two common setups for the location of the stimulation electrodes which target the frontal lobe and the occipital lobe, respectively. We compared lateral and medial electrode configuration with regard to theirusability. We were able to demonstrate that the lateral configurations yielded more focused stimulation areas as well as higher current intensities in the target areas. The high resolution of our simulation allows one to combine the modeled current flow with the knowledge of neuronal orientation to predict the consequences of tDCS and tACS. Our results not only offer a basis for a deeper understanding of the stimulation sites currently in use for clinical applications but also offer a better interpretation of observed effects.

  7. Synaptically evoked glutamate transporter currents in Spinal Dorsal Horn Astrocytes

    Directory of Open Access Journals (Sweden)

    Dougherty Patrick M

    2009-07-01

    Full Text Available Abstract Background Removing and sequestering synaptically released glutamate from the extracellular space is carried out by specific plasma membrane transporters that are primarily located in astrocytes. Glial glutamate transporter function can be monitored by recording the currents that are produced by co-transportation of Na+ ions with the uptake of glutamate. The goal of this study was to characterize glutamate transporter function in astrocytes of the spinal cord dorsal horn in real time by recording synaptically evoked glutamate transporter currents. Results Whole-cell patch clamp recordings were obtained from astrocytes in the spinal substantia gelatinosa (SG area in spinal slices of young adult rats. Glutamate transporter currents were evoked in these cells by electrical stimulation at the spinal dorsal root entry zone in the presence of bicuculline, strychnine, DNQX and D-AP5. Transporter currents were abolished when synaptic transmission was blocked by TTX or Cd2+. Pharmacological studies identified two subtypes of glutamate transporters in spinal astrocytes, GLAST and GLT-1. Glutamate transporter currents were graded with stimulus intensity, reaching peak responses at 4 to 5 times activation threshold, but were reduced following low-frequency (0.1 – 1 Hz repetitive stimulation. Conclusion These results suggest that glutamate transporters of spinal astrocytes could be activated by synaptic activation, and recording glutamate transporter currents may provide a means of examining the real time physiological responses of glial cells in spinal sensory processing, sensitization, hyperalgesia and chronic pain.

  8. Transcranial alternating current stimulation (tACS increases risk taking behavior in the Balloon Analogue Risk Task

    Directory of Open Access Journals (Sweden)

    Tal eSela

    2012-02-01

    Full Text Available The process of evaluating risks and benefits involves a complex neural network that includes the dorsolateral prefrontal cortex (DLPFC. It has been proposed that in conflict and reward situations, theta-band (4–8 Hz oscillatory activity in the frontal cortex may reflect an electrophysiological mechanism for coordinating neural networks monitoring behavior, as well as facilitating task-specific adaptive changes. The goal of the present study was to investigate the hypothesis that theta-band oscillatory balance between right and left frontal and prefrontal regions, with a predominance role to the right hemisphere, is crucial for regulatory control during decision-making under risk. In order to explore this hypothesis, we used transcranial Alternating Current Stimulation (tACS, a novel technique that provides the opportunity to explore the functional role of neuronal oscillatory activities and to establish a causal link between specific oscillations and functional lateralization in risky decision-making situations. For this aim, healthy participants were randomly allocated to one of three stimulation groups (LH stimulation / RH stimulation / Sham stimulation, with active AC stimulation delivered in a frequency-dependent manner (at 6.5 Hz; 1mA peak to-peak. During the AC stimulation, participants performed the Balloon Analog Risk Task. This experiment revealed that participants receiving LH stimulation displayed riskier decision-making style compared to sham and RH stimulation groups. However, there was no difference in decision-making behaviors between sham and RH stimulation groups. The current study extends the notion that DLPFC activity is critical for adaptive decision-making in the context of risk-taking and emphasis the role of theta-band oscillatory activity during risky decision-making situations.

  9. Unifying concept of serotonin transporter-associated currents.

    Science.gov (United States)

    Schicker, Klaus; Uzelac, Zeljko; Gesmonde, Joan; Bulling, Simon; Stockner, Thomas; Freissmuth, Michael; Boehm, Stefan; Rudnick, Gary; Sitte, Harald H; Sandtner, Walter

    2012-01-02

    Serotonin (5-HT) uptake by the human serotonin transporter (hSERT) is driven by ion gradients. The stoichiometry of transported 5-HT and ions is predicted to result in electroneutral charge movement. However, hSERT mediates a current when challenged with 5-HT. This discrepancy can be accounted for by an uncoupled ion flux. Here, we investigated the mechanistic basis of the uncoupled currents and its relation to the conformational cycle of hSERT. Our observations support the conclusion that the conducting state underlying the uncoupled ion flux is in equilibrium with an inward facing state of the transporter with K+ bound. We identified conditions associated with accumulation of the transporter in inward facing conformations. Manipulations that increased the abundance of inward facing states resulted in enhanced steady-state currents. We present a comprehensive kinetic model of the transport cycle, which recapitulates salient features of the recorded currents. This study provides a framework for exploring transporter-associated currents.

  10. Efficacy of low level electric current (A-C) for controlling quagga mussles in the Welland Canal

    Energy Technology Data Exchange (ETDEWEB)

    Fears, C. [Delta Applied Technology, Inc., Pittsburgh, PA (United States); Mackie, G.L. [Water Systems Analysts, Guelph, Ontario (Canada)

    1995-06-01

    The efficacy of systems (for which patents are pending) which use low-voltage A-C currents for preventing settlement and attachment by zebra mussels were tested with steel rods and plates placed near the intake of a pulp and paper plant in the Welland Canal at Thorold, Ontario. Six racks made of 16 ft. (4.9 m), 2x4s (5.1 x 10.2 cm) were placed into the Welland Canal on August 5, 1994. One rack had 1/8th in (3.2 mm) diam x 12 in (30.5 cm) long steel rods, each separated by 2 in (5.1 cm) attached to pressure treated wood and concrete blocks and an A-C current of 16 v (or 8 v/in); rack 2 had steel rods of the same configuration but 12 v (or 6 v/in) was applied; rack 3 was identical to these but no current was applied and was used as a rod control. The remaining three racks had steel plates, each plate being 3 in (7.6 cm) wide X 24 in (61 cm) long X 1/4 in (6.4 mm) thick and separated by 2 in (5.1 cm); one had 12 v applied (or 6 v/in), another had 16 v applied (or 8 v/in), and the third had no current and was used as a plate control. The racks were placed on the upstream and downstream side of the intake at a depth of about 7 ft (2.1 m) where the mussels populations were heaviest (as determined by SCUBA diving). All mussels were quagga mussels (Dreissena bugensis). The racks were pulled in mid November after settlement was complete and the results showed: (1) complete prevention of settlement of both new recruits and translocators at 8 volts/in with steel rods on both wood and concrete surfaces and with steel plate trash bars; (2) partial prevention of settlement at 6 volts/in with steel rods on both wood and concrete surfaces and steel plates; and (3) that, at current kilowatt hr rates, total efficacy at 8 volts/in would cost approximately $10.80/day/1000 sq ft using rods to protect concrete walls and about $16.32/day/1000 sq ft to protect 3 in wide x 1/4 in thick trash bars. These costs can be reduced even further with pulse dosed AC currents.

  11. Superconducting fault current limiter for railway transport

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, L. M., E-mail: LMFisher@niitfa.ru; Alferov, D. F.; Akhmetgareev, M. R.; Budovskii, A. I.; Evsin, D. V.; Voloshin, I. F.; Kalinov, A. V. [National Technical Physics and Automation Research Institute (Russian Federation)

    2015-12-15

    A resistive switching superconducting fault current limiter (SFCL) for DC networks with voltage of 3.5 kV and nominal current of 2 kA is developed. The SFCL consists of two series-connected units: block of superconducting modules and high-speed vacuum breaker with total disconnection time not more than 8 ms. The results of laboratory tests of superconducting SFCL modules in current limiting mode are presented. The recovery time of superconductivity is experimentally determined. The possibility of application of SFCL on traction substations of Russian Railways is considered.

  12. Superconducting fault current limiter for railway transport

    International Nuclear Information System (INIS)

    Fisher, L. M.; Alferov, D. F.; Akhmetgareev, M. R.; Budovskii, A. I.; Evsin, D. V.; Voloshin, I. F.; Kalinov, A. V.

    2015-01-01

    A resistive switching superconducting fault current limiter (SFCL) for DC networks with voltage of 3.5 kV and nominal current of 2 kA is developed. The SFCL consists of two series-connected units: block of superconducting modules and high-speed vacuum breaker with total disconnection time not more than 8 ms. The results of laboratory tests of superconducting SFCL modules in current limiting mode are presented. The recovery time of superconductivity is experimentally determined. The possibility of application of SFCL on traction substations of Russian Railways is considered

  13. AC over-current characteristics of YBCO coated conductor with copper stabilizer layer considering insulation layer

    International Nuclear Information System (INIS)

    Du, H.-I.; Kim, M.-J.; Kim, Y.-J.; Lee, D.-H.; Han, B.-S.; Song, S.-S.

    2010-01-01

    Compared with the first-generation BSCCO wire, the YBCO thin-film wire boasts low material costs and high J c and superior magnetic-field properties, among other strengths. Meanwhile, the previous BSCCO wire material for superconducting cables has been researched on considerably with regard to its post-wire quenching characteristics during the application of an alternating over-current. In this regard, the promising YBCO thin-film wire has yet to be further researched on. Moreover, still lacking is research on the YBCO thin-film wire with insulating layers, which is essential in the manufacture of superconducting cables, along with the testing of the application of an alternating over-current to the wire. In this study, YBCO thin-film wires with copper-stabilizing layers were used in testing alternating over-current application according to the presence or absence of insulating layers and to the thickness of such layers, to examine the post-quenching wire resistance increase and quenching trends. The YBCO thin-film wire with copper-stabilizing layers has a critical temperature of 90 K and a critical current of 85 A rms . Moreover, its current application cycle is 5.5 cycles, and its applied currents are 354, 517, 712, and 915 A peak . These figures enabled the YBCO thin-film wires with copper-stabilizing layers to reach 90, 180, 250, and 300 K, respectively, in this study. These temperatures serve as a relative reference to examine the post-quenching wire properties following the application of an alternating over-current.

  14. Comparison of AC losses, magnetic field/current distributions and critical currents of superconducting circular pancake coils and infinitely long stacks using coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Yuan Weijia; Campbell, A M; Hong, Z; Ainslie, M D; Coombs, T A, E-mail: wy215@cam.ac.u [Electronic, Power and Energy Conversion Group, Electrical Engineering Division, Engineering Department, University of Cambridge, Cambridge CB3 0FA (United Kingdom)

    2010-08-15

    A model is presented for calculating the AC losses, magnetic field/current density distribution and critical currents of a circular superconducting pancake coil. The assumption is that the magnetic flux lines will lie parallel to the wide faces of tapes in the unpenetrated area of the coil. Instead of using an infinitely long stack to approximate the circular coil, this paper gives an exact circular coil model using elliptic integrals. A new efficient numerical method is introduced to yield more accurate and fast computation. The computation results are in good agreement with the assumptions. For a small value of the coil radius, there is an asymmetry along the coil radius direction. As the coil radius increases, this asymmetry will gradually decrease, and the AC losses and penetration depth will increase, but the critical current will decrease. We find that if the internal radius is equal to the winding thickness, the infinitely long stack approximation overestimates the loss by 10% and even if the internal radius is reduced to zero, the error is still only 60%. The infinitely long stack approximation is therefore adequate for most practical purposes. In addition, the comparison result shows that the infinitely long stack approximation saves computation time significantly.

  15. Current distribution effects in AC impedance spectroscopy of electroceramic point contact and thin film model electrodes

    DEFF Research Database (Denmark)

    Nielsen, Jimmi; Jacobsen, Torben

    2010-01-01

    the primary current distribution to the DC current distribution restricted to the Three-Phase-Boundary (TPB) zone introduces an error in the determination of the reaction resistance, Rreac = Z(freq. → 0) − Z(freq. → ∞). The error is estimated for different width of the effective TPB zone and a rule of thumb...... regarding its significance is provided. The associated characteristic impedance spectrum shape change is simulated and its origin discussed. Furthermore, the characteristic shape of impedance spectra of thin electroceramic film electrodes with lateral ohmic resistance is studied as a function...

  16. Brain Oscillatory and Hemodynamic Activity in a Bimanual Coordination Task Following Transcranial Alternating Current Stimulation (tACS): A Combined EEG-fNIRS Study.

    Science.gov (United States)

    Berger, Alisa; Pixa, Nils H; Steinberg, Fabian; Doppelmayr, Michael

    2018-01-01

    Motor control is associated with synchronized oscillatory activity at alpha (8-12 Hz) and beta (12-30 Hz) frequencies in a cerebello-thalamo-cortical network. Previous studies demonstrated that transcranial alternating current stimulation (tACS) is capable of entraining ongoing oscillatory activity while also modulating motor control. However, the modulatory effects of tACS on both motor control and its underlying electro- and neurophysiological mechanisms remain ambiguous. Thus, the purpose of this study was to contribute to gathering neurophysiological knowledge regarding tACS effects by investigating the after-effects of 10 Hz tACS and 20 Hz tACS at parietal brain areas on bimanual coordination and its concurrent oscillatory and hemodynamic activity. Twenty-four right-handed healthy volunteers (12 females) aged between 18 and 30 ( M = 22.35 ± 3.62) participated in the study and performed a coordination task requiring bimanual movements. Concurrent to bimanual motor training, participants received either 10 Hz tACS, 20 Hz tACS or a sham stimulation over the parietal cortex (at P3/P4 electrode positions) for 20 min via small gel electrodes (3,14 cm 2 Ag/AgCl, amperage = 1 mA). Before and three time-points after tACS (immediately, 30 min and 1 day), bimanual coordination performance was assessed. Oscillatory activities were measured by electroencephalography (EEG) and hemodynamic changes were examined using functional near-infrared spectroscopy (fNIRS). Improvements of bimanual coordination performance were not differently between groups, thus, no tACS-specific effect on bimanual coordination performance emerged. However, physiological measures during the task revealed significant increases in parietal alpha activity immediately following 10 Hz tACS and 20 Hz tACS which were accompanied by significant decreases of Hboxy concentration in the right hemispheric motor cortex compared to the sham group. Based on the physiological responses, we conclude that tACS

  17. Brain Oscillatory and Hemodynamic Activity in a Bimanual Coordination Task Following Transcranial Alternating Current Stimulation (tACS: A Combined EEG-fNIRS Study

    Directory of Open Access Journals (Sweden)

    Alisa Berger

    2018-04-01

    Full Text Available Motor control is associated with synchronized oscillatory activity at alpha (8–12 Hz and beta (12–30 Hz frequencies in a cerebello-thalamo-cortical network. Previous studies demonstrated that transcranial alternating current stimulation (tACS is capable of entraining ongoing oscillatory activity while also modulating motor control. However, the modulatory effects of tACS on both motor control and its underlying electro- and neurophysiological mechanisms remain ambiguous. Thus, the purpose of this study was to contribute to gathering neurophysiological knowledge regarding tACS effects by investigating the after-effects of 10 Hz tACS and 20 Hz tACS at parietal brain areas on bimanual coordination and its concurrent oscillatory and hemodynamic activity. Twenty-four right-handed healthy volunteers (12 females aged between 18 and 30 (M = 22.35 ± 3.62 participated in the study and performed a coordination task requiring bimanual movements. Concurrent to bimanual motor training, participants received either 10 Hz tACS, 20 Hz tACS or a sham stimulation over the parietal cortex (at P3/P4 electrode positions for 20 min via small gel electrodes (3,14 cm2 Ag/AgCl, amperage = 1 mA. Before and three time-points after tACS (immediately, 30 min and 1 day, bimanual coordination performance was assessed. Oscillatory activities were measured by electroencephalography (EEG and hemodynamic changes were examined using functional near-infrared spectroscopy (fNIRS. Improvements of bimanual coordination performance were not differently between groups, thus, no tACS-specific effect on bimanual coordination performance emerged. However, physiological measures during the task revealed significant increases in parietal alpha activity immediately following 10 Hz tACS and 20 Hz tACS which were accompanied by significant decreases of Hboxy concentration in the right hemispheric motor cortex compared to the sham group. Based on the physiological responses, we conclude that

  18. Alternatives for blocking direct current in AC system neutrals at the Radisson/LG2 complex

    International Nuclear Information System (INIS)

    Eitzmann, M.A.; Walling, R.A.; Sublich, M.; Kah, A.; Huynh, H.; Granger, M.; Dutil, A.

    1992-01-01

    Severe offset saturation results from the passage of direct current through power transformers. Such direct current can arise from geomagnetic disturbances, or resistive coupling of the substation ground to HVDC earth electrodes. This paper documents the development of alternative approaches for the design and application of blocking devices placed between transformer neutrals and the substation ground. System constraints on the impedance and overvoltage limitation of the neutral blocking device (NBD) are covered. Three alternative NBD schemes are developed and optimized. System performance of the NBD is discussed, as are the practical implementation considerations for this unconventional equipment application. Although the paper focuses on the NBD requirements of Hydro-Quebec's Radisson/LG2 complex, the fundamental information is applicable to any situation where dc must be clocked from a power transformer neutral in a system designed for effectively-grounded operation

  19. Magneto-optical imaging of transport current densities in superconductors

    International Nuclear Information System (INIS)

    Crabtree, G.W.; Welp, U.; Gunter, D.O.; Zhong, W.; Balachandran, U.; Haldar, P.; Sokolowski, R.S.; Vlasko-Vlasov, V.K.; Nikitenko, V.I.

    1995-01-01

    Direct imaging of the paths of transport currents in superconductors creates many new possibilities for exploring the basic features of vortex pinning mechanisms and for improving the performance of superconducting materials. A technique for imaging the path and magnitude of the transport current density flowing in superconductors is described. Results are given for a 37-filament BSCCO 2223 powder-in-tube wire, showing a highly inhomogeneous current path within the filaments

  20. A Single Rod Multi-modality Multi-interface Level Sensor Using an AC Current Source

    Directory of Open Access Journals (Sweden)

    Abdulgader Hwili

    2008-05-01

    Full Text Available Crude oil separation is an important process in the oil industry. To make efficient use of the separators, it is important to know their internal behaviour, and to measure the levels of multi-interfaces between different materials, such as gas-foam, foam-oil, oil-emulsion, emulsion-water and water-solids. A single-rod multi-modality multi-interface level sensor is presented, which has a current source, and electromagnetic modalities. Some key issues have been addressed, including the effect of salt content and temperature i.e. conductivity on the measurement.

  1. Neoclassical bootstrap current and transport in optimized stellarator configurations

    International Nuclear Information System (INIS)

    Maassberg, H.; Lotz, W.; Nuehrenberg, J.

    1993-01-01

    The neoclassical bootstrap current properties of optimized stellarators are analyzed in the relevant mean-free-path regimes and compared with the neoclassical transport properties. Two methods---global Monte Carlo simulation [Phys. Fluids 31, 2984 (1988)], and local analysis with the drift kinetic equation solver code [Phys. Fluids B 1, 563 (1989)]---are employed and good agreement is obtained. Full consistency with the elimination of the bootstrap current and favorable neoclassical transport are found

  2. Modelling the transport system in China and evaluating the current strategies towards the sustainable transport development

    DEFF Research Database (Denmark)

    Liu, W.; Lund, H.; Mathiesen, B.V.

    2013-01-01

    in China. With this purpose in mind, a Chinese transport model has been created and three current transport strategies which are high speed railway (HSR), urban rail transit (URT) and electric vehicle (EV) were evaluated together with a reference transport system in 2020. As conservative results, 13...

  3. Current distribution and ac susceptibility response of a thin superconducting disc in an axial field: a theoretical approach

    Science.gov (United States)

    Aruna, S. A.; Zhang, P.; Lin, F. Y.; Ding, S. Y.; Yao, X. X.

    2000-04-01

    Within the framework of the thermally activated process of the flux line or flux line bundles, and by time integration of the 1D equation of motion of the circulating current density icons/Journals/Common/vecJ" ALT="vecJ" ALIGN="TOP"/> (icons/Journals/Common/rho" ALT="rho" ALIGN="TOP"/> ,t ), which is suitable for thin superconducting films (R >>d ,icons/Journals/Common/le" ALT="le" ALIGN="TOP"/> icons/Journals/Common/lambda" ALT="lambda" ALIGN="TOP"/> ), we present numerical calculations of the current profiles, magnetization hysteresis loops and ac susceptibility icons/Journals/Common/chi" ALT="chi" ALIGN="TOP"/> n = icons/Journals/Common/chi" ALT="chi" ALIGN="TOP"/> ´n +iicons/Journals/Common/chi" ALT="chi" ALIGN="TOP"/> ´´n for n = 1, 3 and 5 of a thin disc immersed in an axial time-dependent external magnetic field Ba (t ) = Bdc +Bac cos(2icons/Journals/Common/pi" ALT="pi" ALIGN="TOP"/> icons/Journals/Common/nu" ALT="nu" ALIGN="TOP"/> t ). Our calculated results are compared with those of the critical state model (CSM) and found to prove the approximate validity of the CSM below the irreversibility field. The differences between our computed results and those of the CSM are also discussed.

  4. Accelerated sea level rise and Florida Current transport

    Directory of Open Access Journals (Sweden)

    J. Park

    2015-07-01

    Full Text Available The Florida Current is the headwater of the Gulf Stream and is a component of the North Atlantic western boundary current from which a geostrophic balance between sea surface height and mass transport directly influence coastal sea levels along the Florida Straits. A linear regression of daily Florida Current transport estimates does not find a significant change in transport over the last decade; however, a nonlinear trend extracted from empirical mode decomposition (EMD suggests a 3 Sv decline in mean transport. This decline is consistent with observed tide gauge records in Florida Bay and the straits exhibiting an acceleration of mean sea level (MSL rise over the decade. It is not known whether this recent change represents natural variability or the onset of the anticipated secular decline in Atlantic meridional overturning circulation (AMOC; nonetheless, such changes have direct impacts on the sensitive ecological systems of the Everglades as well as the climate of western Europe and eastern North America.

  5. Unifying Concept of Serotonin Transporter-associated Currents*

    Science.gov (United States)

    Schicker, Klaus; Uzelac, Zeljko; Gesmonde, Joan; Bulling, Simon; Stockner, Thomas; Freissmuth, Michael; Boehm, Stefan; Rudnick, Gary; Sitte, Harald H.; Sandtner, Walter

    2012-01-01

    Serotonin (5-HT) uptake by the human serotonin transporter (hSERT) is driven by ion gradients. The stoichiometry of transported 5-HT and ions is predicted to result in electroneutral charge movement. However, hSERT mediates a current when challenged with 5-HT. This discrepancy can be accounted for by an uncoupled ion flux. Here, we investigated the mechanistic basis of the uncoupled currents and its relation to the conformational cycle of hSERT. Our observations support the conclusion that the conducting state underlying the uncoupled ion flux is in equilibrium with an inward facing state of the transporter with K+ bound. We identified conditions associated with accumulation of the transporter in inward facing conformations. Manipulations that increased the abundance of inward facing states resulted in enhanced steady-state currents. We present a comprehensive kinetic model of the transport cycle, which recapitulates salient features of the recorded currents. This study provides a framework for exploring transporter-associated currents. PMID:22072712

  6. On transport and the bootstrap current in toroidal plasmas

    International Nuclear Information System (INIS)

    Connor, J.W.; Taylor, J.B.

    1987-01-01

    The recently reported observation of the bootstrap current in a tokamak plasma highlights the problem of reconciling this neoclassical effect with the anomalous (i.e., non-neoclassical) electron thermal transport. This Comment reviews the bootstrap current and considers the implications of a self-consistent modification of neoclassical theory based on an enhanced electron-electron interaction. (author)

  7. Effect of impurities on the steady component of the current in a quantum wire under the joint action of ac and dc fields

    International Nuclear Information System (INIS)

    Zav'yalov, D. V.; Kryuchkov, S. V.

    2008-01-01

    The current flowing along a cylindrical quantum wire with a superlattice in the case of the simultaneous application of dc and ac fields is calculated. It is assumed that the wire contains impurity centers, whose ionization results in the generation of nonequilibrium carriers in the conduction band. It is found that the dependence of the steady component of the current on the ac-field frequency is a step-like function. It is shown that the distance between steps depends on the conduction miniband width and the transverse quantum confinement parameters and is independent of the impurity-level depth.

  8. Computer simulation of transport driven current in tokamaks

    International Nuclear Information System (INIS)

    Nunan, W.J.; Dawson, J.M.

    1993-01-01

    Plasma transport phenomena can drive large currents parallel to an externally applied magnetic field. The Bootstrap Current Theory accounts for the effect of Banana diffusion on toroidal current, but the effect is not confined to that transport regime. The authors' 2 1/2-D, electromagnetic, particle simulations have demonstrated that Maxwellian plasmas in static toroidal and vertical fields spontaneously develop significant toroidal current, even in the absence of the open-quotes seed currentclose quotes which the Bootstrap Theory requires. Other simulations, in both toroidal and straight cylindrical geometries, and without any externally imposed electric field, show that if the plasma column is centrally fueled, and if the particle diffusion coefficient exceeds the magnetic diffusion coefficient (as is true in most tokamaks) then the toroidal current grows steadily. The simulations indicate that such fueling, coupled with central heating due to fusion reactions may drive all of the tokamak's toroidal current. The Bootstrap and dynamo mechanisms do not drive toroidal current where the poloidal magnetic field is zero. The simulations, as well as initial theoretical work, indicate that in tokamak plasmas, various processes naturally transport current from the outer regions of the plasma to the magnetic axis. The mechanisms which cause this effective electron viscosity include conventional binary collisions, wave emission and reabsorption, and also convection associated with rvec E x rvec B vortex motion. The simulations also exhibit preferential loss of particles carrying current opposing the bulk plasma current. This preferential loss generates current even at the magnetic axis. If these self-seeding mechanisms function in experiments as they do in the simulations, then transport driven current would eliminate the need for any external current drive in tokamaks, except simple ohmic heating for initial generation of the plasma

  9. Differential effects of 10-Hz and 40-Hz transcranial alternating current stimulation (tACS) on endogenous versus exogenous attention.

    Science.gov (United States)

    Hopfinger, Joseph B; Parsons, Jonathan; Fröhlich, Flavio

    2017-04-01

    Previous electrophysiological studies implicate both alpha (8-12 Hz) and gamma (>30 Hz) neural oscillations in the mechanisms of selective attention. Here, participants preformed two separate visual attention tasks, one endogenous and one exogenous, while transcranial alternating current stimulation (tACS), at 10 Hz, 40 Hz, or sham, was applied to the right parietal lobe. Our results provide new evidence for the roles of gamma and alpha oscillations in voluntary versus involuntary shifts of attention. Gamma (40 Hz) stimulation resulted in improved disengagement from invalidly cued targets in the endogenous attention task, whereas alpha stimulation (10 Hz) had no effect on endogenous attention, but increased the exogenous cuing effect. These findings agree with previous studies suggesting that right inferior parietal regions may be especially important for the disengagement of attention, and go further to provide details about the specific type of oscillatory neural activity within that brain region that is differentially involved in endogenous versus exogenous attention. Our results also have potential implications for the plasticity and training of attention systems.

  10. High current beam transport with multiple beam arrays

    International Nuclear Information System (INIS)

    Kim, C.H.

    1985-05-01

    Highlights of recent experimental and theoretical research progress on the high current beam transport of single and multiple beams by the Heavy Ion Fusion Accelerator Research (HIFAR) group at the Lawrence Berkeley Laboratory (LBL) are presented. In the single beam transport experiment (SBTE), stability boundaries and the emittance growth of a space charge dominated beam in a long quadrupole transport channel were measured and compared with theory and computer simulations. Also, a multiple beam ion induction linac (MBE-4) is being constructed at LBL which will permit study of multiple beam transport arrays, and acceleration and bunch length compression of individually focused beamlets. Various design considerations of MBE-4 regarding scaling laws, nonlinear effects, misalignments, and transverse and longitudinal space charge effects are summarized. Some aspects of longitudinal beam dynamics including schemes to generate the accelerating voltage waveforms and to amplify beam current are also discussed

  11. AC Voltage Control of DC/DC Converters Based on Modular Multilevel Converters in Multi-Terminal High-Voltage Direct Current Transmission Systems

    Directory of Open Access Journals (Sweden)

    Rui Li

    2016-12-01

    Full Text Available The AC voltage control of a DC/DC converter based on the modular multilevel converter (MMC is considered under normal operation and during a local DC fault. By actively setting the AC voltage according to the two DC voltages of the DC/DC converter, the modulation index can be near unity, and the DC voltage is effectively utilized to output higher AC voltage. This significantly decreases submodule (SM capacitance and conduction losses of the DC/DC converter, yielding reduced capital cost, volume, and higher efficiency. Additionally, the AC voltage is limited in the controllable range of both the MMCs in the DC/DC converter; thus, over-modulation and uncontrolled currents are actively avoided. The AC voltage control of the DC/DC converter during local DC faults, i.e., standby operation, is also proposed, where only the MMC connected on the faulty cable is blocked, while the other MMC remains operational with zero AC voltage output. Thus, the capacitor voltages can be regulated at the rated value and the decrease of the SM capacitor voltages after the blocking of the DC/DC converter is avoided. Moreover, the fault can still be isolated as quickly as the conventional approach, where both MMCs are blocked and the DC/DC converter is not exposed to the risk of overcurrent. The proposed AC voltage control strategy is assessed in a three-terminal high-voltage direct current (HVDC system incorporating a DC/DC converter, and the simulation results confirm its feasibility.

  12. Electric current induced forward and anomalous backward mass transport

    International Nuclear Information System (INIS)

    Somaiah, Nalla; Sharma, Deepak; Kumar, Praveen

    2016-01-01

    Multilayered test samples were fabricated in form of standard Blech structure, where W was used as the interlayer between SiO 2 substrate and Cu film. Electromigration test was performed at 250 °C by passing an electric current with a nominal density of 3.9  ×  10 10 A m −2 . In addition to the regular electromigration induced mass transport ensuing from the cathode towards the anode, we also observed anomalous mass transport from the anode to the cathode, depleting Cu from the anode as well. We propose an electromigration-thermomigration coupling based reasoning to explain the observed mass transport. (letter)

  13. Combined kinetic and transport modeling of radiofrequency current drive

    International Nuclear Information System (INIS)

    Dumont, R.; Giruzzi, G.; Barbato, E.

    2000-07-01

    A numerical model for predictive simulations of radiofrequency current drive in magnetically confined plasmas is developed. It includes the minimum requirements for a self consistent description of such regimes, i.e., a 3-D ,kinetic equation for the electron distribution function, 1-D heat and current transport equations, and resonant coupling between velocity space and configuration space dynamics, through suitable wave propagation equations. The model finds its full application in predictive studies of complex current profile control scenarios in tokamaks, aiming at the establishment of internal transport barriers by the simultaneous use of various radiofrequency current drive methods. The basic properties of this non-linear numerical system are investigated and illustrated by simulations applied to reversed magnetic shear regimes obtained by Lower Hybrid and Electron Cyclotron current drive for parameters typical of the Tore Supra tokamak. (authors)

  14. Temperature dependence of critical current and transport current losses of 4 mm YBCO coated conductors manufactured using nonmagnetic substrate

    Science.gov (United States)

    Kvitkovic, J.; Hatwar, R.; Pamidi, S. V.; Fleshler, S.; Thieme, C.

    2015-12-01

    The temperature dependence of the critical current and AC losses were measured on American Superconductor Corporation's (AMSC) second generation high temperature superconducting (2G HTS) wire produced by Rolling Assisted Biaxially Textured Substrate (RABiTS) and Metal Organic Deposition (MOD) process. Wires manufactured with two types of substrates were characterized. The magnetic substrate with composition Ni5a%W exhibits a magnetic signature and has non-negligible AC losses in AC power applications. A new nonmagnetic substrate with an alloy composition Ni9a%W has been developed by AMSC to address the AC losses in 2G HTS. The data presented show that the performance of the new conductor is identical to the conductor with magnetic substrate in terms of critical current density. The data on AC losses demonstrate the absence of ferromagnetic loss component in the new conductor and significantly reduced AC losses at low to moderate values of I/Ic. The reduced losses will translate into reduced capital costs and lower operating costs of superconducting electrical devices for AC applications.

  15. High-current beam transport in electrostatic accelerator tubes

    International Nuclear Information System (INIS)

    Ramian, G.; Elais, L.

    1987-01-01

    The UCSB Free Electron Laser (FEL) has successfully demonstrated the use of a commercial 6 megavolt electrostatic accelerator as a high current beam source in a recirculating configuration. The accelerator, manufactured by National Electrostatics Corp. (NEC), Middleton WI, uses two standard high gradient accelerator tubes. Suppression of ion multiplication was accomplished by NEC with apertures and a shaped electrostatic field. This field shaping has fortuitously provided a periodically reversing radial field component with sufficient focusing strength to transport electron beams of up to 3 Amps current. Present two-stage FEL work requires a 20 Amp beam and proposed very high voltage FEL designs require currents as high as 100 Amps. A plan to permit transport of such high current beams by the addition of solenoidal focussing elements is described

  16. Current status of high energy nucleon-meson transport code

    Energy Technology Data Exchange (ETDEWEB)

    Takada, Hiroshi; Sasa, Toshinobu [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1998-03-01

    Current status of design code of accelerator (NMTC/JAERI code), outline of physical model and evaluation of accuracy of code were reported. To evaluate the nuclear performance of accelerator and strong spallation neutron origin, the nuclear reaction between high energy proton and target nuclide and behaviors of various produced particles are necessary. The nuclear design of spallation neutron system used a calculation code system connected the high energy nucleon{center_dot}meson transport code and the neutron{center_dot}photon transport code. NMTC/JAERI is described by the particle evaporation process under consideration of competition reaction of intranuclear cascade and fission process. Particle transport calculation was carried out for proton, neutron, {pi}- and {mu}-meson. To verify and improve accuracy of high energy nucleon-meson transport code, data of spallation and spallation neutron fragment by the integral experiment were collected. (S.Y.)

  17. Study of critical current density from ac susceptibility measurements in (La1-xYx)2Ba2CaCu5O2 superconductors

    International Nuclear Information System (INIS)

    Nayak, P.K.; Ravi, S. . sravi@iitg.ernet.in

    2008-01-01

    We have prepared a series of compounds (La 1-x Y x ) 2 Ba 2 CaCu 5 O 2 for x = 0 to 0.5 by adding a CaCuO 2 layer to the parent compound La 2 Ba 2 Cu 4 O 2 and by doping Y in place of La. These materials are also prepared by adding 5 wt% of Ag to enhance the intergranular coupling and critical current density. X-ray diffraction measurements show that all the samples are essentially in single phase form and the patterns could be refined using P4/mmm space group in tetragonal cell. The typical lattice parameters are found to be a = b 3.856 A, c = 11.576 A for x = 0.5 sample. Temperature variations of dc electrical resistivity measured on the above samples show that they exhibit superconductivity with T c ranging from 60 to 75 K. Temperature and ac field amplitude variation of ac susceptibility have been measured on the above samples. The field variation of ac susceptibility data has been analyzed by using Bean critical state model. Using both temperature and field variations of ac susceptibility data, the material dependent parameters, such as critical current density as a function of temperature and effective volume fraction grains have been estimated. The Ag doped samples show relatively large critical current density compared to pure samples due to improved intergranular coupling. (author)

  18. High-current beam dynamics and transport, theory and experiment

    International Nuclear Information System (INIS)

    Reiser, M.

    1986-01-01

    Recent progress in the understanding of beam physics and technology factors determining the current and brightness of ion and electron beams in linear accelerators will be reviewed. Topics to be discussed including phase-space density constraints of particle sources, low-energy beam transport include charge neutralization, emittance growth due to mismatch, energy exchange, instabilities, nonlinear effects, and longitudinal bunching

  19. Modeling the current distribution in HTS tapes with transport current and applied magnetic field

    NARCIS (Netherlands)

    Yazawa, T.; Yazawa, Takashi; Rabbers, J.J.; Chevtchenko, O.A.; ten Haken, Bernard; ten Kate, Herman H.J.; Maeda, Hideaki

    1999-01-01

    A numerical model is developed for the current distribution in a high temperature superconducting (HTS) tape, (Bi,Pb)2Sr2 Ca2Cu3Ox-Ag, subjected to a combination of a transport current and an applied magnetic field. This analysis is based on a two-dimensional formulation of Maxwell's equations in

  20. Down-regulation of a novel ABC transporter gene (Pxwhite) is associated with Cry1Ac resistance in the diamondback moth, Plutella xylostella (L.).

    Science.gov (United States)

    Guo, Zhaojiang; Kang, Shi; Zhu, Xun; Xia, Jixing; Wu, Qingjun; Wang, Shaoli; Xie, Wen; Zhang, Youjun

    2015-04-01

    Biopesticides or transgenic crops based on Cry toxins from the soil bacterium Bacillus thuringiensis (Bt) effectively control agricultural insect pests. The sustainable use of Bt biopesticides and Bt crops is threatened, however, by the development of Cry resistance in the target pests. The diamondback moth, Plutella xylostella (L.), is the first pest that developed resistance to a Bt biopesticide in the field, and a recent study has shown that the resistance of P. xylostella to Cry1Ac is caused by a mutation in an ATP-binding cassette (ABC) transporter gene (ABCC2). In this study, we report that down-regulation of a novel ABC transporter gene from ABCG subfamily (Pxwhite) is associated with Cry1Ac resistance in P. xylostella. The full-length cDNA sequence of Pxwhite was cloned and analyzed. Spatial-temporal expression detection revealed that Pxwhite was expressed in all tissues and developmental stages, and highest expressed in Malpighian tubule tissue and in egg stage. Sequence variation analysis of Pxwhite indicated the absence of constant non-synonymous mutations between susceptible and resistant strains, whereas midgut transcript analysis showed that Pxwhite was remarkably reduced in all resistant strains and further reduced when larvae of the moderately resistant SZ-R strain were subjected to selection with Cry1Ac toxin. Furthermore, RNA interference (RNAi)-mediated suppression of Pxwhite gene expression significantly reduced larval susceptibility to Cry1Ac toxin, and genetic linkage analysis confirmed that down-regulation of Pxwhite gene is tightly linked to Cry1Ac resistance in P. xylostella. To our knowledge, this is the first report indicating that Pxwhite gene is involved in Cry1Ac resistance in P. xylostella. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. Modelling the transport system in China and evaluating the current strategies towards the sustainable transport development

    International Nuclear Information System (INIS)

    Liu, Wen; Lund, Henrik; Mathiesen, Brian Vad

    2013-01-01

    Transport is one of the most challenge sectors when addressing energy security and climate change due to its high reliance on oil products and lack of the alternative fuels. This paper explores the ability of three transport strategies to contribute to the development of a sustainable transport in China. With this purpose in mind, a Chinese transport model has been created and three current transport strategies which are high speed railway (HSR), urban rail transit (URT) and electric vehicle (EV) were evaluated together with a reference transport system in 2020. As conservative results, 13% of the energy saving and 12% of the CO 2 emission reduction can be attained by accomplishing three strategies compared with the reference transport system. However, the energy demand of transport in 2020 with the implementation of three strategies will be about 1.7 times as much as today. The three strategies show the potential of drawing the transport demand to the more energy efficient vehicles; however, more initiatives are needed if the sustainable transport is the long term objective, such as the solutions to stabilise the private vehicle demands, to continuously improve the vehicle efficiency and to boost the alternative fuels produced from the renewable energy sources. - Highlights: • A Chinese transport model was created and three transport strategies were evaluated • Transport is the biggest driver of the oil demand in China not the industry • The energy demand of transport in 2020 will be twice as much as today • Strategies contribute 13% energy saving and 12% CO 2 emission reduction • More initiatives are needed if a sustainable transport is the long-term objective

  2. Concentration polarization: Electrodeposition and transport phenomena at overlimiting current

    DEFF Research Database (Denmark)

    Nielsen, Christoffer Peder

    a numerical sharp-interface model describing the electrode growth. This model differs from the established phase-field models, in that it is applicable at overlimiting current and implements electrode reactions in a consistent way. Comparison of the sharp-interface model to the results of the stability...... methods. The initial study concerns a fundamental problem in the study of concentration polarization at overlimiting current, namely the emergence of an extended space-charge region near the ion-selective interface. Based on the so-called quasi-uniform charge density assumption (QCD), we develop...... this coupled chemical and transport effect using two simple models of the reaction kinetics. The principal investigations are performed using numerical simulations, but in addition we derive an analytical model for the transport in the system. The analytical model reveals an important link between the current...

  3. Current neutralization in ballistic transport of light ion beams

    International Nuclear Information System (INIS)

    Hubbard, R.F.; Slinker, S.P.; Lampe, M.; Joyce, G.; Ottinger, P.

    1992-01-01

    Intense light ion beams are being considered as drivers to ignite fusion targets in the Laboratory Microfusion Facility (LMF). Ballistic transport of these beams from the diode to the target is possible only if the beam current is almost completely neutralized by plasma currents. This paper summarizes related work on relativistic electron beam and heavy ion beam propagation and describes a simple simulation model (DYNAPROP) which has been modified to treat light ion beam propagation. DYNAPROP uses an envelope equation to treat beam dynamics and uses rate equations to describe plasma and conductivity generation. The model has been applied both to the high current, 30 MeV Li +3 beams for LMF as well as low current, 1.2 MeV proton beams which are currently being studied on GAMBLE B at the Naval Research Laboratory. The predicted ratio of net currents to beam current is ∼0.1--0.2 for the GAMBLE experiment and ∼0.01 for LMF. The implications of these results for LMF and the GAMBLE experiments art discussed in some detail. The simple resistive model in DYNAPROP has well-known limitations in the 1 torr regime which arise primarily from the neglect of plasma electron transport. Alternative methods for treating the plasma response are discussed

  4. Beta band transcranial alternating (tACS and direct current stimulation (tDCS applied after initial learning facilitate retrieval of a motor sequence

    Directory of Open Access Journals (Sweden)

    Vanessa eKrause

    2016-01-01

    Full Text Available The primary motor cortex (M1 contributes to the acquisition and early consolidation of a motor sequence. Although the relevance of M1 excitability for motor learning has been supported, the significance of M1 oscillations remains an open issue. This study aims at investigating to what extent retrieval of a newly learned motor sequence can be differentially affected by motor-cortical transcranial alternating (tACS and direct current stimulation (tDCS. Alpha (10 Hz, beta (20 Hz or sham tACS was applied in 36 right-handers. Anodal or cathodal tDCS was applied in 30 right-handers. Participants learned an eight-digit serial reaction time task (SRTT; sequential vs. random with the right hand. Stimulation was applied to the left M1 after SRTT acquisition at rest for ten minutes. Reaction times were analyzed at baseline, end of acquisition, retrieval immediately after stimulation and reacquisition after eight further sequence repetitions.Reaction times during retrieval were significantly faster following 20 Hz tACS as compared to 10 Hz and sham tACS indicating a facilitation of early consolidation. TDCS yielded faster reaction times, too, independent of polarity. No significant differences between 20 Hz tACS and tDCS effects on retrieval were found suggesting that 20 Hz effects might be associated with altered motor-cortical excitability. Based on the behavioural modulation yielded by tACS and tDCS one might speculate that altered motor-cortical beta oscillations support early motor consolidation possibly associated with neuroplastic reorganization.

  5. Scaling with toroidal current of impurity transport in ATC

    International Nuclear Information System (INIS)

    Marmar, E.S.; Cohen, S.A.; Cecchi, J.L.

    1976-06-01

    An experiment measuring the scaling with changing plasma conditions of a parameter characteristic of the transport of aluminum injected into the ATC tokamak is discussed. This parameter is the time after injection at which the photon signal from Al XI reaches its maximum. It is found that the data are in agreement with the predictions of a computer code which uses neoclassical theory in the Pfirsch-Schluter regime. An approximate model describing impurity transport in ATC is also presented. This model is utilized to calculate the expected scaling with current of the aluminum transport assuming classical, neoclassical and pseudoclassical forms for the diffusion coefficient. The data are in agreement with both the neoclassical and pseudoclassical results from this model

  6. Mesoscopic spin-flip transport through a hybrid system with a single molecular dot system applied with ac magnetic fields

    Energy Technology Data Exchange (ETDEWEB)

    Chen Qiao, E-mail: cqhy1127@yahoo.com.c [Department of Maths and Physics, Hunan Institute of Engineering, Xiangtan 411104 (China); Liu Jin [Institute of Theoretical Physics, Chinese Academy of Science, Beijing 100190 (China); Wang Zhiyong [School of Optoelectronic Information, Chongqing University of Technology, Chongqing 400054 (China)

    2011-01-17

    We have investigated the current for the system of vibrating quantum dot irradiated with a rotating magnetic field and an oscillating magnetic field by nonequilibrium Green's function. The rotating magnetic field rotates with the angular frequency {omega}{sub r} around the z-axis with the tilt angle {theta}, and the time-oscillating magnetic field is located in the z-axis with the angular frequency {omega}. Different behaviors have been shown in the presence of electron-phonon interaction (EPI) which plays a significant role in the transport. The current displays asymmetric behavior as the source-drain bias eV=0, novel side peaks or shoulders can be found due to the phonon absorption and emission procedure, and the negative differential resistance becomes stronger as the parameter g increases. Furthermore, the strong EPI also destroys the quasiperiodic oscillations of current in the region {mu}{sub 0}B{sub 1}>2.5{Delta}. The electron transport properties are also significantly influenced by the linewidth function {Gamma}.

  7. Liquid helium boil-off measurements of heat leakage from sinter-forged BSCCO current leads under DC and AC conditions

    International Nuclear Information System (INIS)

    Cha, Y.S.; Niemann, R.C.; Hull, J.R.; Youngdahl, C.A.; Lanagan, M.T.; Nakade, M.; Hara, T.

    1995-06-01

    Liquid helium boil-off experiments are conducted to determine the heat leakage rate of a pair of BSCCO 2223 high-temperature superconductor current leads made by sinter forging. The experiments are carried out in both DC and AC conditions and with and without an intermediate heat intercept. Current ranges are from 0-500 A for DC tests and 0-1,000 A rms for AC tests. The leads are self-cooled. Results show that magnetic hysteresis (AC) losses for both the BSCCO leads and the low-temperature superconductor current jumper are small for the current range. It is shown that significant reduction in heat leakage rate (liquid helium boil-off rate) is realized by using the BSCCO superconductor leads. At 100 A, the heat leakage rate of the BSCCO/copper binary lead is approximately 29% of that of the conventional copper lead. Further reduction in liquid helium boil-off rate can be achieved by using an intermediate heat intercept. For example, at 500 K, the heat leakage rate of the BSCCO/copper binary lead is only 7% of that of the conventional copper lead when an intermediate heat intercept is used

  8. Measurement of AC losses in a racetrack superconducting coil made from YBCO coated conductor

    DEFF Research Database (Denmark)

    Seiler, Eugen; Abrahamsen, Asger Bech; Kovac, Jan

    2012-01-01

    to reinforce it. The AC loss is measured versus the transport current Ia with the coil immersed in liquid nitrogen. Measurements at frequencies 21 Hz, 36 Hz and 72 Hz are compared. The AC losses follow I2 a dependence at low current amplitudes and I3 a at high amplitudes. After cutting the inner steel frame...

  9. High current transport experiment for heavy ion inertial fusion

    Directory of Open Access Journals (Sweden)

    L. R. Prost

    2005-02-01

    Full Text Available The High Current Experiment at Lawrence Berkeley National Laboratory is part of the U.S. program to explore heavy-ion beam transport at a scale representative of the low-energy end of an induction linac driver for fusion energy production. The primary mission of this experiment is to investigate aperture fill factors acceptable for the transport of space-charge-dominated heavy-ion beams at high intensity (line charge density ∼0.2  μC/m over long pulse durations (4  μs in alternating gradient focusing lattices of electrostatic or magnetic quadrupoles. This experiment is testing transport issues resulting from nonlinear space-charge effects and collective modes, beam centroid alignment and steering, envelope matching, image charges and focusing field nonlinearities, halo, and electron and gas cloud effects. We present the results for a coasting 1 MeV K^{+} ion beam transported through ten electrostatic quadrupoles. The measurements cover two different fill factor studies (60% and 80% of the clear aperture radius for which the transverse phase space of the beam was characterized in detail, along with beam energy measurements and the first halo measurements. Electrostatic quadrupole transport at high beam fill factor (≈80% is achieved with acceptable emittance growth and beam loss, even though the initial beam distribution is not ideal (but the emittance is low nor in thermal equilibrium. We achieved good envelope control, and rematching may only be needed every ten lattice periods (at 80% fill factor in a longer lattice of similar design. We also show that understanding and controlling the time dependence of the envelope parameters is critical to achieving high fill factors, notably because of the injector and matching section dynamics.

  10. Large A.C. machines theory and investigation methods of currents and losses in stator and rotor meshes including operation with nonlinear loads

    CERN Document Server

    Boguslawsky, Iliya; Hayakawa, Masashi

    2017-01-01

    In this monograph the authors solve the modern scientific problems connected with A.C. motors and generators, based first on the detailed consideration of their physical phenomena. The authors describe the theory and investigative methods they developed and applied in practice, which are considered to be of essential interest for specialists in the field of the electrical engineering industry in European countries, the USA, Argentina, and Brazil, as well as in such countries as India, China, and Iran. This book will be of interest to engineers specialized in the field of the manufacture, operation, and repair of A.C. machines (motors and generators) as well as electric drives; to professors, lecturers, and post-graduate students of technical universities, who are specializing in the field of electric machine engineering and electric drives; and to students who are engaged in the field of high current techniques, electric drives, and electric machine engineering.

  11. Entrainment, transport and deposition of sediment by saline gravity currents

    Science.gov (United States)

    Zordan, Jessica; Juez, Carmelo; Schleiss, Anton J.; Franca, Mário J.

    2018-05-01

    Few studies have addressed simultaneously the feedback between the hydrodynamics of a gravity current and the geomorphological changes of a mobile bed. Hydrodynamic quantities such as turbulent and mean velocities, bed shear stress and turbulent stresses undoubtedly govern the processes of entrainment, transport and deposition. On the other hand, the incorporation of entrained sediment in the current may change its momentum by introducing extra internal stresses, introducing thus a feedback process. These two main questions are here investigated. Laboratory experiments of saline gravity currents, produced by lock-exchange, flowing over a mobile bed channel reach, are here reported. Different initial buoyancies of the current in the lock are tested together with three different grain sizes of the non-coherent sediment that form the erodible bed. Results from velocity measurements are combined with the visualization of the sediment movement in the mobile reach and with post-test topographic and photo surveys of the geomorphology modifications of the channel bed. Mean and turbulent velocities are measured and bed shear stress and Reynolds stresses are estimated. We show that the mean vertical component of the velocity and bed shear stress are highly correlated with the first instants of sediment entrainment. Vertical turbulent velocity is similarly related to entrainment, although with lower correlation values, contributing as well to the sediment movement. Bed shear stress and Reynolds shear stress measured near the bed are correlated with sediment entrainment for longer periods, indicating that these quantities are associated to distal transport as well. Geomorphological changes in the mobile bed are strongly related to the impulse caused by the bed shear stress on the sediment. On the other hand, we show that the nature of the grain of the mobile bed reach influences the hydrodynamics of the current which means that a feedback mechanisms between both occurs during

  12. Transport simulations TFTR: Theoretically-based transport models and current scaling

    International Nuclear Information System (INIS)

    Redi, M.H.; Cummings, J.C.; Bush, C.E.; Fredrickson, E.; Grek, B.; Hahm, T.S.; Hill, K.W.; Johnson, D.W.; Mansfield, D.K.; Park, H.; Scott, S.D.; Stratton, B.C.; Synakowski, E.J.; Tang, W.M.; Taylor, G.

    1991-12-01

    In order to study the microscopic physics underlying observed L-mode current scaling, 1-1/2-d BALDUR has been used to simulate density and temperature profiles for high and low current, neutral beam heated discharges on TFTR with several semi-empirical, theoretically-based models previously compared for TFTR, including several versions of trapped electron drift wave driven transport. Experiments at TFTR, JET and D3-D show that I p scaling of τ E does not arise from edge modes as previously thought, and is most likely to arise from nonlocal processes or from the I p -dependence of local plasma core transport. Consistent with this, it is found that strong current scaling does not arise from any of several edge models of resistive ballooning. Simulations with the profile consistent drift wave model and with a new model for toroidal collisionless trapped electron mode core transport in a multimode formalism, lead to strong current scaling of τ E for the L-mode cases on TFTR. None of the theoretically-based models succeeded in simulating the measured temperature and density profiles for both high and low current experiments

  13. Radial transport of storm time ring current ions

    Science.gov (United States)

    Lui, A. T. Y.

    1993-01-01

    Radial transport of energetic ions for the development of the main phase of geomagnetic storms is investigated with data from the medium energy particle analyzer (MEPA) on the Charge Composition Explorer spacecraft, which monitored protons, helium ions, and the carbon-nitrogen-oxygen group, which is mostly dominated by oxygen ions. From a study of four geomagnetic storms, we show that the flux increase of these ions in the inner ring current region can be accounted for by an inward displacement of the ring current population by 0.5 to 3.5 R(E). There is a general trend that a larger inward displacement occurs at higher L shells than at lower ones. These results are in agreement with previous findings. The radially injected population consists of the prestorm population modified by substorm injections which occur on a much shorter time scale than that for a storm main phase. It is also found that the inward displacement is relatively independent of ion mass and energy, suggesting that the radial transport of these energetic ions is effected primarily by convective motion from a large electric field or by diffusion resulting from magnetic field fluctuations.

  14. Predicting AC loss in practical superconductors

    International Nuclear Information System (INIS)

    Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P

    2006-01-01

    Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time

  15. Modeling of HVDC System to Improve Estimation of Transient DC Current and Voltages for AC Line-to-Ground Fault—An Actual Case Study in Korea

    Directory of Open Access Journals (Sweden)

    Dohoon Kwon

    2017-10-01

    Full Text Available A new modeling method for high voltage direct current (HVDC systems and associated controllers is presented for the power system simulator for engineering (PSS/E simulation environment. The aim is to improve the estimation of the transient DC voltage and current in the event of an AC line-to-ground fault. The proposed method consists primary of three interconnected modules for (a equation conversion; (b control-mode selection; and (c DC-line modeling. Simulation case studies were carried out using PSS/E and a power systems computer aided design/electromagnetic transients including DC (PSCAD/EMTDC model of the Jeju– Haenam HVDC system in Korea. The simulation results are compared with actual operational data and the PSCAD/EMTDC simulation results for an HVDC system during single-phase and three-phase line-to-ground faults, respectively. These comparisons show that the proposed PSS/E modeling method results in the improved estimation of the dynamic variation in the DC voltage and current in the event of an AC network fault, with significant gains in computational efficiency, making it suitable for real-time analysis of HVDC systems.

  16. Characterization of current transport in ferroelectric polymer devices

    KAUST Repository

    Hanna, Amir

    2014-01-01

    We report the charge injection characteristics in poly(vinylidene fluoride-trifluoroethylene), P(VDF-TrFE), as a function of electrode material in metal/ferroelectric/metal device structures. Symmetric and asymmetric devices with Al, Ag, Au and Pt electrodes were fabricated to determine the dominant carrier type, injection current density, and to propose transport mechanisms in the ferroelectric polymer. Higher work function metals such as Pt are found to inject less charges compared to lower work function metals, implying n-type conduction behavior for P(VDF-TrFE) with electrons as the dominant injected carrier. Two distinct charge transport regimes were identified in the P(VDF-TrFE) devices; a Schottky-limited conduction regime for low to intermediate fields (E < 20 MV/m), and a space-charge limited conduction (SCLC) regime for high fields (20 < E < 120 MV/m). Implication of these results for degradation in P(VDF-TrFE) memory performance are discussed. © 2013 Elsevier B.V. All rights reserved.

  17. Final report SBIR Phase II. High current density (Jc), low A.C . loss, low cost, Internal-Tin Superconductors

    International Nuclear Information System (INIS)

    Gregory, Eric

    2009-01-01

    Final report of SBIR to develop an economical process that can produce the best material for high field magnets to be used in the next generation of accelerators. The overall objective is to develop an economical process that can produce the best material for high field magnets to be used in future particle accelerators. The internal-tin process has shown by others to produce high J c Nb 3 Sn material and the work here is primarily directed to lowering the AC losses, increasing piece lengths and lowering costs. In the previous reports on this Phase II work we have explored the finned restack approach. We have however encountered ductility problems when we have attempted to produce material without fins but with large numbers of subelements in the restacks. The work reported has concentrated on the scale up of the internal-tin materials without fins and we have finally made internal tin material with 40 (micro)m subelements which exhibited a J c at 12 T of 2757 A/mm 2 in the non-Cu and a J c at 14 T of 1985 A/mm 2 in the non-Cu. These results are the best we have achieved to date and are approaching those that Oxford has achieved for sometime.

  18. A Circulating Current Suppression Method for Parallel Connected Voltage-Source-Inverters (VSI) with Common DC and AC Buses

    DEFF Research Database (Denmark)

    Wei, Baoze; Guerrero, Josep M.; Quintero, Juan Carlos Vasquez

    2016-01-01

    This paper describes a theoretical with experiment study on a control strategy for the parallel operation of threephase voltage source inverters (VSI), to be applied to uninterruptible power systems (UPS). A circulating current suppression strategy for parallel VSIs is proposed in this paper based...... on circulating current control loops used to modify the reference currents by compensating the error currents among parallel inverters. Both of the cross and zero-sequence circulating currents are considered. The proposed method is coordinated together with droop and virtual impedance control. In this paper......, droop control is used to generate the reference voltage of each inverter, and the virtual impedance is used to fix the output impedance of the inverters. In addition, a secondary control is used in order to recover the voltage deviation caused by the virtual impedance. And the auxiliary current control...

  19. ACS Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2005-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

  20. Pulse pattern modulated strategy for harmonic current components reduction in three-phase AC-DC converters

    DEFF Research Database (Denmark)

    Davari, Pooya; Zare, Firuz; Blaabjerg, Frede

    2015-01-01

    , which need to be considered in order to be competitive in the market. Therefore, having a flexibility to meet various requirements imposed by the standard recommendations or costumer needs is at most desirable. This makes the generated harmonic current mitigation a challenging task especially with three......-phase diode bridge rectifier, which still is preferred in many power electronic systems. This paper addresses a novel current modulation strategy using a single-switch boost three-phase diode bridge rectifier. The proposed method can selectively mitigate current harmonics, which makes it suitable...

  1. Dynamic modelling and robust current control of wind-turbine driven DFIG during external AC voltage dip

    Institute of Scientific and Technical Information of China (English)

    HU Jia-bing; HE Yi-kang

    2006-01-01

    Doubly-FedInduction Generator (DFIG), with vector control applied, is widely used in Variable-Speed ConstantFrequency (VSCF) windenergy generation system and shows good performance in maximum wind energy capture. But in two traditional vector control schemes, the equivalent stator magnetizing current is considered invariant in order to simplify the rotor current inner-loop controller. The two schemes can perform very well when the grid is in normal condition. However, when grid disturbance such as grid voltage dip or swell fault occurs, the control performance worsens, the rotor over current occurs and the Fault Ride-Through (FRT) capability of the DFIG wind energy generation system gets seriously deteriorated. An accurate DFIG model was used to deeply investigate the deficiency of the traditional vector control. The improved control schemes of two typical traditional vector control schemes used in DFIG were proposed, and simulation study of the proposed and traditional control schemes, with robust rotor current control using Internal Model Control (IMC) method, was carried out. The validity of the proposed modified schemes to control the rotor current and to improve the FRT capability of the DFIG wind energy generation system was proved by the comparison study.

  2. Currents and fluctuations of quantum heat transport in harmonic chains

    International Nuclear Information System (INIS)

    Motz, T; Ankerhold, J; Stockburger, J T

    2017-01-01

    Heat transport in open quantum systems is particularly susceptible to the modeling of system–reservoir interactions. It thus requires us to consistently treat the coupling between a quantum system and its environment. While perturbative approaches are successfully used in fields like quantum optics and quantum information, they reveal deficiencies—typically in the context of thermodynamics, when it is essential to respect additional criteria such as fluctuation-dissipation theorems. We use a non-perturbative approach for quantum dissipative dynamics based on a stochastic Liouville–von Neumann equation to provide a very general and extremely efficient formalism for heat currents and their correlations in open harmonic chains. Specific results are derived not only for first- but also for second-order moments, which requires us to account for both real and imaginary parts of bath–bath correlation functions. Spatiotemporal patterns are compared with weak coupling calculations. The regime of stronger system–reservoir couplings gives rise to an intimate interplay between reservoir fluctuations and heat transfer far from equilibrium. (paper)

  3. Transport current dependence of the hysteresis loss in silver sheathed BSCOO-2212 conductors

    NARCIS (Netherlands)

    Hemmes, Herman K.; Woudstra, Martin J.; ten Kate, Herman H.J.; Tenbrink, Johannes

    1994-01-01

    A technique is described to study the critical current density and penetration fieldassociated with the transport current in a silver sheathed BSCCO conductor. A transport current flowing in a conductor in a varying magnetic field will only influence magnetisation currents that are in competition

  4. Effective Leadership and Management of an ACS Injury Prevention Program: Current Opinions and Perspectives From Where the Rubber Meets the Road.

    Science.gov (United States)

    Wolfe, Elizabeth S; Bryant, Elizabeth A

    The American College of Surgeons (ACS) mandates that each verified trauma center must have an injury prevention coordinator (IPC); however, Chapter 18 in the Resources for Optimal Care of the Injured Patient (2014) provides minimal information on how to effectively lead or manage an injury prevention (IP) program. This opinion article addresses 3 fundamental components of an effective IP program: (1) construction of an innovative vision of IP programming using current technology; (2) intentional investment and involvement; and (3) stakeholder leadership, engagement, and sustainability. This article also provides leadership and management methods from other professions both within and outside of the health care field that can be translated into sustainable IP program planning, implementation, and longevity.

  5. Design of six pulse bridge multiplication converter model for current harmonic elimination of three phase ac-dc converter

    International Nuclear Information System (INIS)

    Soomro, M.A.; Helepoto, I.A.

    2014-01-01

    The recent development of semiconductor technology and wide spread use of power electronic devices in power system have open the era of the power system harmonics due to increasing penetration of non-linear loads. Harmonics are widely admitted as most important issues of power quality which must be eliminated to maintain power system reliability. The tolerable THD (Total Harmonic Distortion) values must be bounded in well-defined limits recognized by IEEE-519 standard. In this work, in order to eliminate the current harmonics produced by non-linear loads, six pulse multiplication converter technique in conjunction with STSSHPE (Single Tuned Shunt Harmonic Passive Filter) is proposed. The proposed model has the capacity of harmonic cancellation of the dominant 3rd order harmonics. Besides that, the 5th and 7th order harmonics are also reduced to a diminishing level. The hardware model has been experimentally tested by PQA (Power Quality Analyzer) and simulation model is designed using MATLAB software. The acquired results have been measured by considering THD values in terms of current and voltage. Furthermore, they have been compared against IEEE-519 performance standards. The prosed model, successfully bounds the total harmonic distortion under defined limits by IEEE-519 standard. (author)

  6. Current issues in the impacts of transport on health.

    Science.gov (United States)

    van Schalkwyk, M C I; Mindell, J S

    2018-03-01

    Transport affects health in many ways. Benefits include access to education, employment, goods, services and leisure, and opportunities for incorporating physical activity into daily living. There are major inequalities: benefits generally accrue to wealthier people and harms to the more deprived, nationally and globally. Health on the Move 2; Journal of Transport and Health. Benefits of travel for access and physical activity. Harms include health impacts of air and noise pollution; injuries and fatalities from falls or collisions; sedentary behaviour with motorized transport; community severance (barrier effect of busy roads and transport infrastructure); global climate change; impacts on inequalities; transport's role in facilitating spread of communicable diseases. Biofuels; cycle safety; driving by older people. Effects of default 20 mph speed limits; impacts of autonomous vehicles on health and inequalities.

  7. Space transportation systems within ESA programmes: Current status and perspectives

    Science.gov (United States)

    Delahais, Maurice

    1993-03-01

    An overview of the space transportation aspects of the ESA (European Space Agency) programs as they result from history, present status, and decisions taken at the ministerial level conference in Granada, Spain is presented. The new factors taken into consideration for the long term plan proposed in Munich, Germany, the three strategic options for the reorientation of the ESA long term plan, and the essential elements of space transportation in the Granada long term plan in three areas of space activities, scientific, and commercial launches with expendable launch vehicles, manned flight and in-orbit infrastructure, and future transportation systems are outlined. The new ESA long term plan, in the field of space transportation systems, constitutes a reorientation of the initial program contemplated in previous councils at ministerial level. It aims at balancing the new economic situation with the new avenues of cooperation, and the outcome will be a new implementation of the space transportation systems policy.

  8. Transport analysis of rf drift-velocity filter employing crossed DC and AC electric fields for ion swarm experiments

    International Nuclear Information System (INIS)

    Iinuma, K.; Takebe, M.

    1995-01-01

    The operational characteristics of the RF drift-velocity filter developed to separate a mixture of gaseous ions are examined theoretically. The solutions of the appropriate transport equations provide an analytical formula for the transmission efficiency of the filter in terms of the mobility and diffusion coefficient of the ions, the electric field strength, the RF frequency and the filter dimension. Using the experimental transport data for Li + /Xe and Cs + /Xe, the formula was tested and it was found that it adequately accounts for the degree of ion separation achieved by the filter at high gas pressures. The variation of the profiles of the arrival time spectra for Li + , Na + and Cs + ions in CO 2 , obtained by drift-tube experiments, also supports this analysis. 4 refs., 10 figs

  9. Meridional Flow Observations: Implications for the current Flux Transport Models

    International Nuclear Information System (INIS)

    Gonzalez Hernandez, Irene; Komm, Rudolf; Kholikov, Shukur; Howe, Rachel; Hill, Frank

    2011-01-01

    Meridional circulation has become a key element in the solar dynamo flux transport models. Available helioseismic observations from several instruments, Taiwan Oscillation Network (TON), Global Oscillation Network Group (GONG) and Michelson Doppler Imager (MDI), have made possible a continuous monitoring of the solar meridional flow in the subphotospheric layers for the last solar cycle, including the recent extended minimum. Here we review some of the meridional circulation observations using local helioseismology techniques and relate them to magnetic flux transport models.

  10. Clast comminution during pyroclastic density current transport: Mt St Helens

    Science.gov (United States)

    Dawson, B.; Brand, B. D.; Dufek, J.

    2011-12-01

    Volcanic clasts within pyroclastic density currents (PDCs) tend to be more rounded than those in fall deposits. This rounding reflects degrees of comminution during transport, which produces an increase in fine-grained ash with distance from source (Manga, M., Patel, A., Dufek., J. 2011. Bull Volcanol 73: 321-333). The amount of ash produced due to comminution can potentially affect runout distance, deposit sorting, the volume of ash lofted into the upper atmosphere, and increase internal pore pressure (e.g., Wohletz, K., Sheridan, M. F., Brown, W.K. 1989. J Geophy Res, 94, 15703-15721). For example, increased pore pressure has been shown to produce longer runout distances than non-comminuted PDC flows (e.g., Dufek, J., and M. Manga, 2008. J. Geophy Res, 113). We build on the work of Manga et al., (2011) by completing a pumice abrasion study for two well-exposed flow units from the May 18th, 1980 eruption of Mt St Helens (MSH). To quantify differences in comminution from source, sampling and the image analysis technique developed in Manga et al., 2010 was completed at distances proximal, medial, and distal from source. Within the units observed, data was taken from the base, middle, and pumice lobes within the outcrops. Our study is unique in that in addition to quantifying the degree of pumice rounding with distance from source, we also determine the possible range of ash sizes produced during comminution by analyzing bubble wall thickness of the pumice through petrographic and SEM analysis. The proportion of this ash size is then measured relative to the grain size of larger ash with distance from source. This allows us to correlate ash production with degree of rounding with distance from source, and determine the fraction of the fine ash produced due to comminution versus vent-fragmentation mechanisms. In addition we test the error in 2D analysis by completing a 3D image analysis of selected pumice samples using a Camsizer. We find that the roundness of PDC

  11. Fault current limiter

    Science.gov (United States)

    Darmann, Francis Anthony

    2013-10-08

    A fault current limiter (FCL) includes a series of high permeability posts for collectively define a core for the FCL. A DC coil, for the purposes of saturating a portion of the high permeability posts, surrounds the complete structure outside of an enclosure in the form of a vessel. The vessel contains a dielectric insulation medium. AC coils, for transporting AC current, are wound on insulating formers and electrically interconnected to each other in a manner such that the senses of the magnetic field produced by each AC coil in the corresponding high permeability core are opposing. There are insulation barriers between phases to improve dielectric withstand properties of the dielectric medium.

  12. Current issues in the transport of radioactive waste and spent fuel: work by the World Nuclear Transport Institute

    Energy Technology Data Exchange (ETDEWEB)

    Neau, H-J.; Bonnardel-Azzarelli, B. [World Nuclear Transport Inst., London (United Kingdom)

    2014-07-01

    Various kinds of radioactive waste are generated from nuclear power and fuel cycle facilities. These materials have to be treated, stored and eventually sent to a repository site. Transport of wastes between these various stages is crucial for the sustainable utilization of nuclear energy. The IAEA Regulations for the Safe Transport of Radioactive Material (SSR-6) have, for many decades, provided a safe and efficient framework for radioactive materials transport and continue to do so. However, some shippers have experienced that in the transport of certain specific radioactive wastes, difficulties can be encountered. For example, some materials produced in the decommissioning of nuclear facilities are unique in terms of composition or size and can be difficult to characterize as surface contaminated objects (SCO) or homogeneous. One way WNTI (World Nuclear Transport Institute) helps develop transport methodologies is through the use of Industry Working Groups, bringing together WNTI members with common interests, issues and experiences. The Back-End Transport Industry Working Group focuses on the following issues currently. - Characterization of Waste: techniques and methods to classify wastes - Large Objects: slightly contaminated large objects (ex. spent steam generators) transport - Dual Use Casks: transportable storage casks for spent nuclear fuels, including the very long term storage of spent fuel - Fissile Exceptions: new fissile exceptions provisions of revised TS-R-1 (SSR-6) The paper gives a broad overview of current issues for the packaging and transport of radioactive wastes and the associated work of the WNTI. (author)

  13. Current transport mechanisms in mercury cadmium telluride diode

    Energy Technology Data Exchange (ETDEWEB)

    Gopal, Vishnu, E-mail: vishnu-46@yahoo.com, E-mail: wdhu@mail.sitp.ac.cn [Institute of Defence Scientists and Technologists, CFEES Complex, Brig. S. K. Majumdar Marg, Delhi 110054 (India); Li, Qing; He, Jiale; Hu, Weida, E-mail: vishnu-46@yahoo.com, E-mail: wdhu@mail.sitp.ac.cn [National Lab for Infrared Physics, Shanghai Institute of Technical Physics, Chinese Academy of Sciences, Shanghai 200083 (China); He, Kai; Lin, Chun [Key Laboratory of Infrared Imaging Materials and Detectors, Shanghai Institute of Technical Physics, Chinese Academy of Sciences, Shanghai 200083 (China)

    2016-08-28

    This paper reports the results of modelling of the current-voltage characteristics (I-V) of a planar mid-wave Mercury Cadmium Telluride photodiode in a gate controlled diode experiment. It is reported that the diode exhibits nearly ideal I-V characteristics under the optimum surface potential leading to the minimal surface leakage current. Deviations from the optimum surface potential lead to non ideal I–V characteristics, indicating a strong relationship between the ideality factor of the diode with its surface leakage current. Diode's I–V characteristics have been modelled over a range of gate voltages from −9 V to −2 V. This range of gate voltages includes accumulation, flat band, and depletion and inversion conditions below the gate structure of the diode. It is shown that the I–V characteristics of the diode can be very well described by (i) thermal diffusion current, (ii) ohmic shunt current, (iii) photo-current due to background illumination, and (iv) excess current that grows by the process of avalanche multiplication in the gate voltage range from −3 V to −5 V that corresponds to the optimum surface potential. Outside the optimum gate voltage range, the origin of the excess current of the diode is associated with its high surface leakage currents. It is reported that the ohmic shunt current model applies to small surface leakage currents. The higher surface leakage currents exhibit a nonlinear shunt behaviour. It is also shown that the observed zero-bias dynamic resistance of the diode over the entire gate voltage range is the sum of ohmic shunt resistance and estimated zero-bias dynamic resistance of the diode from its thermal saturation current.

  14. Magneto-optical measurements on high-temperature superconductors influenced by AC-fields

    International Nuclear Information System (INIS)

    Che'Rose, Simon

    2007-01-01

    In this work magneto-optical measurements on YBa 2 Cu 3 O 7-x and MgB 2 thin films were done. For YBCO the influence of AC-pulses on the flux and current density of a thin film with transport current was investigated. For MgB 2 the influence of AC-fields on the homogenous and dendritic flux penetration was researched. (orig.)

  15. Critical transport current in granular high temperature superconductors

    International Nuclear Information System (INIS)

    Bogolyubov, N.A.

    1999-01-01

    The temperature and size dependence of the critical current in a zero magnetic field of three bismuth-based ceramic samples with round cross section and one sample with rectangular triangle cross section have been studied by a contactless technique. It is shown that the critical current can be presented as a product of the temperature and size dependent factors. The temperature-dependent multiplier reflects the individual peculiarities of the Josephson net of each sample, while the size factor is a homogeneous function of the cross-section sizes. The index of this function is independent of the cross-section form, the temperature and individual properties of HTSC samples. The radial distribution of critical current density in round samples and dependence of the critical current density on the magnetic conduction in granular HTSC have been found from the analysis of experimental data

  16. Transport current anisotropy in oriented grained bulk YBa2Cu3O(x) superconductor

    International Nuclear Information System (INIS)

    Selvamanickam, V.; Salama, K.

    1990-01-01

    The anisotropy in transport current density has been studied on bulk YBa2Cu3O(x) superconductor. The transport current density measurements were performed on oriented grained YBa2Cu3O(x) superconductor with the current aligned at different angles to the a-b plane. The angular dependence of Jc shows a rapid drop when the transport current is misaligned from the a-b plane at small angles and then a slow decrease at higher angles. An anisotropy ratio of about 25 is observed at 77 K and zero field between the Jc along a-b plane and that perpendicular to the plane. 15 refs

  17. Transport current anisotropy in oriented grained bulk YBa2Cu3Ox superconductor

    International Nuclear Information System (INIS)

    Selvamanickam, V.; Salama, K.

    1990-01-01

    The anisotropy in transport current density has been studied on bulk YBa 2 Cu 3 O x superconductor. The transport current density measurements were performed on oriented grained YBa 2 Cu 3 O x superconductor with the current aligned at different angles to the a endash b plane. The angular dependence of J c shows a rapid drop when the transport current is misaligned from the a endash b plane at small angles and then a slow decrease at higher angles. An anisotropy ratio of about 25 is observed at 77 K and zero field between the J c along a endash b plane and that perpendicular to the plane

  18. Solar Energetic Particle Transport Near a Heliospheric Current Sheet

    Energy Technology Data Exchange (ETDEWEB)

    Battarbee, Markus; Dalla, Silvia [Jeremiah Horrocks Institute, University of Central Lancashire, PR1 2HE (United Kingdom); Marsh, Mike S., E-mail: mbattarbee@uclan.ac.uk [Met Office, Exeter, EX1 3 PB (United Kingdom)

    2017-02-10

    Solar energetic particles (SEPs), a major component of space weather, propagate through the interplanetary medium strongly guided by the interplanetary magnetic field (IMF). In this work, we analyze the implications that a flat Heliospheric Current Sheet (HCS) has on proton propagation from SEP release sites to the Earth. We simulate proton propagation by integrating fully 3D trajectories near an analytically defined flat current sheet, collecting comprehensive statistics into histograms, fluence maps, and virtual observer time profiles within an energy range of 1–800 MeV. We show that protons experience significant current sheet drift to distant longitudes, causing time profiles to exhibit multiple components, which are a potential source of confusing interpretations of observations. We find that variation of the current sheet thickness within a realistic parameter range has little effect on particle propagation. We show that the IMF configuration strongly affects the deceleration of protons. We show that in our model, the presence of a flat equatorial HCS in the inner heliosphere limits the crossing of protons into the opposite hemisphere.

  19. A new approach for AC loss reduction in HTS transformer using auxiliary windings, case study: 25 kA HTS current injection transformer

    Science.gov (United States)

    Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza

    2008-01-01

    AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency.

  20. A new approach for AC loss reduction in HTS transformer using auxiliary windings, case study: 25 kA HTS current injection transformer

    International Nuclear Information System (INIS)

    Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza

    2008-01-01

    AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency

  1. A new approach for AC loss reduction in HTS transformer using auxiliary windings, case study: 25 kA HTS current injection transformer

    Energy Technology Data Exchange (ETDEWEB)

    Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza [Center of Excellence for Power System Automation and Operation, Electrical Engineering Department, Iran University of Science and Technology, Tehran (Iran, Islamic Republic of)

    2008-01-15

    AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency.

  2. Secondary Flows and Sediment Transport due to Wave - Current Interaction

    Science.gov (United States)

    Ismail, Nabil; Wiegel, Robert

    2015-04-01

    Objectives: The main purpose of this study is to determine the modifications of coastal processes driven by wave-current interaction and thus to confirm hydrodynamic mechanisms associated with the interaction at river mouths and tidal inlets where anthropogenic impacts were introduced. Further, the aim of the work has been to characterize the effect of the relative strength of momentum action of waves to the opposing current on the nearshore circulation where river flow was previously effective to entrain sediments along the shoreline. Such analytical information are useful to provide guidelines for sustainable design of coastal defense structures. Methodology and Analysis: Use is made of an earlier study reported by the authors (1983) on the interaction of horizontal momentum jets and opposing shallow water waves at shorelines, and of an unpublished laboratory study (1980). The turbulent horizontal discharge was shore-normal, directed offshore, and the incident wave direction was shore-normal, travelling toward shore. Flow visualization at the smooth bottom and the water surface, velocity and water surface elevation measurements were made. Results were obtained for wave , current modifications as well as the flow pattern in the jet and the induced circulation on both sides of the jet, for a range of wave and jet characteristics. The experimental data, obtained from measurement in the 3-D laboratory basin, showed several distinct flow pattern regimes on the bottom and the water surface. The observed flow circulation regimes were found to depend on the ratio of the wave momentum action on the jet to the jet initial momentum. Based on the time and length scales of wave and current parameters and using the time average of the depth integrated conservation equations, it is found that the relative strength of the wave action on the jet could be represented by a dimensionless expression; Rsm ( ) 12ρSa20g-L0h-Cg- 2 Rsm ≈ (C0 - U) /ρ0U w (1) In the above dimensionless

  3. Drug-induced GABA transporter currents enhance GABA release to induce opioid withdrawal behaviors.

    Science.gov (United States)

    Bagley, Elena E; Hacker, Jennifer; Chefer, Vladimir I; Mallet, Christophe; McNally, Gavan P; Chieng, Billy C H; Perroud, Julie; Shippenberg, Toni S; Christie, MacDonald J

    2011-10-30

    Neurotransmitter transporters can affect neuronal excitability indirectly via modulation of neurotransmitter concentrations or directly via transporter currents. A physiological or pathophysiological role for transporter currents has not been described. We found that GABA transporter 1 (GAT-1) cation currents directly increased GABAergic neuronal excitability and synaptic GABA release in the periaqueductal gray (PAG) during opioid withdrawal in rodents. In contrast, GAT-1 did not indirectly alter GABA receptor responses via modulation of extracellular GABA concentrations. Notably, we found that GAT-1-induced increases in GABAergic activity contributed to many PAG-mediated signs of opioid withdrawal. Together, these data support the hypothesis that GAT-1 activity directly produces opioid withdrawal signs through direct hyperexcitation of GABAergic PAG neurons and nerve terminals, which presumably enhances GABAergic inhibition of PAG output neurons. These data provide, to the best of our knowledge, the first evidence that dysregulation of a neurotransmitter transporter current is important for the maladaptive plasticity that underlies opiate withdrawal.

  4. Current leads for superconducting solenoids in a transportable Dewar flask for currents up to 1kA

    International Nuclear Information System (INIS)

    Shirshov, L.S.

    1981-01-01

    A simple design of the current lead for currents up to 1 kA into a transportable helium dewar with 22 mm neck diameter is described. The lead characteristics have been studied at various conditions. Examples of pulse superconducting solenoid usage, parmitting to achieve the magnetic field up to 3.3 T are given. The 1% field homogeneity has been obtained on a length of 90 mm [ru

  5. Transport critical current density in flux creep model

    International Nuclear Information System (INIS)

    Wang, J.; Taylor, K.N.R.; Russell, G.J.; Yue, Y.

    1992-01-01

    The magnetic flux creep model has been used to derive the temperature dependence of the critical current density in high temperature superconductors. The generally positive curvature of the J c -T diagram is predicted in terms of two interdependent dimensionless fitting parameters. In this paper, the results are compared with both SIS and SNS junction models of these granular materials, neither of which provides a satisfactory prediction of the experimental data. A hybrid model combining the flux creep and SNS mechanisms is shown to be able to account for the linear regions of the J c -T behavior which are observed in some materials

  6. AC Initiation System.

    Science.gov (United States)

    An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)

  7. The effect of non-inductive current drive on tokamak transport

    International Nuclear Information System (INIS)

    Helander, P; Akers, R J; Valovic, M; Peysson, Y

    2005-01-01

    Non-inductive current drive causes cross-field neoclassical transport in a tokamak, in much the same way that the toroidal electric field used to drive the plasma current produces the so-called Ware pinch. This transport can be either inwards or outwards, depending on the current drive mechanism, and can be either larger or smaller than the analogous Ware pinch. A Green's function formalism is used to calculate the transport produced by wave-driven currents, which is found to be inwards for electron-cyclotron and lower-hybrid current drive. Its magnitude is proportional to the collisionality of the current-carrying electrons and therefore smaller than the Ware pinch when the resonant electrons are suprathermal. In contrast, neutral-beam current drive produces outward particle transport when the beams are injected in the same toroidal direction as the plasma current, and inward particle transport otherwise. This transport is somewhat larger than the corresponding Ware pinch. Together, they may explain an observation made on several tokamaks over the years, most recently on MAST, that density profiles tend to be more peaked during counter-injection

  8. Revealing origin of quasi-one dimensional current transport in defect rich two dimensional materials

    DEFF Research Database (Denmark)

    Lotz, Mikkel Rønne; Boll, Mads; Hansen, Ole

    2014-01-01

    to a non-uniform current flow characteristic of lower dimensionality. In this work, simulations based on a finite element method together with a Monte Carlo approach are used to establish the transition from 2D to quasi-1D current transport, when applying a micro four-point probe to measure on 2D...... conductors with an increasing amount of line-shaped defects. Clear 2D and 1D signatures are observed at low and high defect densities, respectively, and current density plots reveal the presence of current channels or branches in defect configurations yielding 1D current transport. A strong correlation...

  9. ACS Photometric Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

  10. Predictive Current Control of a 7-level AC-DC back-to-back Converter for Universal and Flexible Power Management System

    DEFF Research Database (Denmark)

    Bifaretti, Steffano; Zanchetta, Pericle; Iov, Florin

    2008-01-01

    The paper proposes a novel power conversion system for Universal and Flexible Power Management (UNIFLEX-PM) in Future Electricity Network. Its structure is based on a back-to-back three-phase AC-DC 7-level converter; each AC side is connected to a different PCC, representing the main grid and....../or various distributed generation systems. Effective and accurate power flow control is demonstrated through simulation in Matlab- Simulink environment on a model based on a two-port structure and using a Predictive Control technique. Control of different Power flow profiles has been successfully tested...

  11. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  12. Current-based detection of nonlocal spin transport in graphene for spin-based logic applications

    Science.gov (United States)

    Wen, Hua; Zhu, Tiancong; Luo, Yunqiu Kelly; Amamou, Walid; Kawakami, Roland K.

    2014-05-01

    Graphene has been proposed for novel spintronic devices due to its robust and efficient spin transport properties at room temperature. Some of the most promising proposals require current-based readout for integration purposes, but the current-based detection of spin accumulation has not yet been developed. In this work, we demonstrate current-based detection of spin transport in graphene using a modified nonlocal geometry. By adding a variable shunt resistor in parallel to the nonlocal voltmeter, we are able to systematically cross over from the conventional voltage-based detection to current-based detection. As the shunt resistor is reduced, the output current from the spin accumulation increases as the shunt resistance drops below a characteristic value R*. We analyze this behavior using a one-dimensional drift-diffusion model, which accounts well for the observed behavior. These results provide the experimental and theoretical foundation for current-based detection of nonlocal spin transport.

  13. AC power losses in Bi-2223/Ag HTS tapes

    International Nuclear Information System (INIS)

    Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.

    1998-01-01

    Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour

  14. A current view of serotonin transporters [version 1; referees: 3 approved

    Directory of Open Access Journals (Sweden)

    Louis J. De Felice

    2016-07-01

    Full Text Available Serotonin transporters (SERTs are largely recognized for one aspect of their function—to transport serotonin back into the presynaptic terminal after its release. Another aspect of their function, however, may be to generate currents large enough to have physiological consequences. The standard model for electrogenic transport is the alternating access model, in which serotonin is transported with a fixed ratio of co-transported ions resulting in net charge per cycle. The alternating access model, however, cannot account for all the observed currents through SERT or other monoamine transporters.  Furthermore, SERT agonists like ecstasy or antagonists like fluoxetine generate or suppress currents that the standard model cannot support.  Here we survey evidence for a channel mode of transport in which transmitters and ions move through a pore. Available structures for dopamine and serotonin transporters, however, provide no evidence for a pore conformation, raising questions of whether the proposed channel mode actually exists or whether the structural data are perhaps missing a transient open state.

  15. Plasma flow between equipotential electrodes in an ion current transport mode

    International Nuclear Information System (INIS)

    Zimin, A.M.; Morozov, A.I.

    1995-01-01

    The paper deals with calculation of parameters in accelerator channel and near electrodes, when realizing ion current transport mode. Model on the basis of two-dimensional two-liquid nondissipative magnetohydrodynamics was formulated, and its solution for isomagnetic flow in smooth channel approximation was conducted. Change of parameters near anode surface was considered in detail. It is shown that regular joining of flow with equipotential electrodes without large near-electrode jumps is performed during ion current transport. Current distribution along accelerator length was calculated when determining ion intake through anode surface due to inertial-drift emission. It is shown that this mechanism can provide rather high current density in ion current transport. 10 refs.; 6 figs

  16. Charge and current transport in open field lines turbulence: Influence of plasma-surface boundary conditions

    Energy Technology Data Exchange (ETDEWEB)

    Futtersack, R., E-mail: romain.futtersack@cea.fr [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Universite Paul Sabatier Toulouse, LAPLACE, 118 Route de Narbonne, F-31062 Toulouse Cedex 9 (France); Tamain, P. [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Hagelaar, G. [Universite Paul Sabatier Toulouse, LAPLACE, 118 Route de Narbonne, F-31062 Toulouse Cedex 9 (France); Ghendrih, Ph.; Simonin, A. [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France)

    2013-07-15

    We investigate the impact of both parallel and transverse boundary conditions on the current and charge transport in open field line systems using the TOKAM2D code, which solves a minimal model for interchange turbulence. Various limit test cases are discussed and analyzed. In the parallel direction, the sheath conductivity is found to play an essential role in the stabilization of large-scale potential structures, leading to the formation of transport channel or transport barrier respectively for an insulating end wall or a wall with an enhanced sheath conductivity. On another hand, the addition of transverse boundary conditions intrinsically changes the transport characteristics, influencing both radial profiles and probability density functions. It underlines that in some cases a detailed description of the plasma-wall interaction process is required to get a proper description of the current loop pattern that determines electrostatic turbulent transport.

  17. Efficiency of LH current drive in tokamaks featuring an internal transport barrier

    International Nuclear Information System (INIS)

    Oliveira, C I de; Ziebell, L F; Rosa, P R da S

    2005-01-01

    In this paper, we study the effects of the occurrence of radial transport of particles in a tokamak on the efficiency of the current drive by lower hybrid (LH) waves, in the presence of an internal transport barrier. The results are obtained by numerical solution of the Fokker-Planck equation which rules the evolution of the electron distribution function. We assume that the radial transport of particles can be due to magnetic or electrostatic fluctuations. In both cases the efficiency of the current drive is shown to increase with the increase of the fluctuations that originate the transport. The dependence of the current drive efficiency on the depth and position of the barrier is also investigated

  18. Measuring Zonal Transport Variability of the Antarctic Circumpolar Current Using GRACE Ocean Bottom Pressure

    Science.gov (United States)

    Makowski, J.; Chambers, D. P.; Bonin, J. A.

    2012-12-01

    Previous studies have suggested that ocean bottom pressure (OBP) can be used to measure the transport variability of the Antarctic Circumpolar Current (ACC). Using OBP data from the JPL ECCO model and the Gravity Recovery and Climate Experiment (GRACE), we examine the zonal transport variability of the ACC integrated between the major fronts between 2003-2010. The JPL ECCO data are used to determine average front positions for the time period studies, as well as where transport is mainly zonal. Statistical analysis will be conducted to determine the uncertainty of the GRACE observations using a simulated data set. We will also begin looking at low frequency changes and how coherent transport variability is from region to region of the ACC. Correlations with bottom pressure south of the ACC and the average basin transports will also be calculated to determine the probability of using bottom pressure south of the ACC as a means for describing the ACC dynamics and transport.

  19. The establishment of Atlantic Water transport as a topographically trapped slope current off Scotland

    Directory of Open Access Journals (Sweden)

    Qin Zhou

    2013-05-01

    Full Text Available Atlantic Water, with its origin in the western Atlantic, enters the Nordic Seas partly as a barotropic current following the continental slope. This water mass is carried across the Atlantic by the baroclinic North Atlantic Current (NAC. When the NAC meets the continental slope at the east side of the Atlantic, some of the transport is converted to barotropic transport over the slope before continuing northward. Here, we show that this baroclinic to barotropic conversion is in agreement with geostrophic theory. Historical observations show that the transport of the slope current increases significantly from the Rockall Channel (RC to the Faroe–Shetland Channel (FSC. Geostrophy predicts that with a northward decreasing buoyancy, baroclinic currents from the west will be transferred into northward topographically steered barotropic flow. We use hydrographic data from two sections crossing the continental slope, one located in the RC and another in the FSC, to estimate baroclinic and barotropic transport changes over the slope, within the framework of geostrophic dynamics. Our results indicate that ~1 Sv of the cross-slope baroclinic flow is mainly converted to northward barotropic transport above the 200–500m isobaths, which is consistent with observed transport changes between the RC and the FSC. Similar processes are also likely to occur further south, along the eastern Atlantic margin. This shows that AW within the slope current in the FSC is derived from both the eastern and the western Atlantic, in agreement with earlier studies of AW inflow to the Nordic Seas.

  20. Methods to reduce AC losses in HTS coated conductors with magnetic substrates

    Energy Technology Data Exchange (ETDEWEB)

    Tsukamoto, O. [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan)], E-mail: osami-t@ynu.ac.jp; Sekizawa, S.; Alamgir, A.K.M. [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan); Miyagi, D. [Okayama University, 1-1, Tsushima-Naka, 1-Chome, Okayama 700-8530 (Japan)

    2007-10-01

    HTS coated conductors (CCs) have high potentials as low-cost and long length conductors. However, a question remains as to what influence the magnetic property of the substrates has on the AC losses. In this paper, the influence of magnetic property of substrates on the AC losses in HTS CCs is studied. Based on the study methods to reduce the AC transport current losses and magnetization losses in CCs with magnetic substrates are investigated. It is shown that the losses can be reduced to the same level of those in CCs with non-magnetic substrates.

  1. Methods to reduce AC losses in HTS coated conductors with magnetic substrates

    International Nuclear Information System (INIS)

    Tsukamoto, O.; Sekizawa, S.; Alamgir, A.K.M.; Miyagi, D.

    2007-01-01

    HTS coated conductors (CCs) have high potentials as low-cost and long length conductors. However, a question remains as to what influence the magnetic property of the substrates has on the AC losses. In this paper, the influence of magnetic property of substrates on the AC losses in HTS CCs is studied. Based on the study methods to reduce the AC transport current losses and magnetization losses in CCs with magnetic substrates are investigated. It is shown that the losses can be reduced to the same level of those in CCs with non-magnetic substrates

  2. AC losses in horizontally parallel HTS tapes for possible wireless power transfer applications

    Science.gov (United States)

    Shen, Boyang; Geng, Jianzhao; Zhang, Xiuchang; Fu, Lin; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Gawith, James; Coombs, T. A.

    2017-12-01

    This paper presents the concept of using horizontally parallel HTS tapes with AC loss study, and the investigation on possible wireless power transfer (WPT) applications. An example of three parallel HTS tapes was proposed, whose AC loss study was carried out both from experiment using electrical method; and simulation using 2D H-formulation on the FEM platform of COMSOL Multiphysics. The electromagnetic induction around the three parallel tapes was monitored using COMSOL simulation. The electromagnetic induction and AC losses generated by a conventional three turn coil was simulated as well, and then compared to the case of three parallel tapes with the same AC transport current. The analysis demonstrates that HTS parallel tapes could be potentially used into wireless power transfer systems, which could have lower total AC losses than conventional HTS coils.

  3. Current structure and volume transport across 12 degrees N in the Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Murty, V.S.N.; Suryanarayana, A.; Rao, D.P.

    of India from April to September. Current structure in November is similar to that in September with a shift in the current bands. Transport in the upper 1000 m between the stations exhibits a reversal west of 83 degrees E from April to September and east...

  4. Transport and acceleration of the high-current ion beam in magneto-isolated gap

    International Nuclear Information System (INIS)

    Karas', V.I.; Kornilov, E.A.; Manuilenko, O.V.; Fedorovskaya, O.V.; Tarakanov, V.P.

    2015-01-01

    The possibility of transportation and acceleration of the high-current ion beam in the magneto-isolated gap has been demonstrated. Found the parameters of the system and beams (the magnetic field produced by the coils with opposing currents, the size of the system, and the parameters of the beams), under which the uniform acceleration of the high-current ion beam all along the gap length is realized. It is shown that the quality of the ion beam, during transport and acceleration, at the exit of the gap is acceptable for many technological applications.

  5. Particle transport analysis in lower hybrid current drive discharges of JT-60U

    International Nuclear Information System (INIS)

    Nagashima, K.; Ide, S.; Naito, O.

    1996-01-01

    Particle transport is modified in lower hybrid current drive discharges of JT-60U. The density profile becomes broad during the lower hybrid wave injection and the profile change depends on the injected wave spectrum. Particle transport coefficients (diffusion coefficient and profile peaking factor) were evaluated using gas-puff modulation experiments. The diffusion coefficient in the current drive discharges is about three times larger than in the ohmic discharges. The profile peaking factor decreases in the current drive discharges and the evaluated values are consistent with the measured density profiles. (author)

  6. Self-field ac losses in biaxially aligned Y endash Ba endash Cu endash O tape conductors

    International Nuclear Information System (INIS)

    Iijima, Y.; Hosaka, M.; Sadakata, N.; Saitoh, T.; Kohno, O.; Takeda, K.

    1997-01-01

    Self-field ac losses were measured by the conventional ac four-probe method in biaxially aligned Y endash Ba endash Cu endash O tapes using polycrystalline Hastelloy tapes with textured yttria-stabilized-zirconia buffer layers. The ac losses increased in proportion to the fourth power of transport current in the high J c sample, and agreed well with Norris close-quote equation for thin strip conductors. However, the low J c sample had rather higher losses than Norris close-quote prediction, suggesting excessive magnetic flux penetration caused by percolated current paths. The results confirmed Norris close-quote prediction of the low ac losses for thin strip conductors, and indicated the importance of removing percolated structures of current paths to avoid higher ac losses than the theoretical predictions based on uniform conductors. copyright 1997 American Institute of Physics

  7. Evaluation of a Modified High-Definition Electrode Montage for Transcranial Alternating Current Stimulation (tACS) of Pre-Central Areas

    DEFF Research Database (Denmark)

    Heise, Kirstin Friederike; Kortzorg, Nick; Saturnino, Guilherme Bicalho

    2016-01-01

    Objective: To evaluate a modified electrode montage with respect to its effect on tACS-dependent modulation of corticospinal excitability and discomfort caused by neurosensory side effects accompanying stimulation. Methods: In a double-blind cross-over design, the classical electrode montage for ....... Conclusions: In comparison to the classic montage, the M1 centre-ring montage enables a more focal stimulation of the target area and, at the same time, significantly reduces neurosensory side effects, essential for placebo-controlled study designs.......Objective: To evaluate a modified electrode montage with respect to its effect on tACS-dependent modulation of corticospinal excitability and discomfort caused by neurosensory side effects accompanying stimulation. Methods: In a double-blind cross-over design, the classical electrode montage...... for primary motor cortex (M1) stimulation (two patch electrodes over M1 and contralateral supraorbital area) was compared with an M1 centre-ring montage. Corticospinal excitability was evaluated before, during, immediately after and 15 minutes after tACS (10 min., 20 Hz vs. 30 s low-frequency transcranial...

  8. Design and initial tests of beam current monitoring systems for the APS transport lines

    International Nuclear Information System (INIS)

    Wang, Xucheng.

    1992-01-01

    The non-intercepting beam current monitoring systems suitable for a wide, range of beam parameters have been developed for the Advanced Photon Source (APS) low energy transport lines and high energy transport line. The positron or electron beam pulse in the transport lines wig have peak beam currents ranging from 8 mA to 29 A with pulse widths varying from 120 ps to 30 ns and pulse repetition rates from 2 Hz to 60 Hz. The peak beam current or total beam charge is measured with the fast or integrating current transformer, respectively, manufactured by Bergoz. In-house high speed beam signal processing electronics provide a DC level output proportional to the peak current or total charge for the digitizer input. The prototype systems were tested on the linacs which have beam pulse structures similar to that of the APS transport lines. This paper describes the design of beam signal processing electronics and grounding and shielding methods for current transformers. The results of the initial operations are presented. A short introduction on the preliminary design of current monitoring systems for the APS rings is also included

  9. Energy efficient direct current distribution in commercially used buildings with smart power link to the AC distribution grid; Energieeffiziente Gleichstromverteilung in kommerziell genutzten Gebaeuden mit intelligenter Kopplung zum Niederspannungsnetz

    Energy Technology Data Exchange (ETDEWEB)

    Weiss, Roland [Siemens AG, Erlangen (Germany); Boeke, Ulrich [Philips Group Innovation-Research, Eindhoven (Netherlands); Maurer, Wilhelm [Infineon Technologies AG, Neubiberg (Germany); Zeltner, Stefan [Fraunhofer-Inst. fuer Integrierte Systeme und Bauelementetechnologie (IISB), Erlangen (Germany)

    2012-07-01

    The joint undertaking ''Direct Current Components and Grid'' (DCC+G) takes on the strategic challenge to reduce energy consumption and thus the reduction of CO{sub 2} emission caused by commercially used buildings through research in the fields of Direct Current distribution at a voltage level of {+-} 380 V. The major energy consumers in commercially used buildings, ready for the ''net-zero-energy'' goal of the European Union, are heat pumps for heating, ventilation systems, air conditioning units, cooling units (HVAC), lighting systems and information technology. All these components and subsystems have in common, that the most efficient versions would benefit from a direct current supply. Additionally the local producers of electric energy like photovoltaic systems usually generate DC-current. A Direct Current distribution grid within buildings would avoid the repeating conversion from DC and AC an vice versa and therefore reduce conversion losses. Important components of a direct current distribution grid are central, smart, high efficient, bidirectional rectifiers replacing the large number of small, less efficient rectifiers used today. Such large central rectifiers units could additionally be used to actively improve the power quality of the smart local AC distribution grid. One major part of the described activities is to show energy savings of about 5 % of electrical energy with a 2-phase direct current distribution grid using a voltage level of {+-} 380 V. (orig.)

  10. Summary of the working group on high current transport and final focus lenses

    International Nuclear Information System (INIS)

    Garren, A.A.

    1978-09-01

    The group reviewed recent work, and then addressed itself to relating the current understanding of relevant beam transport effects to the four reference concepts. In addition there was discussion on plans for future experimental and theoretical work. Discussions covered the following topics: (1) Transverse instabilities on intense beams through periodic focusing systems, (2) evaluation and correction of chromatic aberrations in the final beam transport lines, (3) evaluation and correction of geometric aberrations due to quadrupole fringe fields, and (4) ion focusing by electrons

  11. Current transport modeling and experimental study of THz room temperature ballistic deflection transistors

    Energy Technology Data Exchange (ETDEWEB)

    Kaushal, Vikas; Margala, Martin [Department of Electrical and Computer Engineering, University of Massachusetts Lowell, MA, 01854 (United States); Yu Qiaoyan; Ampadu, Paul; Guarino, Gregg; Sobolewski, Roman, E-mail: vikas_kaushal@student.uml.ed [Department of Electrical and Computer Engineering, University of Rochester, NY, 14627 (United States)

    2009-11-15

    In this paper, two different theoretical models, Comsol Multiphysics{sup TM} (a Finite Element Analysis tool), and a field solver Atlas/Blaze from Silvaco, are compared qualitatively to study the effect of the deflector position, its size and electric field on the charge transport and its distribution along the channel, resulting in current outputs and leakages in ballistic deflection transistors (BDT). Silvaco simulations and experimental results were then used to study the lateral charge transport as a result of variation in electric field distribution, which controls the charge current along the channel in BDT. The electric field dependence of gain is also studied with experimental and theoretical results.

  12. Current transport modeling and experimental study of THz room temperature ballistic deflection transistors

    International Nuclear Information System (INIS)

    Kaushal, Vikas; Margala, Martin; Yu Qiaoyan; Ampadu, Paul; Guarino, Gregg; Sobolewski, Roman

    2009-01-01

    In this paper, two different theoretical models, Comsol Multiphysics TM (a Finite Element Analysis tool), and a field solver Atlas/Blaze from Silvaco, are compared qualitatively to study the effect of the deflector position, its size and electric field on the charge transport and its distribution along the channel, resulting in current outputs and leakages in ballistic deflection transistors (BDT). Silvaco simulations and experimental results were then used to study the lateral charge transport as a result of variation in electric field distribution, which controls the charge current along the channel in BDT. The electric field dependence of gain is also studied with experimental and theoretical results.

  13. Evidence for a role of transporter-mediated currents in the depletion of brain serotonin induced by serotonin transporter substrates.

    Science.gov (United States)

    Baumann, Michael H; Bulling, Simon; Benaderet, Tova S; Saha, Kusumika; Ayestas, Mario A; Partilla, John S; Ali, Syed F; Stockner, Thomas; Rothman, Richard B; Sandtner, Walter; Sitte, Harald H

    2014-05-01

    Serotonin (5-HT) transporter (SERT) substrates like fenfluramine and 3,4-methylenedioxymethamphetamine cause long-term depletion of brain 5-HT, while certain other substrates do not. The 5-HT deficits produced by SERT substrates are dependent upon transporter proteins, but the exact mechanisms responsible are unclear. Here, we compared the pharmacology of several SERT substrates: fenfluramine, d-fenfluramine, 1-(m-chlorophenyl)piperazine (mCPP) and 1-(m-trifluoromethylphenyl)piperainze (TFMPP), to establish relationships between acute drug mechanisms and the propensity for long-term 5-HT depletions. In vivo microdialysis was carried out in rat nucleus accumbens to examine acute 5-HT release and long-term depletion in the same subjects. In vitro assays were performed to measure efflux of [(3)H]5-HT in rat brain synaptosomes and transporter-mediated ionic currents in SERT-expressing Xenopus oocytes. When administered repeatedly to rats (6 mg/kg, i.p., four doses), all drugs produce large sustained elevations in extracellular 5-HT (>5-fold) with minimal effects on dopamine. Importantly, 2 weeks after dosing, only rats exposed to fenfluramine and d-fenfluramine display depletion of brain 5-HT. All test drugs evoke fluoxetine-sensitive efflux of [(3)H]5-HT from synaptosomes, but d-fenfluramine and its bioactive metabolite d-norfenfluramine induce significantly greater SERT-mediated currents than phenylpiperazines. Our data confirm that drug-induced 5-HT release probably does not mediate 5-HT depletion. However, the magnitude of transporter-mediated inward current may be a critical factor in the cascade of events leading to 5-HT deficits. This hypothesis warrants further study, especially given the growing popularity of designer drugs that target SERT.

  14. A Bingham-plastic model for fluid mud transport under waves and currents

    Science.gov (United States)

    Liu, Chun-rong; Wu, Bo; Huhe, Ao-de

    2014-04-01

    Simplified equations of fluid mud motion, which is described as Bingham-Plastic model under waves and currents, are presented by order analysis. The simplified equations are non-linear ordinary differential equations which are solved by hybrid numerical-analytical technique. As the computational cost is very low, the effects of wave current parameters and fluid mud properties on the transportation velocity of the fluid mud are studied systematically. It is found that the fluid mud can move toward one direction even if the shear stress acting on the fluid mud bed is much smaller than the fluid mud yield stress under the condition of wave and current coexistence. Experiments of the fluid mud motion under current with fluctuation water surface are carried out. The fluid mud transportation velocity predicted by the presented mathematical model can roughly match that measured in experiments.

  15. Confinement and transport properties during current ramps in the ASDEX Upgrade tokamak

    Science.gov (United States)

    Fable, E.; Angioni, C.; Hobirk, J.; Pereverzev, G.; Fietz, S.; Hein, T.; ASDEX Upgrade Team

    2011-04-01

    A detailed analysis of experimental data from the ASDEX Upgrade tokamak is carried out to shed light on the properties of confinement and transport in the current ramp-up and ramp-down phases of the plasma discharge. The experimental database is used to identify the relevant ranges of parameters explored during the ramp-up and the ramp-down. The energy confinement time observed in the two ramps displays interesting evolution, in many cases attaining different values at the same current level between ramp-up and ramp-down. The possible reasons for this behaviour are investigated. Interpretative transport simulations are used as a tool to clarify the interplay between different parameters, which are coupled in a non-linear way. In addition, a theory-based transport model is used to understand the behaviour of confinement as observed in the experiment, evidencing the role of both turbulent and neoclassical transport. Linear gyrokinetic calculations are performed to identify the relevant turbulence regime, showing that a broad range of frequencies, in the trapped electron modes (TEMs) and in the ion temperature gradient modes (ITGs) regimes, is explored during both the ramp-up and ramp-down. In the same framework, a quasi-linear model is applied to calculate the value of the local logarithmic density gradient and compare it with the experimental value. Finally, first non-linear simulations of heat transport during the current ramps are presented.

  16. Ratchet Transport of Chiral Particles Caused by the Transversal Asymmetry: Current Reversals and Particle Separation

    Science.gov (United States)

    Liu, Jian-li; Lu, Shi-cai; Ai, Bao-quan

    2018-06-01

    Due to the chirality of active particles, the transversal asymmetry can induce the the longitudinal directed transport. The transport of chiral active particles in a periodic channel is investigated in the presence of two types of the transversal asymmetry, the transverse force and the transverse rigid half-circle obstacles. For all cases, the counterclockwise and clockwise particles move to the opposite directions. For the case of the only transverse force, the chiral active particles can reverse their directions when increasing the transverse force. When the transverse rigid half-circle obstacles are introduced, the transport behavior of particles becomes more complex and multiple current reversals occur. The direction of the transport is determined by the competition between two types of the transversal asymmetry. For a given chirality, by suitably tailoring parameters, particles with different self-propulsion speed can move in different directions and can be separated.

  17. Current transport across the pentacene/CVD-grown graphene interface for diode applications

    International Nuclear Information System (INIS)

    Berke, K; Tongay, S; McCarthy, M A; Rinzler, A G; Appleton, B R; Hebard, A F

    2012-01-01

    We investigate the electronic transport properties across the pentacene/graphene interface. Current transport across the pentacene/graphene interface is found to be strikingly different from transport across pentacene/HOPG and pentacene/Cu interfaces. At low voltages, diodes using graphene as a bottom electrode display Poole-Frenkel emission, while diodes with HOPG and Cu electrodes are dominated by thermionic emission. At high voltages conduction is dominated by Poole-Frenkel emission for all three junctions. We propose that current across these interfaces can be accurately modeled by a combination of thermionic and Poole-Frenkel emission. Results presented not only suggest that graphene provides low resistive contacts to pentacene where a flat-laying orientation of pentacene and transparent metal electrodes are desired but also provides further understanding of the physics at the organic semiconductor/graphene interface. (paper)

  18. Current transport across the pentacene/CVD-grown graphene interface for diode applications.

    Science.gov (United States)

    Berke, K; Tongay, S; McCarthy, M A; Rinzler, A G; Appleton, B R; Hebard, A F

    2012-06-27

    We investigate the electronic transport properties across the pentacene/graphene interface. Current transport across the pentacene/graphene interface is found to be strikingly different from transport across pentacene/HOPG and pentacene/Cu interfaces. At low voltages, diodes using graphene as a bottom electrode display Poole–Frenkel emission, while diodes with HOPG and Cu electrodes are dominated by thermionic emission. At high voltages conduction is dominated by Poole–Frenkel emission for all three junctions. We propose that current across these interfaces can be accurately modeled by a combination of thermionic and Poole–Frenkel emission. Results presented not only suggest that graphene provides low resistive contacts to pentacene where a flat-laying orientation of pentacene and transparent metal electrodes are desired but also provides further understanding of the physics at the organic semiconductor/graphene interface.

  19. Nernst-Planck modeling of multicomponent ion transport in a Nafion membrane at high current density

    NARCIS (Netherlands)

    Moshtari Khah, S.; Oppers, N.A.W.; de Groot, M.T.; Keurentjes, J.T.F.; Schouten, J.C.; van der Schaaf, J.

    A mathematical model of multicomponent ion transport through a cation-exchange membrane is developed based on the Nernst–Planck equation. A correlation for the non-linear potential gradient is derived from current density relation with fluxes. The boundary conditions are determined with the Donnan

  20. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  1. Low Offset AC Correlator.

    Science.gov (United States)

    This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)

  2. Effect of parallel transport currents on the d-wave Josephson junction

    International Nuclear Information System (INIS)

    Rashedi, Gholamreza

    2009-01-01

    In this paper, the non-local mixing of coherent current states in d-wave superconducting banks is investigated. The superconducting banks are connected via a ballistic point contact. The banks have mis-orientation and phase difference. Furthermore, they are subjected to a tangential transport current along the ab plane of d-wave crystals and parallel to the interface between the superconductors. The effects of mis-orientation and external transport current on the current-phase relations and current distributions are the subjects of this paper. It is observed that, at values of phase difference close to 0, π and 2π, the current distribution may have a vortex-like form in the vicinity of the point contact. The current distribution of the above-mentioned junction between d-wave superconductors is totally different from the junction between s-wave superconductors. The interesting result which this study shows is that spontaneous and Josephson currents are observed for the case of φ = 0.

  3. Methods for stable recording of short-circuit current in a Na+-transporting epithelium.

    Science.gov (United States)

    Gondzik, Veronika; Awayda, Mouhamed S

    2011-07-01

    Epithelial Na(+) transport as measured by a variety of techniques, including the short-circuit current technique, has been described to exhibit a "rundown" phenomenon. This phenomenon manifests as time-dependent decrease of current and resistance and precludes the ability to carry out prolonged experiments aimed at examining the regulation of this transport. We developed methods for prolonged stable recordings of epithelial Na(+) transport using modifications of the short-circuit current technique and commercial Ussing-type chambers. We utilize the polarized MDCK cell line expressing the epithelial Na(+) channel (ENaC) to describe these methods. Briefly, existing commercial chambers were modified to allow continuous flow of Ringer solution and precise control of such flow. Chamber manifolds and associated plumbing were modified to allow precise temperature clamp preventing temperature oscillations. Recording electrodes were modified to eliminate the use of KCl and prevent membrane depolarization from KCl leakage. Solutions utilized standard bicarbonate-based buffers, but all gasses were prehydrated to clamp buffer osmolarity. We demonstrate that these modifications result in measurements of current and resistance that are stable for at least 2 h. We further demonstrate that drifts in osmolarity similar to those obtained before prior to our modifications can lead to a decrease of current and resistance similar to those attributed to rundown.

  4. Revealing origin of quasi-one dimensional current transport in defect rich two dimensional materials

    International Nuclear Information System (INIS)

    Lotz, Mikkel R.; Boll, Mads; Bøggild, Peter; Petersen, Dirch H.; Hansen, Ole; Kjær, Daniel

    2014-01-01

    The presence of defects in graphene have for a long time been recognized as a bottleneck for its utilization in electronic and mechanical devices. We recently showed that micro four-point probes may be used to evaluate if a graphene film is truly 2D or if defects in proximity of the probe will lead to a non-uniform current flow characteristic of lower dimensionality. In this work, simulations based on a finite element method together with a Monte Carlo approach are used to establish the transition from 2D to quasi-1D current transport, when applying a micro four-point probe to measure on 2D conductors with an increasing amount of line-shaped defects. Clear 2D and 1D signatures are observed at low and high defect densities, respectively, and current density plots reveal the presence of current channels or branches in defect configurations yielding 1D current transport. A strong correlation is found between the density filling factor and the simulation yield, the fraction of cases with 1D transport and the mean sheet conductance. The upper transition limit is shown to agree with the percolation threshold for sticks. Finally, the conductance of a square sample evaluated with macroscopic edge contacts is compared to the micro four-point probe conductance measurements and we find that the micro four-point probe tends to measure a slightly higher conductance in samples containing defects

  5. Electron heat transport in current carrying and currentless thermonuclear plasmas. Tokamaks and stellarators compared

    International Nuclear Information System (INIS)

    Peters, M.

    1996-01-01

    In the first experiment the plasma current in the RTP tokamak is varied. Here the underlying idea was to check whether at a low plasma current, transport in the tokamak resembles transport in stellarators more than at higher currents. Secondly, experiments have been done to study the relation of the diffusivity χ to the temperature and its gradient in both W7-AS and RTP. In this case the underlying idea was to find the explanation for the phenomenon observed in both tokamaks and stellarators that the quality of the confinement degrades when more heating is applied. A possible explanation is that the diffusivity increases with the temperature or its gradient. Whereas in standard tokamak and stellarator experiments the temperature and its gradient are strongly correlated, a special capability of the plasma heating system of W7-AS and RTP can force them to decouple. (orig.)

  6. Sensitivity analysis explains quasi-one-dimensional current transport in two-dimensional materials

    DEFF Research Database (Denmark)

    Boll, Mads; Lotz, Mikkel Rønne; Hansen, Ole

    2014-01-01

    We demonstrate that the quasi-one-dimensional (1D) current transport, experimentally observed in graphene as measured by a collinear four-point probe in two electrode configurations A and B, can be interpreted using the sensitivity functions of the two electrode configurations (configurations...... A and B represents different pairs of electrodes chosen for current sources and potential measurements). The measured sheet resistance in a four-point probe measurement is averaged over an area determined by the sensitivity function. For a two-dimensional conductor, the sensitivity functions for electrode...... configurations A and B are different. But when the current is forced to flow through a percolation network, e.g., graphene with high density of extended defects, the two sensitivity functions become identical. This is equivalent to a four-point measurement on a line resistor, hence quasi-1D transport...

  7. Electron heat transport in current carrying and currentless thermonuclear plasmas. Tokamaks and stellarators compared

    Energy Technology Data Exchange (ETDEWEB)

    Peters, M

    1996-01-16

    In the first experiment the plasma current in the RTP tokamak is varied. Here the underlying idea was to check whether at a low plasma current, transport in the tokamak resembles transport in stellarators more than at higher currents. Secondly, experiments have been done to study the relation of the diffusivity {chi} to the temperature and its gradient in both W7-AS and RTP. In this case the underlying idea was to find the explanation for the phenomenon observed in both tokamaks and stellarators that the quality of the confinement degrades when more heating is applied. A possible explanation is that the diffusivity increases with the temperature or its gradient. Whereas in standard tokamak and stellarator experiments the temperature and its gradient are strongly correlated, a special capability of the plasma heating system of W7-AS and RTP can force them to decouple. (orig.).

  8. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  9. Current correlations for the transport of interacting electrons through parallel quantum dots in a photon cavity

    Science.gov (United States)

    Gudmundsson, Vidar; Abdullah, Nzar Rauf; Sitek, Anna; Goan, Hsi-Sheng; Tang, Chi-Shung; Manolescu, Andrei

    2018-06-01

    We calculate the current correlations for the steady-state electron transport through multi-level parallel quantum dots embedded in a short quantum wire, that is placed in a non-perfect photon cavity. We account for the electron-electron Coulomb interaction, and the para- and diamagnetic electron-photon interactions with a stepwise scheme of configuration interactions and truncation of the many-body Fock spaces. In the spectral density of the temporal current-current correlations we identify all the transitions, radiative and non-radiative, active in the system in order to maintain the steady state. We observe strong signs of two types of Rabi oscillations.

  10. Coastal currents and mass transport of surface sediments over the shelf regions of Monterey Bay, California

    Science.gov (United States)

    Wolf, S.C.

    1970-01-01

    In Monterey Bay, the highest concentrations of medium and fine sands occur nearshore between ten and thirty fathoms. Silt and clay accumulate in greater depths. Contours of median diameter roughly parallel the isobaths. Fine-grained materials are supplied to the bay region from erosion of cliffs which partly surround Monterey Bay, from sediment laden river discharge, and from continual reworking of widespread Pleistocene and Recent sea floor sediments. These sediments in turn are picked up by coastal currents and distributed over the shelf regions by present day current regimes. Studies of bottom currents over the shelf regions and in Monterey Canyon have revealed patterns which vary with seasonal changes. Current patterns during August and September exhibit remarkable symmetry about the axis of Monterey Submarine Canyon. Central Shelf currents north and south of Monterey Canyon flowed northwest at an average rate of 0.2 knots and south at 0.3 knots respectively. On the North Shelf between January and March currents flowed east to southeast at 0.3-0.5 knots with mirror image patterns above the South Shelf during the same period. Irregular current flow in the canyon indicates a complex current structure with frequent shifts in counterclockwise and clockwise direction over very short periods of time. Bottom topography of the canyon complex often causes localization of canyon currents. One particular observation at a depth of 51 fathoms indicated up-canyon flow at a rate of 0.2 knots. Most of the observed currents are related to seasonal variations, upwelling, ocean swell patterns, and to changes in the California and Davidson currents. Changes in current regimes are reflected in the patterns of sediment distribution and transport. Sediment transport is chiefly parallel to the isobaths, particularly on the North and South Shelf regions. Complex dispersal patterns are observed near Monterey Canyon and Moss Landing Harbor jetties. Longshore currents move sediments

  11. Time Series of Transport and Currents on the Chukchi Shelf: 2010 - 2015

    Science.gov (United States)

    Stabeno, P. J.; Ladd, C. A.; Mordy, C. W.; Sullivan, M. E.

    2016-02-01

    Starting in 2010, NOAA/EcoFOCI in partnership with BOEM, has measured currents and water properties at multiple mooring sites on the Chukchi shelf and slope. Observations began at three sites (C1, C2, C3) off Icy Cape in 2010 and expanded in 2013 to include three sites around Barrow Canyon and two sites northeast of Hanna Shoal. In 2014, a mooring was deployed on the slope (1000 m) northeast of Hanna Shoal. A near-continuous velocity record exists at C2 from August 2010 - September 2015. These velocity data are combined with 40 satellite-tracked drifter trajectories (drogue depth 30 m) and hydrographic transects (2010 - 2015) to examine flow patterns and transport on the eastern Chukchi shelf. Six primary hydrographic transects extending from Pt. Hope (DBO3) to Barrow Canyon (DBO5) were occupied most years. Transport past Icy Cape accounts for 40% of the transport through Bering Strait. Maximum monthly-mean transport (>0.8 Sv) is in July with low interannual variability, while the lowest monthly transports are in December - April with high interannual variability. Currents are significantly correlated with alongshore winds. Satellite-tracked drifters deployed near Bering Strait show onshelf flow at Central Channel. Drifters deployed along the Icy Cape line are transported northeastward, converging to a narrow flow, and mainly exit the shelf through Barrow Canyon. The drifters then travel westward along the slope. In summer, drifters and hydrographic sections delineate the pathways of the nutrient-poor Alaska Coastal Current, and the nutrient-rich water to the west (Bering Sea water and Anadyr water). These data were collected mainly as part of three BOEM funded projects (CHAOZ, CHAOZ-Extension and ArcWEST).

  12. Transports and tidal current estimates in the Taiwan Strait from shipboard ADCP observations (1999-2001)

    Science.gov (United States)

    Wang, Y. H.; Jan, S.; Wang, D. P.

    2003-05-01

    Tidal and mean flows in the Taiwan Strait are obtained from analysis of 2.5 years (1999-2001) of shipboard ADCP data using a spatial least-squares technique. The average tidal current amplitude is 0.46 ms -1, the maximum amplitude is 0.80 ms -1 at the northeast and southeast entrances and the minimum amplitude is 0.20 ms -1 in the middle of the Strait. The tidal current ellipses derived from the shipboard ADCP data compare well with the predictions of a high-resolution regional tidal model. For the mean currents, the average velocity is about 0.40 ms -1. The mean transport through the Strait is northward (into the East China Sea) at 1.8 Sv. The transport is related to the along Strait wind by a simple regression, transport (Sv)=2.42+0.12×wind (ms -1). Using this empirical formula, the maximum seasonal transport is in summer, about 2.7 Sv, the minimum transport is in winter, at 0.9 Sv, and the mean transport is 1.8 Sv. For comparison, this result indicates that the seasonal amplitude is almost identical to the classical estimate by Wyrtki (Physical oceanography of the southeast Asian waters, scientific results of marine investigations of the South China Sea and Gulf of Thailand, 1959-1961. Naga Report 2, Scripps Institute of Oceanography, 195 pp.) based on the mass balance in the South China Sea, while the mean is close to the recent estimate by Isobe [Continental Shelf Research 19 (1999) 195] based on the mass balance in the East China Sea.

  13. Moment approach to neoclassical flows, currents and transport in auxiliary heated tokamaks

    International Nuclear Information System (INIS)

    Kim, Yil Bong.

    1988-02-01

    The moment approach is utilized to derive the full complement of neoclassical transport processes in auxiliary heated tokamaks. The effects of auxiliary heating [neutral beam injection (NBI) and ion cyclotron resonance heating (ICRH)] considered arise from the collisional interaction between the background plasma species and the fast-ion-tail species. From a known fast ion distribution function we evaluate the parallel (to the magnetic field) momentum and heat flow inputs to the background plasma. Then, through the momentum and heat flow balance equations, we can determine the induced parallel flows (and current) and radial transpot fluxes in ''equilibrium'' (on the time scale much longer than the collisional relaxation time, i.e., t >> 1ν/sub ii/). In addition to the fast-ion-induced current, the total neoclassical current includes the boostap current, which is driven by the pressure and temperature gradients, the Pfirsch-Schlueter current which is required for charge neutrality, and the neoclassical (including trapped particle effects) Spitzer current due to the parallel electric field. The radial transport fluxes also include off-diagonal compnents in the transport matrix which correspond to the Ware (neoclassical) pinch due to the inductive applied electric field an the fast-ion-induced radial fluxes, in addition to the usual pressure- and temperature-gradient-driven fluxes (particle diffusion and heat conduction). Once the tranport coefficient are completely determined, the radial fluxes and the heat fluxes can be substituted into the density and energy evolution equations to provide a complete description of ''equilibrium'' (δδt << ν/sub ii/) neoclassical transport processes in a plasma. 47 refs., 14 figs

  14. Direct observations of the Antarctic Slope Current transport at 113°E

    Science.gov (United States)

    Peña-Molino, B.; McCartney, M. S.; Rintoul, S. R.

    2016-10-01

    The Antarctic Slope Current (ASC), defined here as the region of westward flow along the continental slope off Antarctica, forms the southern limb of the subpolar gyres. It regulates the exchange of water across the shelf break and provides a path for interbasin westward transport. Despite its significance, the ASC remains largely unobserved around most of the Antarctic continent. Here we present direct velocity observations from a 17 month current meter moored array deployed across the continental slope between the 1000 and the 4200 m isobaths, in the southeastern Indian Ocean near 113°E. The observed time-mean flow consists of a surface-intensified jet associated with the Antarctic Slope Front (ASF) and a broader bottom-intensified westward flow that extends out to approximately the 4000 m isobath and is strongest along the upper slope. The time-mean transport of the ASC is -29.2 Sv. Fluctuations in the transport are large, typically exceeding the mean by a factor of 2. They are mainly due to changes in the northward extent of the current over the lower slope. However, seasonal changes in the wind also drive variations in the transport of the ASF and the flow in the upper slope. Both mean and variability are largely barotropic, thus invisible to traditional geostrophic methods.

  15. Coherency Between Volume Transport in the Antarctic Circumpolar Current and Southern Hemisphere Winds

    Science.gov (United States)

    Makowski, Jessica; Chambers, Don; Bonin, Jennifer

    2013-04-01

    Previous studies have suggested that ocean bottom pressure (OBP) can be used to measure the transport variability of the Antarctic Circumpolar Current (ACC). The OBP observations from the Gravity Recovery and Climate Experiment (GRACE) will be used to calculate transport along the 150°E longitude choke point, between Antarctica and Australia. We will examine whether zonally averaged wind stress, wind stress curl, or local zonal winds are more coherent with zonal mass transport variability. Preliminary studies suggest that seasonal variation in transport across 150°E is more correlated with winds along and north of the northern front of the ACC: the Sub Tropical front (STF). It also appears that interannual variations in transport along 150°E are related to wind variations south of the STF and centered south of the Sub Antarctic Front (SAF). We have observed a strong anti-correlation across the SAF, in the Indian Ocean, which suggests wind stress curl may also be responsible for transport variations. Preliminary results will be presented.

  16. The target-specific transporter and current status of diuretics as antihypertensive.

    Science.gov (United States)

    Ali, Syed Salman; Sharma, Pramod Kumar; Garg, Vipin Kumar; Singh, Avnesh Kumar; Mondal, Sambhu Charan

    2012-04-01

    The currently available diuretics increase the urinary excretion of sodium chloride by selective inhibition of specific sodium transporters in the loop of Henle and distal nephron. In recent years, the molecular cloning of the diuretic-sensitive sodium transporters at distal convoluted tubule has improved our understanding of the cellular mechanisms of action of each class of diuretics. Diuretics are tools of considerable therapeutic importance. First, they effectively reduce blood pressure. Loop and thiazide diuretics are secreted from the proximal tubule via the organic anion transporter-1 and exert their diuretic action by binding to the Na(+)-K(+)-2Cl(-) co-transporter type 2 in the thick ascending limb and the Na(+)-Cl(-) co-transporter in the distal convoluted tubule, respectively. Recent studies in animal models suggest that abundance of these ion transporters is affected by long-term diuretic administration. The WHO/ISH guidelines point out that diuretics enhance the efficacy of antihypertensive drugs and will most often be a component of combination therapy. © 2011 The Authors Fundamental and Clinical Pharmacology © 2011 Société Française de Pharmacologie et de Thérapeutique.

  17. Exchange-Dominated Pure Spin Current Transport in Alq3 Molecules.

    Science.gov (United States)

    Jiang, S W; Liu, S; Wang, P; Luan, Z Z; Tao, X D; Ding, H F; Wu, D

    2015-08-21

    We address the controversy over the spin transport mechanism in Alq3 utilizing spin pumping in the Y3Fe5O12/Alq3/Pd system. An unusual angular dependence of the inverse spin Hall effect is found. It, however, disappears when the microwave magnetic field is fully in the sample plane, excluding the presence of the Hanle effect. Together with the quantitative temperature-dependent measurements, these results provide compelling evidence that the pure spin current transport in Alq3 is dominated by the exchange-mediated mechanism.

  18. Understanding the Occurrence and Transport of Current-use Pesticides in the San Francisco Estuary Watershed

    Directory of Open Access Journals (Sweden)

    Kathryn Kuivila

    2008-10-01

    Full Text Available The occurrence and potential effects of current-use pesticides are of concern in the San Francisco Estuary watershed but our understanding of the spatial and temporal distribution of contamination is limited. This paper summarizes almost two decades of historical data and uses it to describe our current knowledge of the processes controlling the occurrence of current-use pesticides in the watershed. Monitoring studies analyze fewer than half of the pesticides applied in the watershed and most of our knowledge is about inputs of dissolved pesticides in the upper watershed. The four major seasonal patterns of riverine inputs of pesticides to the estuary can be identified by usage and transport mechanism. Dormant spray insecticides applied to orchards and herbicides applied to a variety of crops are transported by rainfall during the winter. Alfalfa pesticides are detected following rainfall and irrigation return flow in the spring, and rice pesticides are detected following release of rice field water in the summer. Irrigation return flows transport a variety of herbicides during the summer. In addition, pesticides applied on Delta islands can cause elevated pesticide concentrations in localized areas. Although not as well characterized, urban creeks appear to have their own patterns of insecticide concentrations causing toxicity throughout most of the year. Current-use pesticides have also been detected on suspended and bed sediments throughout the watershed but limited data make it difficult to determine occurrence patterns. Data gaps include the lack of analysis of many pesticides (or degradates, changing pesticide use, limited information on pesticide transport within the Delta, and an incomplete understanding of the transport and persistence of sediment-associated pesticides. Future monitoring programs should be designed to address these data gaps.

  19. ACS Postflash Characterization

    Science.gov (United States)

    Smith, Linda

    2011-10-01

    This program will evaluate the in-flight performance of the ACS/WFC post-flash lamp. A series of observations of Omega Cen will be taken using short and long exposures. The short exposures will be post-flashed using pre-determined exposure times to produce backgrounds from 0 to 125 e-. The data will be used to {1} make an empirical study of the effectiveness in preserving counts for faint stars on various post-flash backgrounds; {2} validate that our current mechanisms for formula-based and pixel-based corrections provide good fixes for whatever CTE remains; and {3} probe a fine enough range of backgrounds that users will be able to pick the level that optimizes their science, which will be a straightforward compromise between the noise added and the signal preserved.

  20. Nonequilibrium Distribution of the Microscopic Thermal Current in Steady Thermal Transport Systems

    KAUST Repository

    Yukawa, Satoshi; Ogushi, Fumiko; Shimada, Takashi; Ito, Nobuyasu

    2010-01-01

    Nonequilibrium distribution of the microscopic thermal current is investigated by direct molecular dynamics simulations. The microscopic thermal current in this study is defined by a flow of kinetic energy carried by a single particle. Asymptotic parallel and antiparallel tails of the nonequilibrium distribution to an average thermal current are identical to ones of equilibrium distribution with different temperatures. These temperatures characterizing the tails are dependent on a characteristic length in which a memory of dynamics is completely erased by several particle collisions. This property of the tails of nonequilibrium distribution is confirmed in other thermal transport systems. In addition, statistical properties of a particle trapped by a harmonic potential in a steady thermal conducting state are also studied. This particle feels a finite force parallel to the average thermal current as a consequence of the skewness of the distribution of the current. This force is interpreted as the microscopic origin of thermophoresis.

  1. Current drive by EC waves in the presence of magnetic islands and transport

    International Nuclear Information System (INIS)

    Rosa, P R da S; Ziebell, L F

    2008-01-01

    In this paper we address the problem of current drive by electron cyclotron (EC) waves in the presence of magnetic islands and transport. Our approach makes use of quasilinear theory by numerically solving the Fokker-Planck equation in cylindrical geometry. We take into account the actual geometry of the islands along the calculations as well as the changes in the plasma density profile due to the action of the radial particle transport. The particle transport is supposed to have a magnetic origin. The waves are assumed to be launched and propagated in the equatorial plane of the tokamak, as in the slab geometry. Our results show that the use of equilibrium profiles as usually done in the studies on neoclassical tearing mode control may not be a better choice and point to the need for taking into account the actual island geometry

  2. La fermentation acétonobutylique. Synthèse bibliographique et orientations actuelles Butanol-Acetone Fermentation. Bibliographie Synthesis and Current Trends

    Directory of Open Access Journals (Sweden)

    Marchal R.

    2006-11-01

    Full Text Available Cet article présente une synthèse des connaissances sur la fermentation acétonobutylique tant d'un point de vue microbiologique que technologique. Divers aspects du métabolisme et de la régulation du microorganisme mis en oeuvre sont abordés. Les performances de la fermentation sur ses substrats traditionnels (farine de maïs ou mélasses sont comparées avec celles qui ont été récemment obtenues à partir du topinambour à l'Institut Français du Pétrole, dans le cadre d'un nouveau développement de cette fermentation pour la production de carburants. This article gives a synthesis of what is known about butylacetone fermentation from both the microbiological and technological standpoints. Different aspects of the metabolism of the microorganism used and of how it is regulated are considered. The performances of fermentation on traditional substrates (cornmeal or molasses are compared with those recently obtained using Jerusalem artichokes at Institut Français du Pétrole as part of a new project on this fermentation for the purpose of producing substitute fuel.

  3. Calculation of AC losses in large HTS stacks and coils

    DEFF Research Database (Denmark)

    Zermeno, Victor; Abrahamsen, Asger Bech; Mijatovic, Nenad

    2012-01-01

    In this work, we present a homogenization method to model a stack of HTS tapes under AC applied transport current or magnetic field. The idea is to find an anisotropic bulk equivalent for the stack of tapes, where the internal alternating structures of insulating, metallic, superconducting...... allowing for overcritical current densities to be considered. The method presented here allowed for a computational speedup factor of up to 2 orders of magnitude when compared to full 2-D simulations taking into account the actual structure of the stacks without compromising accuracy....

  4. Effect of Fast Neutron Irradiation on Current Transport Properties of HTS Materials

    CERN Document Server

    Ballarino, A; Kruglov, V S; Latushkin, S T; Lubimov, A N; Ryazanov, A I; Shavkin, S V; Taylor, T M; Volkov, P V

    2004-01-01

    The effect of fast neutron irradiation with energy up to 35 MeV and integrated fluence of up to 5 x 10**15 cm-2 on the current transport properties of HTS materials Bi-2212 and Bi-2223 has been studied, both at liquid nitrogen and at room temperatures. The samples irradiated were selected after verification of the stability of their superconducting properties after temperature cycling in the range of 77 K - 293 K. It has been found that the irradiation by fast neutrons up to the above dose does not produce a significant degradation of critical current. The effect of room temperature annealing on the recovery of transport properties of the irradiated samples is also reported, as is a preliminary microstructure investigation of the effect of irradiation on the soldered contacts.

  5. Magneto-optical measurements on high-temperature superconductors influenced by AC-fields; Magnetooptische Untersuchungen an Hochtemperatursupraleitern unter Einfluss von Frequenzfeldern

    Energy Technology Data Exchange (ETDEWEB)

    Che' Rose, Simon

    2007-01-15

    In this work magneto-optical measurements on YBa{sub 2}Cu{sub 3}O{sub 7-x} and MgB{sub 2} thin films were done. For YBCO the influence of AC-pulses on the flux and current density of a thin film with transport current was investigated. For MgB{sub 2} the influence of AC-fields on the homogenous and dendritic flux penetration was researched. (orig.)

  6. Flame spread over inclined electrical wires with AC electric fields

    KAUST Repository

    Lim, Seung J.; Park, Sun H.; Park, Jeong; Fujita, Osamu; Keel, Sang I.; Chung, Suk-Ho

    2017-01-01

    Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field

  7. Sediment Resuspension and Transport During Bora in the Western Adriatic Coastal Current

    Science.gov (United States)

    Mullenbach, B. L.; Geyer, W. R.; Sherwood, C. R.

    2004-12-01

    The Western Adriatic Coastal Current (WACC) is an important agent for along-shelf transport of sediment and fresh water in the western Adriatic Sea. The WACC is driven by a combination of buoyancy forcing from the Po River (northern Adriatic) and wind forcing from northeasterly Bora winds. The large seasonal pulse of freshwater (during the winter) from the Po River influences WACC strength; however, preliminary results from current measurements and model runs indicate that the WACC responds quickly and strongly to Bora wind events, with a strengthening of the current moving southward. Along-margin sediment transport to the south is significantly increased as a result of Bora wind events, presumably because of enhanced wave resuspension and WACC velocity. Elevated sediment fluxes have been observed in both the upper water column (i.e., core of the WACC) and bottom boundary layer (BBL) during these events, which suggests that wind-driven currents may be coupled with the near-bottom transport. This study addresses the interaction of the WACC with the BBL and the impact of this interaction on sediment transport in the western Adriatic. Two benthic tripods were deployed from November 2002 to June 2003 on an across-shelf transect near the Chienti River (at 10 and 20-m water depth), in the region where WACC begins to intensify (200 km south of Po River). Continuous measurements of suspended sediment concentration and current velocity were recorded in the upper-water column and BBL to document sediment transport events. A time series of sediment fluxes and shear velocities (from currents only, u*c; from waves and currents, u*wc) were calculated from these data. Results show that suspended sediment concentrations near the seabed (few cmab) during Bora wind events are strongly correlated with u*wc, which supports a previous hypothesis that wave resuspension (rather than direct fluvial input) is responsible for much of the suspended sediment available for transport southward

  8. Fast-ion transport and neutral beam current drive in ASDEX upgrade

    DEFF Research Database (Denmark)

    Geiger, B.; Weiland, M.; Jacobsen, Asger Schou

    2015-01-01

    The neutral beam current drive efficiency has been investigated in the ASDEX Upgrade tokamak by replacing on-axis neutral beams with tangential off-axis beams. A clear modification of the radial fast-ion profiles is observed with a fast-ion D-alpha diagnostic that measures centrally peaked profiles...... during on-axis injection and outwards shifted profiles during off-axis injection. Due to this change of the fast-ion population, a clear modification of the plasma current profile is predicted but not observed by a motional Stark effect diagnostic. The fast-ion transport caused by MHD activity has been...

  9. Exponential temperature dependence of the critical transport current in Y-Ba-Cu-O thin films

    International Nuclear Information System (INIS)

    Yom, S.S.; Hahn, T.S.; Kim, Y.H.; Chu, H.; Choi, S.S.

    1989-01-01

    We have measured the critical currents in rf-sputtered YBa 2 Cu 3 O/sub 7-x/ thin films deposited on polycrystalline yttria-stabilized zirconia substrates as a function of temperature down to 10 K. The dependence of the granular films at low temperature indicated exponential behavior which is similar to the superconductor-normal metal-superconductor (S-N-S) type tunneling junctions. For the films with a grain size of approximately 1 μm, we observed two exponential decay constants, which suggest that Josephson junctions limiting the transport critical current are possible both at the grain boundaries and at twin boundaries

  10. Mesoscopic current transport in two-dimensional materials with grain boundaries: Four-point probe resistance and Hall effect

    DEFF Research Database (Denmark)

    Lotz, Mikkel Rønne; Boll, Mads; Østerberg, Frederik Westergaard

    2016-01-01

    -configurations depends on the dimensionality of the current transport (i.e., one- or two-dimensional). At low grain density or low grain boundary resistivity, two-dimensional transport is observed. In contrast, at moderate grain density and high grain resistivity, one-dimensional transport is seen. Ultimately...

  11. Modeling Solar Energetic Particle Transport near a Wavy Heliospheric Current Sheet

    Science.gov (United States)

    Battarbee, Markus; Dalla, Silvia; Marsh, Mike S.

    2018-02-01

    Understanding the transport of solar energetic particles (SEPs) from acceleration sites at the Sun into interplanetary space and to the Earth is an important question for forecasting space weather. The interplanetary magnetic field (IMF), with two distinct polarities and a complex structure, governs energetic particle transport and drifts. We analyze for the first time the effect of a wavy heliospheric current sheet (HCS) on the propagation of SEPs. We inject protons close to the Sun and propagate them by integrating fully 3D trajectories within the inner heliosphere in the presence of weak scattering. We model the HCS position using fits based on neutral lines of magnetic field source surface maps (SSMs). We map 1 au proton crossings, which show efficient transport in longitude via HCS, depending on the location of the injection region with respect to the HCS. For HCS tilt angles around 30°–40°, we find significant qualitative differences between A+ and A‑ configurations of the IMF, with stronger fluences along the HCS in the former case but with a distribution of particles across a wider range of longitudes and latitudes in the latter. We show how a wavy current sheet leads to longitudinally periodic enhancements in particle fluence. We show that for an A+ IMF configuration, a wavy HCS allows for more proton deceleration than a flat HCS. We find that A‑ IMF configurations result in larger average fluences than A+ IMF configurations, due to a radial drift component at the current sheet.

  12. Shear flow generation and transport barrier formation on rational surface current sheets in tokamaks

    International Nuclear Information System (INIS)

    Wang Xiaogang; Xiao Chijie; Wang Jiaqi

    2009-01-01

    Full text: A thin current sheet with a magnetic field component in the same direction can form the electrical field perpendicularly pointing to the sheet, therefore an ExB flow with a strong shear across the current sheet. An electrical potential well is also found on the rational surface of RFP as well as the neutral sheet of the magnetotail with the E-field pointing to the rational (neutral) surface. Theoretically, a current singularity is found to be formed on the rational surface in ideal MHD. It is then very likely that the sheet current on the rational surfaces will generate the electrical potential well in its vicinity so the electrical field pointing to the sheet. It results in an ExB flow with a strong shear in the immediate neighborhood of the rational surface. It may be the cause of the transport barrier often seen near the low (m, n) rational surfaces with MHD signals. (author)

  13. Thermal spin current generation and spin transport in Pt/magnetic-insulator/Py heterostructures

    Science.gov (United States)

    Chen, Ching-Tzu; Safranski, Christopher; Krivorotov, Ilya; Sun, Jonathan

    Magnetic insulators can transmit spin current via magnon propagation while blocking charge current. Furthermore, under Joule heating, magnon flow as a result of the spin Seeback effect can generate additional spin current. Incorporating magnetic insulators in a spin-orbit torque magnetoresistive memory device can potentially yield high switching efficiencies. Here we report the DC magneto-transport studies of these two effects in Pt/magnetic-insulator/Py heterostructures, using ferrimagnetic CoFexOy (CFO) and antiferromagnet NiO as the model magnetic insulators. We observe the presence and absence of the inverse spin-Hall signals from the thermal spin current in Pt/CFO/Py and Pt/NiO/Py structures. These results are consistent with our spin-torque FMR linewidths in comparison. We will also report investigations into the magnetic field-angle dependence of these observations.

  14. Study of the electric Held in HTS tape caused by perpendicular AC magnetic field

    International Nuclear Information System (INIS)

    Roiberg, V; Kopansky, F.

    2004-01-01

    Full Text: In a previous work we studied the influence of AC magnetic fields on voltage-currents (V-I) characteristics of high temperature superconducting (HTS) multi filament BSCC0-2223 tapes. It was found that AC magnetic fields perpendicular to the ab plane (the wide surface of the tape) cause a linear decrease of the critical current (IC) with amplitude of the AC magnetic field. The degradation of IC in .AC field was explained by the geometrical model according to which the transport current floe: is confined to the central zone of the tape where .AC field does not penetrate. For deeper understanding of the observed phenomena we carried out a study of the time dependence of the electric field during the cycle of AC field. At the same time we expanded the frequency range to low frequencies down to 1 Hz. The main results of the work are as following. 1. The time modulation of the electric field E in the HTS tape carrying transport DC current has the double frequency relating to AC magnetic field. 2. In field amplitudes less than 70 G the electric field modulation decreases with increasing frequency in opposite to its well-pronounced increase in higher AC field amplitudes. Alcove 70 G, the electric field increases with increasing the frequency of the external magnetic field. The wave forms of the electric field are different in both amplitudes ranges. 3. E-I curves of the tape in low amplitudes are frequency independent and coincide with E-l curves in AC field with intensity equal to the AC field amplitude. 4. In high AC field amplitudes, a strong dependence of the E-I curves on frequency is observed in the frequency range of 1-40 Hz and no dependence is observed in higher frequencies. Our results suggest that a combination of the geometrical model with flux creep concepts is necessary for a better understanding of the electric field behavior in our measurement conditions

  15. Leakage current transport mechanisms of La 0.67 Sr 0.33 MnO 3 ...

    Indian Academy of Sciences (India)

    limited current mechanism under forward bias while thermionic emission model under reverse bias. Analysis indicates that a modulating Schottky barrier exists at the LSMO/BTO interface, which dominates the leakage current transport properties ...

  16. Interannual Variations of Surface Currents and Transports in the Sicily Channel Derived From Coastal Altimetry

    Science.gov (United States)

    Jebri, Fatma; Zakardjian, Bruno; Birol, Florence; Bouffard, Jérôme; Jullion, Loïc.; Sammari, Cherif

    2017-11-01

    A 20 year coastal altimetry data set (X-TRACK) is used, for the first time, to gain insight into the long-term interannual variations of the surface circulation in the Sicily Channel. First, a spectral along with a time/space diagram analysis are applied to the monthly means. They reveal a regionally coherent current patterns from track to track with a marked interannual variability that is unequally shared between the Atlantic Tunisian Current and Atlantic Ionian Stream inflows in the Sicily Channel and the Bifurcation Tyrrhenian Current outflow northeast of Sicily. Second, an empirical altimetry-based transport-like technique is proposed to quantify volume budgets inside the closed boxes formed by the crossing of the altimetry tracks and coastlines over the study area. A set of hydrographic measurements is used to validate the method. The inferred altimetry transports give a well-balanced mean eastward Atlantic Waters baroclinic flow of 0.4 Sv and standard deviations of 0.2 Sv on a yearly basis throughout the Sicily Channel and toward the Ionian Sea, which is fairly coherent with those found in the literature. Furthermore, the analysis allows to quantify the intrusions of Atlantic Waters over the Tunisian Shelf (0.12 ± 0.1 Sv) and highlights two main modes of variability of the main surface waters path over the Sicily Channel through the Bifurcation Atlantic Tunisian Current and Atlantic Ionian Stream systems. Some physical mechanisms are finally discussed with regards to changes in the observed currents and transports.

  17. Poloidal spin up and electric-field generation related to displacement current and neoclassical transport

    International Nuclear Information System (INIS)

    Gervasini, G.; Lazzaro, E.; Minardi, E.

    1996-01-01

    In accordance with the conventional ordering of neoclassical theory, poloidal and toroidal accelerations with constant parallel flow can be driven by heat transport in the absence of external momentum input and with vanishing parallel viscous stress. In a transient phase in which the heat transport is the primary source of the time dependence, the torque generating the rotation is provided at third order in the adiabatic expansion by the surface-averaged (non ambipolar) displacement current, which in also responsible for charge build-up and for the radial electric field. The heat transport equation has been solved in a narrow layer interfaced with the intensely heated plasma core through heat flux continuity, assuming neoclassical multi collisional coefficients with self-consistent suppression mechanism of anomalous transport. Starting from low temperature in the edge layer, a strong temperature gradient, a mass poloidal rotation in the ion direction and a strongly negative sheared radial electric field can be generated, in agreement with the observations, and reach a stationary state after a displacement current-dominated triggering phase (intrinsically non-ambipolar) lasting few milliseconds. Momentum input becomes important on longer time scale and is responsible for the toroidal rotation, decoupled from temperature gradient and for a further development of the radial electric field. The results show the ability of edge transport processes to adapt flexibly to a high temperature imposed on the inner side of the edge layer and support the view that the edge processes are a integral part of a more fundamental global process involving possibly an internal bifurcation of state

  18. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  19. Circumpolar Deep Water transport and current structure at the Amundsen Sea shelf break

    Science.gov (United States)

    Assmann, Karen M.; Wåhlin, Anna K.; Heywood, Karen J.; Jenkins, Adrian; Kim, Tae Wan; Lee, Sang Hoon

    2017-04-01

    The West Antarctic Ice Sheet has been losing mass at an increasing rate over the past decades. Ocean heat transport to the ice-ocean interface has been identified as an important contributor to this mass loss and the role it plays in ice sheet stability makes it crucial to understand its drivers in order to make accurate future projections of global sea level. While processes closer to the ice-ocean interface modulate this heat transport, its ultimate source is located in the deep basin off the continental shelf as a core of relatively warm, salty water underlying a colder, fresher shallow surface layer. To reach the marine terminating glaciers and the base of floating ice shelves, this warm, salty water mass must cross the bathymetric obstacle of the shelf break. Glacial troughs that intersect the Amundsen shelf break and deepen southwards towards the ice shelf fronts have been shown to play an important role in transporting warm, salty Circumpolar Deep Water (CDW) towards the ice shelves. North of the shelf break, circulation in the Amundsen Sea occupies an intermediate regime between the eastward Antarctic Circumpolar Current that impinges on the shelf break in the Bellingshausen Sea and the westward southern limb of the Ross Gyre that follows the shelf break in the Ross Sea. Hydrographic and mooring observations and numerical model results at the mouth of the central shelf break trough leading to Pine Island and Thwaites Glaciers show a westward wind-driven shelf break current overlying an eastward undercurrent that turns onto the shelf in the trough. It is thought that the existence of the latter feature facilitates the on-shelf transport of CDW. A less clearly defined shelf break depression further west acts as the main pathway for CDW to Dotson and eastern Getz Ice shelves. Model results indicate that a similar eastward undercurrent exists here driving the on-shelf transport of CDW. Two moorings on the upper slope east of the trough entrance show a

  20. The off-shore Transport of China Coastal Current over Taiwan Bank in Winter

    Science.gov (United States)

    Liao, E.; Yan, X. H.; Oey, L. Y.; Jiang, Y.

    2016-12-01

    In winter, an off-shore flow of China Coastal Current can be inferred from satellite and in-situ data over the Taiwan Bank. The dynamics related to this off-shore flow have not been previously explained and are examined here using observations and model. Influenced by southward wind stress and opposing pressure gradient, currents over the Taiwan Bank can be classified into three regimes. The southward China Coastal Current flows pass the Taiwan Bank when the wind stress is stronger than a critical value which depends on the opposite pressure gradient force. The coastal current turns northward under a weak wind stress. Two opposite currents converge over the bank and a branch of the coastal current then turns into the northward warm current when these two forces are in balance. Analysis of the vorticity balance shows that the cross-isobath movement is related to a negative bottom stress curl over the Taiwan Bank. Both bottom Ekman transport and shear and curvature vorticity related to the weak bottom slope over the Taiwan Bank contribute to the bottom stress curl. Composite analyses using observations tend to support the model results.

  1. Current status of radiation transport tools for proliferation and terrorism prevention

    International Nuclear Information System (INIS)

    Sale, K.E.

    2004-01-01

    We present the current status and future plans for the set of calculational tools and data bases developed and maintained at LLNL. The calculational tools include the Monte Carlo codes TART and COG as well as the deterministic code ARDRA. In addition to these codes presently in use there is a major development effort for a new massively parallel transport code. An important part of the capability we're developing is a sophisticated user interface, based on a commercial 3-D modeling product, to improve the model development process. A major part of this user interface tool is being developed by Strela under the Nuclear Cities Initiative. Strela has developed a hub-and-spoke technology for code input interconversions (between COG, TART and MCNP) and will produce the plug-ins that extend the capabilities of the 3-D modeler for use as a radiation transport input generator. The major advantages of this approach are the built-in user interface for 3-D modeling and the ability to read a large variety of CAD-file formats. In addition to supporting our current radiation transport codes and developing new capabilities we are working on some nuclear data needs for homeland security. These projects are carried out and the Lawrence Berkeley National Laboratory 88' cyclotron and at the Institute for Nuclear Research of the Nation Academy of Science of Ukraine under and STCU contract. (author)

  2. Pulsed transport critical currents of Bi2212 tapes in pulsed magnetic fields

    Energy Technology Data Exchange (ETDEWEB)

    Rogacki, K [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, Wroclaw (Poland); Gilewski, A; Klamut, J [International Laboratory of High Magnetic Fields and Low Temperatures, Polish Academy of Sciences, Wroclaw (Poland); Newson, M; Jones, H [Clarendon Laboratory, University of Oxford, Oxford (United Kingdom); Glowacki, B A [IRC in Superconductivity and Department of Materials Science, University of Cambridge, Cambridge (United Kingdom)

    2002-07-01

    If high-T{sub C} superconductors are ever to be used in high-field applications, it is vital that the critical surfaces can be mapped under high-field conditions. However, the latest superconductors have high currents even at fields over 20 T, making accurate measurements very difficult due to the thermal and mechanical problems. In this paper, we compare measurements on BSCCO-2212 tape using a number of different methods, particularly an innovative pulsed transport current and pulsed field mode. We show how the analysis of the voltage signal from BSCCO-2212 tape in pulsed conditions may be used to extract the critical current in quasi-stationary conditions. The effect of a metallic substrate on the results is also briefly discussed. (author)

  3. Transport measurements in superconductors: critical current of granular high TC ceramic superconductor samples

    International Nuclear Information System (INIS)

    Passos, W.A.C.

    2016-01-01

    This work presents a method to obtain critical current of granular superconductors. We have carried out transport measurements (ρxT curves and VxI curves) in a YBa_2Cu_3O_7_-_δ sample to determine critical current density of it. Some specimens reveal a 'semiconductor-like' behavior (electrical resistivity decreases with increasing temperatures above critical temperature T_c of material) competing with superconductor behavior. Due to high granular fraction of the sample, these competition is clearly noted in ρxT curves. Measurements carried out from 0 to 8500 Oe of applied field show the same behavior, and the critical current density of the samples is shown. (author)

  4. Ion current prediction model considering columnar recombination in alpha radioactivity measurement using ionized air transportation

    International Nuclear Information System (INIS)

    Naito, Susumu; Hirata, Yosuke; Izumi, Mikio; Sano, Akira; Miyamoto, Yasuaki; Aoyama, Yoshio; Yamaguchi, Hiromi

    2007-01-01

    We present a reinforced ion current prediction model in alpha radioactivity measurement using ionized air transportation. Although our previous model explained the qualitative trend of the measured ion current values, the absolute values of the theoretical curves were about two times as large as the measured values. In order to accurately predict the measured values, we reinforced our model by considering columnar recombination and turbulent diffusion, which affects columnar recombination. Our new model explained the considerable ion loss in the early stage of ion diffusion and narrowed the gap between the theoretical and measured values. The model also predicted suppression of ion loss due to columnar recombination by spraying a high-speed air flow near a contaminated surface. This suppression was experimentally investigated and confirmed. In conclusion, we quantitatively clarified the theoretical relation between alpha radioactivity and ion current in laminar flow and turbulent pipe flow. (author)

  5. Nonlinear AC susceptibility, surface and bulk shielding

    Science.gov (United States)

    van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.

    1996-02-01

    We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.

  6. Modeling and control of the current density profile in Tokamaks and its relation to electron transport

    International Nuclear Information System (INIS)

    Zucca, C.

    2009-04-01

    The current density in tokamak plasmas strongly affects transport phenomena, therefore its understanding and control represent a crucial challenge for controlled thermonuclear fusion. Within the vast framework of tokamak studies, three topics have been tackled in the course of the present thesis: first, the modelling of the current density evolution in electron Internal Transport Barrier (eITB) discharges in the Tokamak à Configuration Variable (TCV); second, the study of current diffusion and inversion of electron transport properties observed during Swing Electron Cyclotron Current Drive (Swing ECCD) discharges in TCV; third, the analysis of the current density tailoring obtained by local ECCD driven by the improved EC system for sawtooth control and reverse shear scenarios in the International Thermonuclear Experimental Reactor (ITER). The work dedicated to the study of eITBs in TCV has been undertaken to identify which of the main parameters, directly related to the current density, played a relevant role in the confinement improvement created during these advanced scenarios. In this context, the current density has to be modeled, there being no measurement currently available on TCV. Since the Rebut-Lallia-Watkins (RLW) model has been validated on TCV ohmic heated plasmas, the corresponding scaling factor has often been used as a measure of improved confinement on TCV. The many interpretative simulations carried on different TCV discharges have shown that the thermal confinement improvement factor, H RLW , linearly increases with the absolute value of the minimum shear outside ρ > 0.3, ρ indicating a normalized radial coordinate. These investigations, performed with the transport code ASTRA, therefore confirmed a general observation, formulated through previous studies, that the formation of the transport barrier is correlated with the magnetic shear reversal. This was, indeed, found to be true in all cases studied, regardless of the different heating and

  7. FLUIDIC AC AMPLIFIERS.

    Science.gov (United States)

    Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems

  8. Electron and ion heat transport with lower hybrid current drive and neutral beam injection heating in ASDEX

    International Nuclear Information System (INIS)

    Soeldner, F.X.; Pereverzev, G.V.; Bartiromo, R.; Fahrbach, H.U.; Leuterer, F.; Murmann, H.D.; Staebler, A.; Steuer, K.H.

    1993-01-01

    Transport code calculations were made for experiments with the combined operation of lower hybrid current drive and heating and of neutral beam injection heating on ASDEX. Peaking or flattening of the electron temperature profile are mainly explained by modifications of the MHD induced electron heat transport. They originate from current profile changes due to lower hybrid and neutral beam current drive and to contributions from the bootstrap current. Ion heat transport cannot be described by one single model for all heating scenarios. The ion heat conductivity is reduced during lower hybrid heated phases with respect to Ohmic and neutral beam heating. (author). 13 refs, 5 figs

  9. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    International Nuclear Information System (INIS)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  10. Transportation safety aspects of ore and related material - inconsistencies in current exemption values

    International Nuclear Information System (INIS)

    Rawl, R.R.; Leggett, R.W.; Eckerman, K.F.; Cook, J.R.

    2004-01-01

    The IAEA's system for exemption of material from the transport regulations is based on the fundamental principle that exemption values should be commensurate with the risk posed by the material, as represented by effective dose and skin dose. Important departures from that principle as well as inconsistencies between exemption values for different radionuclides have resulted from special provisions for natural materials that depend on their intended use, and from exposure scenarios and other assumptions and rules used in the derivation of exemption values. This paper examines the sources and extent of inconsistencies in exemption values for transport, particularly as they relate to naturally occurring radionuclides, and suggests ways to achieve greater internal consistency in exemption values as well as greater consistency with the fundamental principle underlying the current system

  11. A chopper current-feedback instrumentation amplifier with a 1 mHz 1/f noise corner and an AC-coupled ripple reduction loop

    NARCIS (Netherlands)

    Wu, R.; Makinwa, K.A.A.; Huijsing, J.H.

    2009-01-01

    This paper presents a chopper instrumentation amplifier for interfacing precision thermistor bridges. For high CMRR and DC gain, the amplifier employs a three-stage current-feedback topology with nested-Miller compensation. By chopping both the input and intermediate stages of the amplifier, a 1 mHz

  12. AC power supply systems

    International Nuclear Information System (INIS)

    Law, H.

    1987-01-01

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  13. Current status of radiation transport tools for proliferation and terrorism prevention

    International Nuclear Information System (INIS)

    Sale, K.E.

    2004-01-01

    Full text: We will present the current status and future plans for the set of calculational tools and databases developed and maintained at LLNL. The calculational tools include the Monte Carlo codes TART 1) and COG 2) as well as the deterministic code ARDRA 3) . In addition to these codes we use currently there is a major development effort for a new massively parallel transport code. An important part of the capability we're developing is a sophisticated user interface, based on a commercial 3-D modeling product, to improve the model development process. A major part of this user interface tool is being developed by Strela 4) under the Nuclear Cities Initiative. Strela has developed a hub-and-spoke technology for code input interconversions (between COG, TART and MCNP) and will produce the plug-ins that extend the capabilities of the 3-D modeler for use as a radiation transport input generator. The major advantages of this approach are the built-in user interface for 3-D modeling and the ability to read a large variety of CAD-file formats. In addition to supporting our current radiation transport codes and developing new capabilities we are working on some nuclear data needs for homeland security. These projects are carried out and the Lawrence Berkeley National Laboratory 88' cyclotron and at the Institute for Nuclear Research of the Nation Academy of Science of Ukraine under and STCU contract. Reference: 1. http://www.llnl.gov/cullen1/mc/htm; 2. http://www-phys.llnl.gov/N_Div/COG/ETR/ETR_9306.html; 3. http://www.llnl.gov/CASC/asciturb/talks/PPT-HTML.131596/tsld030.htm; 4. http://strela.snz.ru/

  14. Sediment Transport Capacity of Turbidity Currents: from Microscale to Geological Scale.

    Science.gov (United States)

    Eggenhuisen, J. T.; Tilston, M.; Cartigny, M.; Pohl, F.; de Leeuw, J.; van der Grind, G. J.

    2016-12-01

    A big question in sedimentology concerns the magnitude of fluxes of sediment particles, solute matter and dissolved gasses from shallow marine waters to deep basins by turbidity current flow. Here we establish sediment transport capacity of turbidity current flow on three levels. The most elementary level is set by the maximum amount of sediment that can be contained at the base of turbidity currents without causing complete extinction of boundary layer turbulence. The second level concerns the capacity in a vertical column within turbidity currents. The third level involves the amount of sediment that can be transported in turbidite systems on geological timescales. The capacity parameter Γ compares turbulent forces near the boundary of a turbulent suspension to gravity and buoyancy forces acting on suspended particles. The condition of Γ>1 coincides with complete suppression of coherent boundary layer turbulence in Direct Numerical Simulations of sediment-laden turbulent flow. Γ=1 coincides with the upper limit of observed suspended particle concentrations in flume and field measurements. Γ is grainsize independent, yet capacity of the full vertical structure of turbidity currents becomes grainsize dependent. This is due to the appearance of grainsize dependent vertical motions within turbulence as a primary control on the shape of the vertical concentration profile. We illustrate this dependence with experiments and theory and conclude that capacity depends on the competence of prevailing turbulence to suspend particle sizes. The concepts of capacity and competence are thus tangled. Finally, the capacity of turbidity current flow structure is coupled to geological constraints on recurrence times, channel and lobe life cycles, and allogenic forcing on system activity to arrive at system scale sediment transport capacity. We demonstrate a simple model that uses the fundamental process insight described above to estimate geological sediment budgets from

  15. Enhanced transport currents in Cu-sheathed MgB{sub 2} wires

    Energy Technology Data Exchange (ETDEWEB)

    Eisterer, M; Weber, H W [Atomic Institute of the Austrian Universities, Vienna (Austria); Glowacki, B A [Department of Materials Science and Metallurgy, University of Cambridge, Cambridge (United Kingdom); Pacific Northwest National Laboratory, Richland, WA (United States); Greenwood, L R [Pacific Northwest National Laboratory, Richland, WA (United States); Majoros, M [Interdisciplinary Research Centre in Superconductivity, University of Cambridge, Cambridge (United Kingdom)

    2002-07-01

    Copper-sheathed MgB{sub 2} wires, prepared by an in-situ process, were exposed to neutron radiation in order to introduce defects into the superconductor. The high level of disorder (4.6x10{sup -2} dpa) leads to a decrease of the transition temperature by more than 4 K, but to an increase of the slope of the irreversibility line, thus resulting in higher irreversibility fields at low temperatures. The transport currents are significantly enhanced at 4.2 K for fields above 2 T. (author)

  16. Current transport in graphene/AlGaN/GaN vertical heterostructures probed at nanoscale.

    Science.gov (United States)

    Fisichella, Gabriele; Greco, Giuseppe; Roccaforte, Fabrizio; Giannazzo, Filippo

    2014-08-07

    Vertical heterostructures combining two or more graphene (Gr) layers separated by ultra-thin insulating or semiconductor barriers represent very promising systems for next generation electronics devices, due to the combination of high speed operation with wide-range current modulation by a gate bias. They are based on the specific mechanisms of current transport between two-dimensional-electron-gases (2DEGs) in close proximity. In this context, vertical devices formed by Gr and semiconductor heterostructures hosting an "ordinary" 2DEG can be also very interesting. In this work, we investigated the vertical current transport in Gr/Al(0.25)Ga(0.75)N/GaN heterostructures, where Gr is separated from a high density 2DEG by a ∼ 24 nm thick AlGaN barrier layer. The current transport from Gr to the buried 2DEG was characterized at nanoscale using conductive atomic force microscopy (CAFM) and scanning capacitance microscopy (SCM). From these analyses, performed both on Gr/AlGaN/GaN and on AlGaN/GaN reference samples using AFM tips with different metal coatings, the Gr/AlGaN Schottky barrier height ΦB and its lateral uniformity were evaluated, as well as the variation of the carrier densities of graphene (ngr) and AlGaN/GaN 2DEG (ns) as a function of the applied bias. A low Schottky barrier (∼ 0.40 eV) with excellent spatial uniformity was found at the Gr/AlGaN interface, i.e., lower compared to the measured values for metal/AlGaN contacts, which range from ∼ 0.6 to ∼ 1.1 eV depending on the metal workfunction. The electrical behavior of the Gr/AlGaN contact has been explained by Gr interaction with AlGaN donor-like surface states located in close proximity, which are also responsible of high n-type Gr doping (∼ 1.3 × 10(13) cm(-2)). An effective modulation of ns by the Gr Schottky contact was demonstrated by capacitance analysis under reverse bias. From this basic understanding of transport properties in Gr/AlGaN/GaN heterostructures, novel vertical field effect

  17. Diffuser Design for Marine Outfalls in Areas with Strong Currents, High waves and Sediment Transport

    DEFF Research Database (Denmark)

    Larsen, Torben

    1995-01-01

    The design of marine outfalls is often based on environmental criteria for a minimum initial dilution. Accordingly advanced diffuser arrangement are designed to fulfil these requirements. A large number of examples of malfunction and blocking in sea outfalls have occurred around the world...... as a result of this uncompromising consent to environmental demands. Two examples of unconventional design are given in this paper. Both cases involved risk of blockage of the diffuser section because of wave and current induced sediment transport The paper also discusses how acceptable far field dilution...

  18. Atmospheric transport and deposition of pesticides: An assessment of current knowledge

    DEFF Research Database (Denmark)

    Pul, W.A.J. van; Bidleman, T.F.; Brorström-Lunden, E.

    1999-01-01

    The current knowledge on atmospheric transport and deposition of pesticides is reviewed and discussed by a working group of experts during the Workshop on Fate of pesticides in the atmosphere; implications for risk assessment, held in Driebergen, the Netherlands, 22-24 April, 1998. In general...... in the exchange processes at the interface between air and soil/water/vegetation. In all process descriptions the uncertainty in the physicochemical properties play an important role. Particularly those in the vapour pressure, Henry's law constant and its temperature dependency. More accurate data...

  19. Measurement of AC losses in superconducting tapes by reproduction of thermometric dynamic response

    Energy Technology Data Exchange (ETDEWEB)

    Ligneris, Benoit des; Aubin, Marcel; Cave, Julian

    2003-04-15

    We have developed a dynamic response thermometric method for the measurement of AC losses in high T{sub c} superconductors. This method is based on the comparison of a temperature response caused by a known dissipation in the sample with that produced by the AC losses. By passing a DC current and measuring the DC voltage and corresponding temperature response the sample can be used as its own power dissipation reference. The advantages of this method are the short measurement duration time and the possibility to vary many experimental conditions: for example, AC and DC transport currents and AC, DC and rotating applied magnetic fields. In this article we present the basic method using variable short pulses of constant DC current for calibration and similarly of constant amplitude AC current to create the losses. The losses are obtained by numerical modelling and comparison of the thermometric dynamic response in the two above conditions. Finally, we present some experimental results for a Bi2223 superconducting tape at 50 Hz and 77 K.

  20. Computation of quantum electron transport with local current conservation using quantum trajectories

    International Nuclear Information System (INIS)

    Alarcón, A; Oriols, X

    2009-01-01

    A recent proposal for modeling time-dependent quantum electron transport with Coulomb and exchange correlations using quantum (Bohm) trajectories (Oriols 2007 Phys. Rev. Lett. 98 066803) is extended towards the computation of the total (particle plus displacement) current in mesoscopic devices. In particular, two different methods for the practical computation of the total current are compared. The first method computes the particle and the displacement currents from the rate of Bohm particles crossing a particular surface and the time-dependent variations of the electric field there. The second method uses the Ramo–Shockley theorem to compute the total current on that surface from the knowledge of the Bohm particle dynamics in a 3D volume and the time-dependent variations of the electric field on the boundaries of that volume. From a computational point of view, it is shown that both methods achieve local current conservation, but the second is preferred because it is free from 'spurious' peaks. A numerical example, a Bohm trajectory crossing a double-barrier tunneling structure, is presented, supporting the conclusions

  1. Influence of microscopic inhomogeneity on macroscopic transport current of Ag/Bi2223 tapes

    International Nuclear Information System (INIS)

    Ogawa, Kazuhiro; Osamura, Kozo

    2004-01-01

    In Ag/Bi2223 tapes, inhomogeneities such as spatially distributed weak links or non-superconducting oxides are inevitably introduced because of the complicated manufacturing process and thermodynamic instability. In order to clarify the effect of the difference in such microscopic inhomogeneites on the macroscopic current transport properties, we carried out a numerical analysis. By changing volume fraction (V f ) of the Bi2223 phase and the shape of local distribution of critical current at each weak link, it is revealed that I-V characteristics are largely affected by the breadth of local distributions with different dependence on V f of Bi2223 and calculated results can be analyzed by Weibull distribution function with some parameters including the information of two-dimensional distribution

  2. Simulation of transport critical current of Bi2223/Ag tape with ferromagnetic shielding

    Energy Technology Data Exchange (ETDEWEB)

    Gu, C. [Applied Superconductivity Research Center, Department of Physics, Tsinghua University, Beijing 100084 (China)], E-mail: guchen@tsinghua.edu.cn; Alamgir, A.K.M. [Faculty of Engineering, Yokohama National University, 75-9 Tokiwadai, Hodogaya, ku, Yokohama (Japan); Qu, T.M. [Applied Superconductivity Research Center, Department of Physics, Tsinghua University, Beijing 100084 (China); Key Laboratory for Advanced Materials Processing Technology, Ministry of Education (China); Han, Z. [Applied Superconductivity Research Center, Department of Physics, Tsinghua University, Beijing 100084 (China)

    2008-09-15

    Ferromagnetic shielding (FS) was coated onto the surface of the Bi2223/Ag multi-filamentary tape. Transport critical current of the Bi2223/Ag multi-filamentary tape with a FS was systematically studied by numerical simulation. In the help of a finite element analysis (FEA) tool, we are able to understand how the FS alters the flux inside the superconductor region and thus increases and decreases the critical current density locally. The results show the open FS function both positively and negatively to the performance of the tape. An optimization process was proposed, aiming to reach a tradeoff between I{sub c} increasing and less usage of the ferromagnetic material. Three important shielding parameters, shielding width, shielding thickness, and shielding material were taken into account.

  3. Simulation of transport critical current of Bi2223/Ag tape with ferromagnetic shielding

    International Nuclear Information System (INIS)

    Gu, C.; Alamgir, A.K.M.; Qu, T.M.; Han, Z.

    2008-01-01

    Ferromagnetic shielding (FS) was coated onto the surface of the Bi2223/Ag multi-filamentary tape. Transport critical current of the Bi2223/Ag multi-filamentary tape with a FS was systematically studied by numerical simulation. In the help of a finite element analysis (FEA) tool, we are able to understand how the FS alters the flux inside the superconductor region and thus increases and decreases the critical current density locally. The results show the open FS function both positively and negatively to the performance of the tape. An optimization process was proposed, aiming to reach a tradeoff between I c increasing and less usage of the ferromagnetic material. Three important shielding parameters, shielding width, shielding thickness, and shielding material were taken into account

  4. Transport properties of triarylamine based dendrimers studied by space charge limited current transients

    Science.gov (United States)

    Szymanski, Marek Z.; Kulszewicz-Bajer, Irena; Faure-Vincent, Jérôme; Djurado, David

    2012-08-01

    We have studied hole transport in triarylamine based dendrimer using space-charge-limited current transient technique. A mobility of 8 × 10-6 cm2/(V s) and a characteristic detrapping time of about 100 ms have been obtained. We found that quasi-ohmic contact is formed with gold. The obtained mobility differs from the apparent one given by the analysis of stationary current-voltage characteristics because of a limited contact efficiency. The comparison between transients obtained from fresh and aged samples reveals no change in mobility with aging. The deterioration of electrical properties is exclusively caused by trap formation and accumulation of ionic conducting impurities. Finally, repeated transient measurements have been applied to analyze the dynamics of charge trapping process.

  5. Observations of Near-Surface Current Shear Help Describe Oceanic Oil and Plastic Transport

    Science.gov (United States)

    Laxague, Nathan J. M.; Ö-zgökmen, Tamay M.; Haus, Brian K.; Novelli, Guillaume; Shcherbina, Andrey; Sutherland, Peter; Guigand, Cédric M.; Lund, Björn; Mehta, Sanchit; Alday, Matias; Molemaker, Jeroen

    2018-01-01

    Plastics and spilled oil pose a critical threat to marine life and human health. As a result of wind forcing and wave motions, theoretical and laboratory studies predict very strong velocity variation with depth over the upper few centimeters of the water column, an observational blind spot in the real ocean. Here we present the first-ever ocean measurements of the current vector profile defined to within 1 cm of the free surface. In our illustrative example, the current magnitude averaged over the upper 1 cm of the ocean is shown to be nearly four times the average over the upper 10 m, even for mild forcing. Our findings indicate that this shear will rapidly separate pieces of marine debris which vary in size or buoyancy, making consideration of these dynamics essential to an improved understanding of the pathways along which marine plastics and oil are transported.

  6. EC + LH current drive efficiency in the presence of an internal transport barrier

    International Nuclear Information System (INIS)

    Rosa, P.R. da S; Ziebell, L.F.

    2002-01-01

    In this paper we study the effects of the presence of an internal transport barrier (ITB) on the current drive efficiency and power deposition profiles in the case of electron cyclotron waves interacting with an extended tail generated by lower hybrid (LH) waves. We study the subject by numerically solving the Fokker-Planck equation, with temperature and density profiles corrected along the time evolution at each collision time, based on the actual time-evolving electron distribution function. The results obtained show that the LH and electron cyclotron (EC) power absorption profiles and the current driven by the combined action of both types of waves are weakly dependent on the depth of the ITB, slightly more dependent on the level of magnetic turbulence and much more dependent on the level of EC wave power. (author)

  7. A study of the variability in the Benguela Current volume transport

    Science.gov (United States)

    Majumder, Sudip; Schmid, Claudia

    2018-04-01

    The Benguela Current forms the eastern limb of the subtropical gyre in the South Atlantic and transports a blend of relatively fresh and cool Atlantic water and relatively warm and salty Indian Ocean water northwestward. Therefore, it plays an important role not only for the local freshwater and heat budgets but for the overall meridional heat and freshwater transport in the South Atlantic. Historically, the Benguela Current region is relatively data sparse, especially with respect to long-term velocity observations. A new three-dimensional data set of the horizontal velocity in the upper 2000 m that covers the years 1993 to 2015 is used to analyze the variability in the Benguela Current. This data set was derived using observations from Argo floats, satellite sea surface height, and wind fields. Since Argo floats do not cover regions shallower than 1000 m, the data set has gaps inshore. The main features of the horizontal circulation observed in this data set are in good agreement with those from earlier studies based on limited observations. Therefore, it can be used for a more detailed study of the flow pattern as well as the variability in the circulation in this region. It is found that the mean meridional transport in the upper 800 m between the continental shelf of Africa and 3° E, decreases from 23 ± 3 Sv (1 Sv = 106 m3 s-1) at 31° S to 11 ± 3 Sv at 28° S. In terms of variability, the 23-year long time series at 30 and 35° S reveals phases with large energy densities at periods of 3 to 7 months, which can be attributed to the occurrence of Agulhas rings in this region. The prevalence of Agulhas rings is also behind the fact that the energy density at 35° S at the annual period is smaller than at 30° S because the former latitude is closer to Agulhas Retroflection and therefore more likely to be impacted by the Agulhas rings. In agreement with this, the energy density associated with mesoscale variability at 30° S is weaker than at 35° S. With

  8. Stabilization of the dissipation-free current transport in inhomogeneous MgB2 thin films

    International Nuclear Information System (INIS)

    Treiber, S.; Stahl, C.; Schütz, G.; Soltan, S.; Albrecht, J.

    2014-01-01

    Highlights: • We investigate transport properties of inhomogeneous MgB 2 films. • An inhomogeneous microstructure stabilizes supercurrents. • Vortex pinning forces and energies have been analyzed experimentally. • In inhomogeneous films the increase of the pinning energy is responsible for stable supercurrents. - Abstract: In type-II superconductors at T = 0 the critical current density is determined by the pinning of flux lines. Considering an arbitrarily shaped energy landscape the pinning force at each pinning site is given by the derivative of the flux line energy with respect to the considered direction. At finite temperatures, in addition, thermal activation can lead to a depinning of flux lines. The governing property in this case is the depth of the corresponding pinning potential, i.e. the pinning energy. We show a detailed analysis of both pinning forces and pinning energies of MgB 2 films with inhomogeneous microstructure. We show that a pronounced increase of the pinning energy is responsible for the significantly enhanced stability of the dissipation-free current transport in thin inhomogeneous MgB 2 films. This is found even if the corresponding pinning forces are small

  9. Impurities in a non-axisymmetric plasma: Transport and effect on bootstrap current

    Energy Technology Data Exchange (ETDEWEB)

    Mollén, A., E-mail: albertm@chalmers.se [Department of Applied Physics, Chalmers University of Technology, Göteborg (Sweden); Max-Planck-Institut für Plasmaphysik, 17491 Greifswald (Germany); Landreman, M. [Institute for Research in Electronics and Applied Physics, University of Maryland, College Park, Maryland 20742 (United States); Smith, H. M.; Helander, P. [Max-Planck-Institut für Plasmaphysik, 17491 Greifswald (Germany); Braun, S. [Max-Planck-Institut für Plasmaphysik, 17491 Greifswald (Germany); German Aerospace Center, Institute of Engineering Thermodynamics, Pfaffenwaldring 38-40, D-70569 Stuttgart (Germany)

    2015-11-15

    Impurities cause radiation losses and plasma dilution, and in stellarator plasmas the neoclassical ambipolar radial electric field is often unfavorable for avoiding strong impurity peaking. In this work we use a new continuum drift-kinetic solver, the SFINCS code (the Stellarator Fokker-Planck Iterative Neoclassical Conservative Solver) [M. Landreman et al., Phys. Plasmas 21, 042503 (2014)] which employs the full linearized Fokker-Planck-Landau operator, to calculate neoclassical impurity transport coefficients for a Wendelstein 7-X (W7-X) magnetic configuration. We compare SFINCS calculations with theoretical asymptotes in the high collisionality limit. We observe and explain a 1/ν-scaling of the inter-species radial transport coefficient at low collisionality, arising due to the field term in the inter-species collision operator, and which is not found with simplified collision models even when momentum correction is applied. However, this type of scaling disappears if a radial electric field is present. We also use SFINCS to analyze how the impurity content affects the neoclassical impurity dynamics and the bootstrap current. We show that a change in plasma effective charge Z{sub eff} of order unity can affect the bootstrap current enough to cause a deviation in the divertor strike point locations.

  10. SNS AC Power Distribution and Reliability of AC Power Supply

    CERN Document Server

    Holik, Paul S

    2005-01-01

    The SNS Project has 45MW of installed power. A design description under the Construction Design and Maintenance (CDM) with regard to regulations (OSHA, NFPA, NEC), reliability issues and maintenance of the AC power distribution system are herewith presented. The SNS Project has 45MW of installed power. The Accelerator Systems are Front End (FE)and LINAC KLYSTRON Building (LK), Central Helium Liquefier (CHL), High Energy Beam Transport (HEBT), Accumulator Ring and Ring to Target Beam Transport (RTBT) Support Buildings have 30MW installed power. FELK has 16MW installed, majority of which is klystron and magnet power supply system. CHL, supporting the super conducting portion of the accelerator has 7MW installed power and the RING Systems (HEBT, RING and RTBT) have also 7MW installed power.*

  11. Simulation studies of current transport in metal-insulator-semiconductor Schottky barrier diodes

    International Nuclear Information System (INIS)

    Chand, Subhash; Bala, Saroj

    2007-01-01

    The current-voltage characteristics of Schottky diodes with an interfacial insulator layer are analysed by numerical simulation. The current-voltage data of the metal-insulator-semiconductor Schottky diode are simulated using thermionic emission diffusion (TED) equation taking into account an interfacial layer parameter. The calculated current-voltage data are fitted into ideal TED equation to see the apparent effect of interfacial layer parameters on current transport. Results obtained from the simulation studies shows that with mere presence of an interfacial layer at the metal-semiconductor interface the Schottky contact behave as an ideal diode of apparently high barrier height (BH), but with same ideality factor and series resistance as considered for a pure Schottky contact without an interfacial layer. This apparent BH decreases linearly with decreasing temperature. The effects giving rise to high ideality factor in metal-insulator-semiconductor diode are analysed. Reasons for observed temperature dependence of ideality factor in experimentally fabricated metal-insulator-semiconductor diodes are analysed and possible mechanisms are discussed

  12. The DC electrical conductivity calculation purely from the dissipative component of the AC conductivity III. statistical ensemble inherent to state with DC current

    International Nuclear Information System (INIS)

    Milinski, N.; Milinski, E.

    2002-01-01

    Amorphous conductors such as liquid metals and alloys are subject to dc conductivity σ calculation here. Principal aim is to explore the impact on σ of the constitutive equation α * = 1, formulated and developed in the preceding papers. The nearly free electrons (NFE) model has been applied. Alkali metals are assumed to fit this model well, and sodium the best. Consequently, the results on these metals have been assumed reliable and relevant for conclusions making. The conclusion we made is: instead of the Fermi radius k f proper for the statistical ensemble in state of thermodynamics equilibrium, a new k ' f number is needed to be introduced into the linear response formula when calculating σ and α * . This k ' f is the length of the corresponding axis of ellipsoid proper for describing the statistical ensemble in the state with dc current. In the traditional interpretation of the linear response formula (Kubo formula) this conversion has been overlooked. Parameters of the mentioned ellipsoids are determined in this paper for a number of liquid metals of valency numbers 1,2,3,4, in addition to a selection of some binary and ternary conducting alloys. It is up to experimental measurements to decide how real this concept of restructuring the statistical ensemble is. (Authors)

  13. AcMNPV

    African Journals Online (AJOL)

    USER

    2010-08-16

    Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...

  14. AC BREAKDOWN IN GASES

    Science.gov (United States)

    electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.

  15. THERMIONIC AC GENERATION

    Science.gov (United States)

    is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)

  16. Neutron transport assembly calculation with non-zero net current boundary condition

    International Nuclear Information System (INIS)

    Jo, Chang Keun

    1993-02-01

    Fuel assembly calculation for the homogenized group constants is one of the most important parts in the reactor core analysis. The homogenized group constants of one a quarter assembly are usually generated for the nodal calculation of the reactor core. In the current nodal calculation, one or a quarter of the fuel assembly corresponds to a unit node. The homogenized group constant calculation for a fuel assembly proceeds through cell spectrum calculations, group condensation and cell homogenization calculations, two dimensional fuel assembly calculation, and then depletion calculations of fuel rods. To obtain the assembly wise homogenized group constants, the two dimensional transport calculation is usually performed. Most codes for the assembly wise homogenized group constants employ a zero net current boundary condition. CASMO-3 is such a code that is in wide use. The zero net current boundary condition is plausible and valid in an infinite reactor composed of the same kind of assemblies. However, the reactor is finite and the core is constructed by different kinds of assemblies. Hence, the assumption of the zero net current boundary condition is not valid in the actual reactor. The objective of this study is to develop a homogenization methodology that can treat any actual boundary condition, i.e. non-zero net current boundary condition. In order to treat the non-zero net current boundary condition, we modify CASMO-3. For the two-dimensional treatment in CASMO-3, a multigroup integral transport routine based on the method of transmission probability is used. The code performs assembly calculation with zero net current boundary condition. CASMO-3 is modified to consider the inhomogeneous source at the assembly boundary surface due to the non-zero net current. The modified version of CASMO-3 is called CASMO-3M. CASMO-3M is applied to several benchmark problems. In order to obtain the inhomogeneous source, the global calculation is performed. The local calculation

  17. Modelling of sediment transport and morphological evolution under the combined action of waves and currents

    Science.gov (United States)

    Franz, Guilherme; Delpey, Matthias T.; Brito, David; Pinto, Lígia; Leitão, Paulo; Neves, Ramiro

    2017-09-01

    Coastal defence structures are often constructed to prevent beach erosion. However, poorly designed structures may cause serious erosion problems in the downdrift direction. Morphological models are useful tools to predict such impacts and assess the efficiency of defence structures for different scenarios. Nevertheless, morphological modelling is still a topic under intense research effort. The processes simulated by a morphological model depend on model complexity. For instance, undertow currents are neglected in coastal area models (2DH), which is a limitation for simulating the evolution of beach profiles for long periods. Model limitations are generally overcome by predefining invariant equilibrium profiles that are allowed to shift offshore or onshore. A more flexible approach is described in this paper, which can be generalised to 3-D models. The present work is based on the coupling of the MOHID modelling system and the SWAN wave model. The impacts of different designs of detached breakwaters and groynes were simulated in a schematic beach configuration following a 2DH approach. The results of bathymetry evolution are in agreement with the patterns found in the literature for several existing structures. The model was also tested in a 3-D test case to simulate the formation of sandbars by undertow currents. The findings of this work confirmed the applicability of the MOHID modelling system to study sediment transport and morphological changes in coastal zones under the combined action of waves and currents. The same modelling methodology was applied to a coastal zone (Costa da Caparica) located at the mouth of a mesotidal estuary (Tagus Estuary, Portugal) to evaluate the hydrodynamics and sediment transport both in calm water conditions and during events of highly energetic waves. The MOHID code is available in the GitHub repository.

  18. Transportation

    Science.gov (United States)

    2007-01-01

    Faculty ii INDUSTRY TRAVEL Domestic Assistant Deputy Under Secretary of Defense (Transportation Policy), Washington, DC Department of...developed between the railroad and trucking industries. Railroads: Today’s seven Class I freight railroad systems move 42% of the nation’s intercity ...has been successfully employed in London to reduce congestion and observed by this industry study during its travels . It is currently being

  19. Imaging the Spatial Distribution of Transport Currents and the Phenomenon of Nanoscale Phase Separation Phenomenon in CMR Materials

    National Research Council Canada - National Science Library

    Banerjee, Satyajit

    2007-01-01

    ... by transport currents sent through materials. Based on the above objective it was planned to apply this technique to investigate fundamental issues like magnetic phase separation in colossal magneto resistive materials as well as to investigate...

  20. Ion transport and loss in the earth's quiet ring current. I - Data and standard model

    Science.gov (United States)

    Sheldon, R. B.; Hamilton, D. C.

    1993-01-01

    A study of the transport and loss of ions in the earth's quiet time ring current, in which the standard radial diffusion model developed for the high-energy radiation belt particles is compared with the measurements of the lower-energy ring current ions, is presented. The data set provides ionic composition information in an energy range that includes the bulk of the ring current energy density, 1-300 keV/e. Protons are found to dominate the quiet time energy density at all altitudes, peaking near L of about 4 at 60 keV/cu cm, with much smaller contributions from O(+) (1-10 percent), He(+) (1-5 percent), and He(2+) (less than 1 percent). A minimization procedure is used to fit the amplitudes of the standard electric radial diffusion coefficient, yielding 5.8 x 10 exp -11 R(E-squared)/s. Fluctuation ionospheric electric fields are suggested as the source of the additional diffusion detected.

  1. A superconducting quadrupole array for transport of multiple high current beams

    International Nuclear Information System (INIS)

    Faltens, A.; Shuman, D.

    1999-01-01

    We present a conceptual design of a superconducting quadrupole magnet array for the side-by-side transport of multiple high current particle beams in induction linear accelerators. The magnetic design uses a modified cosine 20 current distribution inside a square cell boundary. Each interior magnet's neighbors serve as the return flux paths and the poles are placed as close as possible to each other to facilitate this. No iron is present in the basic 2-D magnetic design; it will work at any current level without correction windings. Special 1/8th quadrupoles are used along the transverse periphery of the array to contain and channel flux back into the array, making every channel look as part of an infinite array. This design provides a fixed dimension array boundary equal to the quadrupole radius that can be used for arrays of any number of quadrupole channels, at any field level. More importantly, the design provides magnetic field separation between the array and the induction cores which may be surrounding it. Flux linkage between these two components can seriously affect the operation of both of them

  2. cAMP Stimulates Transepithelial Short-Circuit Current and Fluid Transport Across Porcine Ciliary Epithelium.

    Science.gov (United States)

    Cheng, Angela King-Wah; Civan, Mortimer M; To, Chi-Ho; Do, Chi-Wai

    2016-12-01

    To investigate the effects of cAMP on transepithelial electrical parameters and fluid transport across porcine ciliary epithelium. Transepithelial electrical parameters were determined by mounting freshly isolated porcine ciliary epithelium in a modified Ussing chamber. Similarly, fluid movement across intact ciliary body was measured with a custom-made fluid flow chamber. Addition of 1, 10, and 100 μM 8-Br-cAMP (cAMP) to the aqueous side (nonpigmented ciliary epithelium, NPE) induced a sustained increase in short-circuit current (Isc). Addition of niflumic acid (NFA) to the aqueous surface effectively blocked the cAMP-induced Isc stimulation. The administration of cAMP to the stromal side (pigmented ciliary epithelium, PE) triggered a significant stimulation of Isc only at 100 μM. No additive effect was observed with bilateral application of cAMP. Likewise, forskolin caused a significant stimulation of Isc when applied to the aqueous side. Concomitantly, cAMP and forskolin increased fluid transport across porcine ciliary epithelium, and this stimulation was effectively inhibited by aqueous NFA. Depleting Cl- in the bathing solution abolished the baseline Isc and inhibited the subsequent stimulation by cAMP. Pretreatment with protein kinase A (PKA) blockers (H89/KT5720) significantly inhibited the cAMP- and forskolin-induced Isc responses. Our results suggest that cAMP triggers a sustained stimulation of Cl- and fluid transport across porcine ciliary epithelium; Cl- channels in the NPE cells are potentially a cellular site for this PKA-sensitive cAMP-mediated response.

  3. An improved FEM model for computing transport AC loss in coils made of RABiTS YBCO coated conductors for electric machines

    DEFF Research Database (Denmark)

    Ainslie, Mark D; Rodriguez Zermeno, Victor Manuel; Hong, Zhiyong

    2011-01-01

    and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC...

  4. Current & Heat Transport in Graphene Nanoribbons: Role of Non-Equilibrium Phonons

    Science.gov (United States)

    Pennington, Gary; Finkenstadt, Daniel

    2010-03-01

    The conducting channel of a graphitic nanoscale device is expected to experience a larger degree of thermal isolation when compared to traditional inversion channels of electronic devices. This leads to enhanced non-equilibrium phonon populations which are likely to adversely affect the mobility of graphene-based nanoribbons due to enhanced phonon scattering. Recent reports indicating the importance of carrier scattering with substrate surface polar optical phonons in carbon nanotubes^1 and graphene^2,3 show that this mechanism may allow enhanced heat removal from the nanoribbon channel. To investigate the effects of hot phonon populations on current and heat conduction, we solve the graphene nanoribbon multiband Boltzmann transport equation. Monte Carlo transport techniques are used since phonon populations may be tracked and updated temporally.^4 The electronic structure is solved using the NRL Tight-Binding method,^5 where carriers are scattered by confined acoustic, optical, edge and substrate polar optical phonons. [1] S. V. Rotkin et al., Nano Lett. 9, 1850 (2009). [2] J. H. Chen, C. Jang, S. Xiao, M. Ishigami and M. S. Fuhrer, Nature Nanotech. 3, 206 (2008). [3] V. Perebeinos and P. Avouris, arXiv:0910.4665v1 [cond-mat.mes-hall] (2009). [4] P. Lugli et al., Appl. Phys. Lett. 50, 1251 (1987). [5] D. Finkenstadt, G. Pennington & M.J. Mehl, Phys. Rev. B 76, 121405(R) (2007).

  5. Review of current results in computational studies of hydrocarbon phase and transport properties in nanoporous structures

    Science.gov (United States)

    Stroev, N.; Myasnikov, A.

    2017-12-01

    This article provides a general overview of the main simulation results on the behavior of gas/liquids under confinement conditions, namely hydrocarbons in shale formations, and current understanding of such phenomena. In addition to the key effects, which different research groups obtained and which have to be taken into account during the creation of reservoir simulation software, a list of methods is briefly covered. Comprehensive understanding of both fluid phase equilibrium and transport properties in nanoscale structures is of great importance for many scientific and technical disciplines, especially for petroleum engineering considering the hydrocarbon behavior in complex shale formations, the development of which increases with time. Recent estimations show that a significant amount of resources are trapped inside organic matter and clays, which has extremely low permeability and yet great economic potential. The issue is not only of practical importance, as the existing conventional approaches by definition are unable to capture complicated physics phenomena for effective results, but it is also of fundamental value. The research of the processes connected with such deposits is necessary for both evaluations of petroleum reservoir deposits and hydrodynamic simulators. That is why the review is divided into two major parts—equilibrium states of hydrocarbons and their transport properties in highly confined conditions.

  6. Nonequilibrium spin transport in integrable spin chains: Persistent currents and emergence of magnetic domains

    Science.gov (United States)

    De Luca, Andrea; Collura, Mario; De Nardis, Jacopo

    2017-07-01

    We construct exact steady states of unitary nonequilibrium time evolution in the gapless XXZ spin-1/2 chain where integrability preserves ballistic spin transport at long times. We characterize the quasilocal conserved quantities responsible for this feature and introduce a computationally effective way to evaluate their expectation values on generic matrix product initial states. We employ this approach to reproduce the long-time limit of local observables in all quantum quenches which explicitly break particle-hole or time-reversal symmetry. We focus on a class of initial states supporting persistent spin currents and our predictions remarkably agree with numerical simulations at long times. Furthermore, we propose a protocol for this model where interactions, even when antiferromagnetic, are responsible for the unbounded growth of a macroscopic magnetic domain.

  7. Transport currents along c-axis and (a,b) planes in YBCO single domain materials. Critical current densities and normal-superconducting transitions

    International Nuclear Information System (INIS)

    Porcar, L.; Bourgault, D.; Chaud, X.; Noudem, J.G.; Tournier, R.; Tixador, P.

    1998-01-01

    High transport currents along the (a,b) planes and along the c-axis have been measured in pulsed current of different pseudo-frequencies. Self field losses and transport current of 8000 A (20000 A cm -2 ) have been measured in Y 1 Ba 2 Cu 3 O 7-δ bars textured by the melting zone technique. Critical currents as high as 500 A (90000 A cm -2 ) along the (a,b) planes or 3000 A (7500 A cm -2 ) along the c-axis have been measured. For both orientations, the transition from the normal state to the superconducting state has been observed. Electric field of 1000 V m -1 and study of the superconducting state recovery are reported. (orig.)

  8. 'Anomalous electron transport' with 'Giant Current Density' at room temperature observed with nanogranular materials

    International Nuclear Information System (INIS)

    Koops, Hans W.P.

    2013-01-01

    Focused electron beam induced deposition is a novel bottom up nano-structurization technology. An electron beam of high power density is used to generate nano- structures with dimensions > 20 nm, but being composed from amorphous or nanogranular materials with crystals of 2 to 5 nm diameter embedded in a Fullerene matrix. Those compounds are generated in general by secondary or low energy electrons in layers of inorganic, organic, organometallic compounds absorbed to the sample. Those are converted into nanogranular materials by the electron beam following chemical and physical laws, as given by 'Mother Nature'. Metals and amorphous mixtures of chemical compounds from metals are normal resistors, which can carry a current density J 2 . Nanogranular composites like Au/C or Pt/C with metal nanocrystals embedded in a Fullerene matrix have hopping conduction with 0-dimensional Eigen-value characteristics and show 'anomalous electron transport' and can carry 'Giant Current Densities' with values from > 1 MA/cm 2 to 0.1 GA/cm 2 without destruction of the materials. However the area connecting the nanogranular material with a metal with a 3-dimensional electron gas needs to be designed, that the flowing current is reduced to the current density values which the 3-D metal can support without segregation. The basis for a theoretical explanation of the phenomenon can be geometry quantization for Coulomb blockade, of electron surface orbitals around the nanocrystals, hopping conduction, and the limitation of the density of states for phonons in geometry confined non percolated granular materials with strong difference in mass and orientation. Several applications in electronics, signal generators, light sources, detectors, and solar energy harvesting are suggested. (author)

  9. Crossover properties of a one-dimensional reaction-diffusion process with a transport current

    International Nuclear Information System (INIS)

    Fortin, Jean-Yves

    2014-01-01

    1D non-equilibrium models of particles subjected to a coagulation-diffusion process are important in understanding non-equilibrium dynamics, and fluctuation-dissipation relations. We consider in this paper transport properties in finite and semi-infinite one-dimensional chains. A set of particles freely hop between nearest-neighbor sites, with the additional condition that, when two particles meet, they merge instantaneously into one particle. A localized source of particle-current is imposed at the origin as well as a non-symmetric hopping rate between the left and right directions (particle drift). This model was previously studied with exact results for the particle density by Hinrichsen et al [1] in the long-time limit. We are interested here in the crossover process between a scaling regime and long-time behavior, starting with a chain filled with particles. As in the previous reference [1], we employ the empty-interval-particle method, where the probability of finding an empty interval between two given sites is considered. However a different method is developed here to treat the boundary conditions by imposing the continuity and differentiability of the interval probability, which allows for a closed and unique solution, especially for any given initial particle configuration. In the finite size case, we find a crossover between the scaling regime and two different exponential decays for the particle density as a function of the input current. Precise asymptotic expressions for the particle density and coagulation rate are given. (paper)

  10. Genome-Wide Identification and Expression Profiling of ATP-Binding Cassette (ABC) Transporter Gene Family in Pineapple (Ananas comosus (L.) Merr.) Reveal the Role of AcABCG38 in Pollen Development.

    Science.gov (United States)

    Chen, Piaojuan; Li, Yi; Zhao, Lihua; Hou, Zhimin; Yan, Maokai; Hu, Bingyan; Liu, Yanhui; Azam, Syed Muhammad; Zhang, Ziyan; Rahman, Zia Ur; Liu, Liping; Qin, Yuan

    2017-01-01

    Pineapple ( Ananas comosus L .) cultivation commonly relies on asexual reproduction which is easily impeded by many factors in agriculture production. Sexual reproduction might be a novel approach to improve the pineapple planting. However, genes controlling pineapple sexual reproduction are still remain elusive. In different organisms a conserved superfamily proteins known as ATP binding cassette (ABC) participate in various biological processes. Whereas, till today the ABC gene family has not been identified in pineapple. Here 100 ABC genes were identified in the pineapple genome and grouped into eight subfamilies (5 ABCAs , 20 ABCB s, 16 ABCCs , 2 ABCDs , one ABCEs , 5 ABCFs , 42 ABCGs and 9 ABCIs ). Gene expression profiling revealed the dynamic expression pattern of ABC gene family in various tissues and different developmental stages. AcABCA5, AcABCB6, AcABCC4 , AcABCC7 , AcABCC9 , AcABCG26 , AcABCG38 and AcABCG42 exhibited preferential expression in ovule and stamen. Over-expression of AcABCG38 in the Arabidopsis double mutant abcg1-2abcg16-2 partially restored its pollen abortion defects, indicating that AcABCG38 plays important roles in pollen development. Our study on ABC gene family in pineapple provides useful information for developing sexual pineapple plantation which could be utilized to improve pineapple agricultural production.

  11. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...

  12. Hypoxic augmentation of Ca2+ channel currents requires a functional electron transport chain.

    Science.gov (United States)

    Brown, Stephen T; Scragg, Jason L; Boyle, John P; Hudasek, Kristin; Peers, Chris; Fearon, Ian M

    2005-06-10

    The incidence of Alzheimer disease is increased following ischemic episodes, and we previously demonstrated that following chronic hypoxia (CH), amyloid beta (Abeta) peptide-mediated increases in voltage-gated L-type Ca(2+) channel activity contribute to the Ca(2+) dyshomeostasis seen in Alzheimer disease. Because in certain cell types mitochondria are responsible for detecting altered O(2) levels we examined the role of mitochondrial oxidant production in the regulation of recombinant Ca(2+) channel alpha(1C) subunits during CH and exposure to Abeta-(1-40). In wild-type (rho(+)) HEK 293 cells expressing recombinant L-type alpha(1C) subunits, Ca(2+) currents were enhanced by prolonged (24 h) exposure to either CH (6% O(2)) or Abeta-(1-40) (50 nm). By contrast the response to CH was absent in rho(0) cells in which the mitochondrial electron transport chain (ETC) was depleted following long term treatment with ethidium bromide or in rho(+) cells cultured in the presence of 1 microm rotenone. CH was mimicked in rho(0) cells by the exogenous production of O2(-.). by xanthine/xanthine oxidase. Furthermore Abeta-(1-40) enhanced currents in rho(0) cells to a degree similar to that seen in cells with an intact ETC. The antioxidants ascorbate (200 microm) and Trolox (500 microm) ablated the effect of CH in rho(+) cells but were without effect on Abeta-(1-40)-mediated augmentation of Ca(2+) current in rho(0) cells. Thus oxidant production in the mitochondrial ETC is a critical factor, acting upstream of amyloid beta peptide production in the up-regulation of Ca(2+) channels in response to CH.

  13. Vertical Transport of Momentum by the Inertial-Gravity Internal Waves in a Baroclinic Current

    Directory of Open Access Journals (Sweden)

    A. A. Slepyshev

    2017-08-01

    Full Text Available When the internal waves break, they are one of the sources of small-scale turbulence. Small-scale turbulence causes the vertical exchange in the ocean. However, internal waves with regard to the Earth rotation in the presence of vertically inhomogeneous two-dimensional current are able to contribute to the vertical transport. Free inertial-gravity internal waves in a baroclinic current in a boundless basin of a constant depth are considered in the Bussinesq approximation. Boundary value problem of linear approximation for the vertical velocity amplitude of internal waves has complex coefficients when current velocity component, which is transversal to the wave propagation direction, depends on the vertical coordinate (taking into account the rotation of the Earth. Eigenfunction and wave frequency are complex, and it is shown that a weak wave damping takes place. Dispersive relation and wave damping decrement are calculated in the linear approximation. At a fixed wave number damping decrement of the second mode is larger (in the absolute value than the one of the first mode. The equation for vertical velocity amplitude for real profiles of the Brunt – Vaisala frequency and current velocity are numerically solved according to implicit Adams scheme of the third order of accuracy. The dispersive curves of the first two modes do not reach inertial frequency in the low-frequency area due to the effect of critical layers in which wave frequency of the Doppler shift is equal to the inertial one. Termination of the second mode dispersive curves takes place at higher frequency than the one of the first mode. In the second order of the wave amplitude the Stokes drift speed is determined. It is shown that the Stokes drift speed, which is transversal to the wave propagation direction, differs from zero if the transversal component of current velocity depends on the vertical coordinate. In this case, the Stokes drift speed in the second mode is lower than

  14. Creation, transport and detection of imprinted magnetic solitons stabilized by spin-polarized current

    Science.gov (United States)

    Loreto, R. P.; Moura-Melo, W. A.; Pereira, A. R.; Zhang, X.; Zhou, Y.; Ezawa, M.; de Araujo, C. I. L.

    2018-06-01

    With the recent proposition of skyrmion utilization in racetrack memories at room temperature, skyrmionics has become a very attractive field. However, for the stability of skyrmions, it is essential to incorporate the Dzyaloshinskii-Moriya interaction (DMI) and the out-of-plane magnetic field into the system. In this work, we explore a system without these interactions. First, we propose a controlled way for the creation of magnetic skyrmions and skyrmioniums imprinted on a ferromagnetic nanotrack via a nanopatterned nanodisk with the magnetic vortex state. Then we investigate the detachment of the imprinted spin textures from the underneath of the nanodisk, as well as its transport by the spin-transfer torque imposed by spin-polarized current pulses applied in the nanotrack. A prominent feature of the moving imprinted spin texture is that its topological number Q is oscillating around the averaged value of Q = 0 as if it is a resonant state between the skyrmions with Q = ± 1 and the bubble with Q = 0 . We may call it a resonant magnetic soliton (RMS). A RMS moves along a straight line since it is free from the skyrmion Hall effect. In our studied device, the same electrodes are employed to realize the imprinted spin texture detachment and its transport. In addition, we have investigated the interaction between the RMS and a magnetic tunnel junction sensor, where the passing of the RMS in the nanotrack can be well detected. Our results would be useful for the development of novel spintronic devices based on moveable spin textures.

  15. Observed increase in freshwater transport in the East Greenland Current north of Denmark Strait

    Science.gov (United States)

    de Steur, Laura; Pickart, Bob; Macrander, Andreas; Våge, Kjetil; Harden, Ben; Jonsson, Steingrimur; Østerhus, Svein; Valdimarsson, Hedinn

    2017-04-01

    We present liquid freshwater transports of the shelfbreak East Greenland Current (EGC) and the separated EGC determined from mooring records from the Kögur section north of Denmark Strait between August 2011 and July 2012. The 11-month mean freshwater transport (FWT) of these two branches was 65±11 mSv to the south (relative to a salinity of 34.8). Approximately 70% of this was associated with the shelfbreak EGC and the remaining 30% with the separated EGC. Very large southward FWT ranging from 160 mSv to 120 mSv was observed from September to mid-October 2011 and was foremost due to anomalously low upper-layer salinities. The FWT on the Greenland shelf was also estimated using additional inshore moorings deployed from 2012-2014. While the annual mean ranged from nearly zero during the first year to 18 mSv to the south during the second year, synoptically the FWT on the shelf can be significant. Furthermore, an anomalous event in autumn 2011 caused the shelfbreak EGC to reverse, leading to a large reduction in FWT. This reversed circulation was due to the passage of a large, 100 km wide anticyclone originating upstream from the shelfbreak. The late summer FWT of -131 mSv is two and a half times larger than earlier estimates based on sections in the late-1990s and early-2000s. This increase is likely the result of enhanced freshwater flux from the Arctic Ocean to the Nordic Seas during the early 2010s when also a significant increase of Pacific Water in the EGC was observed. Preliminary results obtained from the long-term ocean observing system in Fram Strait are included to compare the increased FWT seen in 2011-2012 with interannual variations in Arctic freshwater outflow during the last decade.

  16. Bulk-Like Electrical Properties Induced by Contact-Limited Charge Transport in Organic Diodes: Revised Space Charge Limited Current

    KAUST Repository

    Xu, Guangwei

    2018-02-22

    Charge transport governs the operation and performance of organic diodes. Illuminating the charge-transfer/transport processes across the interfaces and the bulk organic semiconductors is at the focus of intensive investigations. Traditionally, the charge transport properties of organic diodes are usually characterized by probing the current–voltage (I–V) curves of the devices. However, to unveil the landscape of the underlying potential/charge distribution, which essentially determines the I–V characteristics, still represents a major challenge. Here, the electrical potential distribution in planar organic diodes is investigated by using the scanning Kelvin probe force microscopy technique, a method that can clearly separate the contact and bulk regimes of charge transport. Interestingly, by applying to devices based on novel, high mobility organic materials, the space-charge-limited-current-like I–V curves, which are previously believed to be a result of the bulk transport, are surprisingly but unambiguously demonstrated to be caused by contact-limited conduction. A model accounting is developed for the transport properties of both the two metal/organic interfaces and the bulk. The results indicate that pure interface-dominated transport can indeed give rise to I–V curves similar to those caused by bulk transport. These findings provide a new insight into the charge injection and transport processes in organic diodes.

  17. Mass of AC Andromedae

    International Nuclear Information System (INIS)

    King, D.S.; Cox, A.N.; Hodson, S.W.

    1975-01-01

    Calculations indicate that AC Andromedae is population I rather than population II. A mass and radius for this star are calculated using a new set of opacities for the Kippenhahn Ia mixture. It is concluded that the mass is too high for an ordinary RR Lyrae star. (BJG)

  18. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, G [Jefferson Lab (United States)

    2014-07-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  19. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  20. Effect of the poloidal current from the classical diffusion in the steady-state neo-classical transport

    International Nuclear Information System (INIS)

    Igna Junior, A.D.

    1984-01-01

    The relevant parameters of two steady-state models of a plasma column, in fusion regime, were analyzed for an ideal Tokamak. The neo-classical transport theory was considered in the banana regime and in the Pfirsch-Schlueter regime. The first model proposes a correction in the numerical coefficients of the transport equations. In the other one, a poloidal current from Pfirsch-Schlueter classical diffusion is considered aiming to satisfy the pressure balance. (M.C.K.) [pt

  1. Sodium glucose CoTransporter 2 (SGLT2) inhibitors: Current status and future perspective.

    Science.gov (United States)

    Madaan, Tushar; Akhtar, Mohd; Najmi, Abul Kalam

    2016-10-10

    Diabetes mellitus is a disease that affects millions of people worldwide and its prevalence is estimated to rise in the future. Billions of dollars are spent each year around the world in health expenditure related to diabetes. There are several anti-diabetic drugs in the market for the treatment of non-insulin dependent diabetes mellitus. In this article, we will be talking about a relatively new class of anti-diabetic drugs called sodium glucose co-transporter 2 (SGLT2) inhibitors. This class of drugs has a unique mechanism of action focusing on inhibition of glucose reabsorption that separates it from other classes. This article covers the mechanism of glucose reabsorption in the kidneys, the mechanism of action of SGLT2 inhibitors, several SGLT2 inhibitors currently available in the market as well as those in various phases of development, their individual pharmacokinetics as well as the discussion about the future role of SGLT2 inhibitors, not only for the treatment of diabetes, but also for various other diseases like obesity, hepatic steatosis, and cardiovascular disorders. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. Spallation neutron production and the current intra-nuclear cascade and transport codes

    International Nuclear Information System (INIS)

    Filges, D.; Goldenbaum, F.

    2001-01-01

    A recent renascent interest in energetic proton-induced production of neutrons originates largely from the inception of projects for target stations of intense spallation neutron sources, like the planned European Spallation Source (ESS), accelerator-driven nuclear reactors, nuclear waste transmutation, and also from the application for radioactive beams. In the framework of such a neutron production, of major importance is the search for ways for the most efficient conversion of the primary beam energy into neutron production. Although the issue has been quite successfully addressed experimentally by varying the incident proton energy for various target materials and by covering a huge collection of different target geometries --providing an exhaustive matrix of benchmark data-- the ultimate challenge is to increase the predictive power of transport codes currently on the market. To scrutinize these codes, calculations of reaction cross-sections, hadronic interaction lengths, average neutron multiplicities, neutron multiplicity and energy distributions, and the development of hadronic showers are confronted with recent experimental data of the NESSI collaboration. Program packages like HERMES, LCS or MCNPX master the prevision of reaction cross-sections, hadronic interaction lengths, averaged neutron multiplicities and neutron multiplicity distributions in thick and thin targets for a wide spectrum of incident proton energies, geometrical shapes and materials of the target generally within less than 10% deviation, while production cross-section measurements for light charged particles on thin targets point out that appreciable distinctions exist within these models. (orig.)

  3. Transport of contaminants by Arctic sea ice and surface ocean currents

    International Nuclear Information System (INIS)

    Pfirman, S.

    1995-01-01

    Sea ice and ocean currents transport contaminants in the Arctic from source areas on the shelves, to biologically active regions often more than a thousand kilometers away. Coastal regions along the Siberian margin are polluted by discharges of agricultural, industrial and military wastes in river runoff, from atmospheric deposition and ocean dumping. The Kara Sea is of particular concern because of deliberate dumping of radioactive waste, as well as the large input of polluted river water. Contaminants are incorporated in ice during suspension freezing on the shelves, and by atmospheric deposition during drift. Ice releases its contaminant load through brine drainage, surface runoff of snow and meltwater, and when the floe disintegrates. The marginal ice zone, a region of intense biological activity, may also be the site of major contaminant release. Potentially contaminated ice from the Kara Sea is likely to influence the marginal ice zones of the Barents and Greenland seas. From studies conducted to date it appears that sea ice from the Kara Sea does not typically enter the Beaufort Gyre, and thus is unlikely to affect the northern Canadian and Alaskan margins

  4. California coast nearshore processes study. [nearshore currents, sediment transport, estuaries, and river discharge

    Science.gov (United States)

    Pirie, D. M.; Steller, D. D. (Principal Investigator)

    1973-01-01

    The author has identified the following significant results. Large scale sediment plumes from intermittent streams and rivers form detectable seasonal patterns on ERTS-1 imagery. The ocean current systems, as plotted from three California coast ERTS mosaics, were identified. Offshore patterns of sediment in areas such as the Santa Barbara Channel are traceable. These patterns extend offshore to heretofore unanticipated ranges as shown on the ERTS-1 imagery. Flying spot scanner enhancements of NASA tapes resulted in details of subtle and often invisible (to the eye) nearshore features. The suspended sediments off San Francisco and in Monterey Bay are emphasized in detail. These are areas of extremely changeable offshore sediment transport patterns. Computer generated contouring of radiance levels resulted in maps that can be used in determining surface and nearsurface suspended sediment distribution. Tentative calibrations of ERTS-1 spectral brightness against sediment load have been made using shipboard measurements. Information from the combined enhancement and interpretation techniques is applicable to operational coastal engineering programs.

  5. Finite element transport methods for criticality calculations - current status and potential applications

    International Nuclear Information System (INIS)

    Oliveira, C.R.E. de; Goddard, A.

    1991-01-01

    In this paper we review the current status of the finite element method applied to the solution of the neutron transport equation and we discuss its potential role in the field of criticality safety. We show that the method's ability in handling complex, irregular geometry in two- and three-dimensions coupled with its accurate solutions potentially renders it an attractive alternative to the longer-established Monte Carlo method. Details of the most favoured form of the method - that which combines finite elements in space and spherical harmonics in angle - are presented. This form of the method, which has been extensively investigated over the last decade by research groups at the University of London, has been numerically implemented in the finite element code EVENT. The code has among its main features the capability of solving fixed source eigenvalue and time-dependent complex geometry problems in two- and three-dimensions. Other features of the code include anisotropic up- and down-scatter, direct and/or adjoint solutions and access to standard data libraries. Numerical examples, ranging from simple criticality benchmark studies to the analysis of idealised three-dimensional reactor cores, are presented to demonstrate the potential of the method. (author)

  6. Spallation neutron production and the current intra-nuclear cascade and transport codes

    Science.gov (United States)

    Filges, D.; Goldenbaum, F.; Enke, M.; Galin, J.; Herbach, C.-M.; Hilscher, D.; Jahnke, U.; Letourneau, A.; Lott, B.; Neef, R.-D.; Nünighoff, K.; Paul, N.; Péghaire, A.; Pienkowski, L.; Schaal, H.; Schröder, U.; Sterzenbach, G.; Tietze, A.; Tishchenko, V.; Toke, J.; Wohlmuther, M.

    A recent renascent interest in energetic proton-induced production of neutrons originates largely from the inception of projects for target stations of intense spallation neutron sources, like the planned European Spallation Source (ESS), accelerator-driven nuclear reactors, nuclear waste transmutation, and also from the application for radioactive beams. In the framework of such a neutron production, of major importance is the search for ways for the most efficient conversion of the primary beam energy into neutron production. Although the issue has been quite successfully addressed experimentally by varying the incident proton energy for various target materials and by covering a huge collection of different target geometries --providing an exhaustive matrix of benchmark data-- the ultimate challenge is to increase the predictive power of transport codes currently on the market. To scrutinize these codes, calculations of reaction cross-sections, hadronic interaction lengths, average neutron multiplicities, neutron multiplicity and energy distributions, and the development of hadronic showers are confronted with recent experimental data of the NESSI collaboration. Program packages like HERMES, LCS or MCNPX master the prevision of reaction cross-sections, hadronic interaction lengths, averaged neutron multiplicities and neutron multiplicity distributions in thick and thin targets for a wide spectrum of incident proton energies, geometrical shapes and materials of the target generally within less than 10% deviation, while production cross-section measurements for light charged particles on thin targets point out that appreciable distinctions exist within these models.

  7. Influence of a transport current on the local magnetic field distribution in sintered YBa2Cu3Ox

    International Nuclear Information System (INIS)

    Zimmermann, P.; Keller, H.; Kuendig, W.; Puempin, B.; Savic, I.M.; Schneider, J.W.; Simmler, H.; Kaldis, E.; Rusiecki, S.

    1991-01-01

    The influence of a transport current on the magnetic flux-line distribution in sintered YBCO was studied by means of μSR. Pronounced differences between zero-field-cooled (ZFC) and field-cooled (FC) signals and irreversible behavior were observed. In the ZFC case even a small transport current (10 A/cm 2 ) tends to order irreversibly the inhomogeneous flux-line distribution considerably, suggesting a broad distribution of pinning barriers. However, for a FC sample no noticeable change in the flux distribution in the presence of a transport current (up to 40 A/cm 2 ) was detected, indicating that the FC state represents a stable flux-line configuration. (orig.)

  8. Conformational basis for the Li(+)-induced leak current in the rat gamma-aminobutyric acid (GABA) transporter-1

    DEFF Research Database (Denmark)

    MacAulay, Nanna; Zeuthen, Thomas; Gether, Ulrik

    2002-01-01

    The rat gamma-aminobutyric acid transporter-1 (GAT-1) was expressed in Xenopus laevis oocytes and the substrate-independent Li(+)-induced leak current was examined using two-electrode voltage clamp. The leak current was not affected by the addition of GABA and was not due to H(+) permeation. The Li......(+)-bound conformation of the protein displayed a lower passive water permeability than that of the Na(+)- and choline (Ch(+))-bound conformations and the leak current did not saturate with increasing amounts of Li(+) in the test solution. The mechanism that gives rise to the leak current did not support active water...... transport in contrast to the mechanism responsible for GABA translocation (approximately 330 water molecules per charge). Altogether, these data support the distinct nature of the leak conductance in relation to the substrate translocation process. It was observed that the leak current was inhibited by low...

  9. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  10. Multi-phase AC/AC step-down converter for distribution systems

    Science.gov (United States)

    Aeloiza, Eddy C.; Burgos, Rolando P.

    2017-10-25

    A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

  11. Simulation of current-voltage characteristics of a MOS structure considering the tunnel transport of carriers in semiconductor

    International Nuclear Information System (INIS)

    Vexler, M I

    2006-01-01

    The effect of a tunnel charge transport in the near-surface region of silicon on the electrical characteristics of MOS structures with a 2-3 nm insulator layer is studied theoretically. An equilibrium condition for the substrate is assumed. The cases of an Al and polySi gate are considered. The possibility of a 'double' (in Si and through SiO 2 ) tunnelling expands the energy range of transported particles, which increases one of the components of the total tunnel current. The proposed model allows for the improved simulation of gate current in MOSFETs, which is especially important for highly-doped substrates

  12. Current status and future considerations for a transportation system for spent fuel and radioactive waste

    International Nuclear Information System (INIS)

    Anderson, R.T.; Darr, D.G.; Godfrey, W.L.; Keely, R.B.; Lusk, E.C.; Peterson, R.W.; Ridihalgh, J.L.; Shallo, F.A.; Young, M.

    1978-02-01

    This report is part of the OWI Transportation/Logistics systems analysis of problems associated with shipping these wastes to waste terminal storage facilities. It covers governmental regulations and functional responsibilities, highway and rail transportation status and economic considerations, assessment of present industry capabilities and business-related considerations, important receiving facility considerations, necessary engineering and licensing-related aspects of packaging systems, and essential elements of reprocessing plant waste activities including packaging and transportation

  13. Finite-element analysis and comparison of the AC loss performance of BSCCO and YBCO conductors

    International Nuclear Information System (INIS)

    Stavrev, Svetlomir; Grilli, Francesco; Dutoit, Bertrand; Ashworth, Stephen

    2006-01-01

    The AC loss performance of two BSCCO and two YBCO conductors of different geometry, characterized by the same self-field critical current of 150 A, is analysed and compared quantitatively. The comparison is made using the finite-element method with a nonlinear B-dependent E-J relation. A new shell-region model is utilised for the simulations of thin YBCO strips. Different AC working conditions are simulated: self-field, applied external field, and combined transport current and external perpendicular field application. Magnetic field and current density profiles are investigated in order to illustrate the reasons for the loss difference in the conductors. Depending on the application, the advantages of using BSCCO or YBCO conductors with specific geometry are outlined

  14. Regulatory Framework and Current Practices of the Radioactive Material Safe and Secure Transport in Albania

    International Nuclear Information System (INIS)

    Dollani, K.; Grillo, B.; Telhaj, E.

    2016-01-01

    Attempts for the establishing of a safe and secure radioactive material transport in Albania began a decade ago with formulation of the different regulation in the field of safe and secure handling of the radioactive materials. In 2004 a special regulation for the safe transport of radioactive material was prepared and approved by the National Radiation Protection Commission). This regulation has been based in the IAEA standards for the radioactive material transport and was reviewed periodically. The last regulation of the radioactive material transport was approved by Albanian government through a governmental ordinance. The transport of the radioactive material in Albania is performed by licensed subjects, which fulfill all requirements of the mentioned governmental ordinance. Based in the existing regulation, for each transport of radioactive material, a special permission is issued by NRPC. The issuing of permission allows competent authority to provide necessary information on transport regularity and to have under survey all transports of the radioactive material carried out inside the country. Last year were issued more than 80 permissions for the transport of the different types and categories of the radioactive sources. (author)

  15. Evaluation of transporters in drug development: Current status and contemporary issues.

    Science.gov (United States)

    Lee, Sue-Chih; Arya, Vikram; Yang, Xinning; Volpe, Donna A; Zhang, Lei

    2017-07-01

    Transporters govern the access of molecules to cells or their exit from cells, thereby controlling the overall distribution of drugs to their intracellular site of action. Clinically relevant drug-drug interactions mediated by transporters are of increasing interest in drug development. Drug transporters, acting alone or in concert with drug metabolizing enzymes, can play an important role in modulating drug absorption, distribution, metabolism and excretion, thus affecting the pharmacokinetics and/or pharmacodynamics of a drug. The drug interaction guidance documents from regulatory agencies include various decision criteria that may be used to predict the need for in vivo assessment of transporter-mediated drug-drug interactions. Regulatory science research continues to assess the prediction performances of various criteria as well as to examine the strength and limitations of each prediction criterion to foster discussions related to harmonized decision criteria that may be used to facilitate global drug development. This review discusses the role of transporters in drug development with a focus on methodologies in assessing transporter-mediated drug-drug interactions, challenges in both in vitro and in vivo assessments of transporters, and emerging transporter research areas including biomarkers, assessment of tissue concentrations, and effect of diseases on transporters. Published by Elsevier B.V.

  16. Spintronics with metals: Current perpendicular-to-the-plane magneto-transport studies

    Science.gov (United States)

    Sharma, Amit

    understanding the physics underlying spin transfer torque in F/N/F trilayers, we devised a simple test, where we change the transport properties of only the N-spacer from ballistic to diffusive. To try to minimize effects of systematic errors, we compare ratios of results for diffusive and ballistic transport with calculations. The ratios disagree with predictions of those models that were expected to be most, reliable. Recently, it was predicted that spintronics effects: magnetoresistance, and spin transfer torque induced magnetization switching, should be observable in systems where ferromagnets are replaced by antiferromagnets. We have done the first experiments to search for those predicted antiferromagnetic spintronics effects. We find effects of large current densities on exchange bias, but no clear evidence for antiferromagnetic giant magnetoresistance.

  17. Current transport mechanism in graphene/AlGaN/GaN heterostructures with various Al mole fractions

    Science.gov (United States)

    Pandit, Bhishma; Seo, Tae Hoon; Ryu, Beo Deul; Cho, Jaehee

    2016-06-01

    The current transport mechanism of graphene formed on AlxGa1-xN/GaN heterostructures with various Al mole fractions (x = 0.15, 0.20, 0.30, and 0.40) is investigated. The current-voltage measurement from graphene to AlGaN/GaN shows an excellent rectifying property. The extracted Schottky barrier height of the graphene/AlGaN/GaN contacts increases with the Al mole fraction in AlGaN. However, the current transport mechanism deviates from the Schottky-Mott theory owing to the deterioration of AlGaN crystal quality at high Al mole fractions confirmed by reverse leakage current measurement.

  18. Summary of the working group on high current transport and final focus lenses

    International Nuclear Information System (INIS)

    Garren, A.A.

    1978-01-01

    Transverse instabilities of intense beams in periodic transport lines are reviewed. Chromatic aberrations in the final beam transport lines and geometric aberrations due to quadrupole fringe fields are discussed and corrections to reduce them are evaluated. The implications for four reference designs are evaluated by comparing the tune depression, momentum spread, and emittance

  19. Current practices on sheep and beef farms in New Zealand for depriving sheep of feed prior to transport for slaughter.

    Science.gov (United States)

    Fisher, M W; Gregory, N G; Muir, P D

    2012-05-01

    To assess current practices on sheep and beef farms that deprive sheep of feed prior to transport to facilitate effluent management and processing at slaughter. A national telephone survey of 122 sheep and 346 sheep and beef farmers was conducted in March and April 2010. They were asked how long sheep were held off green feed prior to transport and why, what environment the sheep were held in, and if that period ever varied. Of the 468 respondents, 303 (65%) removed their sheep from green feed 3-12 h before transport for slaughter, with longer periods reported in the South than North Island. The main reasons given were to reduce the volume of effluent for transport operators (n=174), to prevent wool staining during transport (n=173), and that sheep were better suited to load and travel empty (n=171). Water was provided during feed deprivation by 313 farmers. The period of food deprivation could be altered in response to requirements of transporters and processors, the weather, and by the class of stock involved, although 115/468 (25%) farmers stated that they never changed their normal protocol. Amongst survey respondents, common practices compared favourably with recommendations to reduce effluent during transportation. Previous studies have investigated the effects of fasting lambs whilst in lairage prior to slaughter and focussed on carcass quality such as carcass weight and tenderness. Changes in liveweight and gastrointestinal tract contents suggest feed deprivation reduces the risk of defaecation and urination contributing to the accumulation of effluent during transport and of carcass contamination during processing. However, the point at which that risk is acceptable to transport and processing is unclear. Fasting results in physiological changes indicative of altered metabolism but it is not clear when those changes are indicative of adaptation to food deprivation or metabolic depletion and compromised welfare. There may be opportunities to improve the

  20. Impedance Spectroscopy and AC Conductivity Studies of Bulk 3-Amino-7-(dimethylamino)-2-methyl-hydrochloride

    Science.gov (United States)

    El-Shabaan, M. M.

    2018-02-01

    Impedance spectroscopy and alternating-current (AC) conductivity (σ AC) studies of bulk 3-amino-7-(dimethylamino)-2-methyl-hydrochloride (neutral red, NR) have been carried out over the temperature (T) range from 303 K to 383 K and frequency (f) range from 0.5 kHz to 5 MHz. Dielectric data were analyzed using the complex impedance (Z *) and complex electric modulus (M *) for bulk NR at various temperatures. The impedance loss peaks were found to shift towards high frequencies, indicating an increase in the relaxation time (τ 0) and loss in the material, with increasing temperature. For each temperature, a single depressed semicircle was observed at high frequencies, originating from the bulk transport, and a spike in the low-frequency region, resulting from the electrode effect. Fitting of these curves yielded an equivalent circuit containing a parallel combination of a resistance R and constant-phase element (CPE) Q. The carrier transport in bulk NR is governed by the correlated barrier hopping (CBH) mechanism, some parameters of which, such as the maximum barrier height (W M), charge density (N), and hopping distance (r), were determined as functions of both temperature and frequency. The frequency dependence of σ AC at different temperatures indicated that the conduction in bulk NR is a thermally activated process. The σ AC value at different frequencies increased linearly with temperature.

  1. Non-canonical spectral decomposition of random functions of the traction voltage and current in electric transportation systems

    Directory of Open Access Journals (Sweden)

    N.A. Kostin

    2015-03-01

    Full Text Available The paper proposes the non-canonical spectral decomposition of random functions of the traction voltages and currents. This decomposition is adapted for the electric transportation systems. The numerical representation is carried out for the random function of voltage on the pantograph of electric locomotives VL8 and DE1.

  2. Characteristics of alternating current hopping conductivity in DNA sequences

    International Nuclear Information System (INIS)

    Song-Shan, Ma; Hui, Xu; Huan-You, Wang; Rui, Guo

    2009-01-01

    This paper presents a model to describe alternating current (AC) conductivity of DNA sequences, in which DNA is considered as a one-dimensional (1D) disordered system, and electrons transport via hopping between localized states. It finds that AC conductivity in DNA sequences increases as the frequency of the external electric field rises, and it takes the form of ø ac (ω) ∼ ω 2 ln 2 (1/ω). Also AC conductivity of DNA sequences increases with the increase of temperature, this phenomenon presents characteristics of weak temperature-dependence. Meanwhile, the AC conductivity in an off-diagonally correlated case is much larger than that in the uncorrelated case of the Anderson limit in low temperatures, which indicates that the off-diagonal correlations in DNA sequences have a great effect on the AC conductivity, while at high temperature the off-diagonal correlations no longer play a vital role in electric transport. In addition, the proportion of nucleotide pairs p also plays an important role in AC electron transport of DNA sequences. For p < 0.5, the conductivity of DNA sequence decreases with the increase of p, while for p ≥ 0.5, the conductivity increases with the increase of p. (cross-disciplinary physics and related areas of science and technology)

  3. Characteristics of alternating current hopping conductivity in DNA sequences

    Institute of Scientific and Technical Information of China (English)

    Ma Song-Shan; Xu Hui; Wang Huan-You; Guo Rui

    2009-01-01

    This paper presents a model to describe alternating current (AC) conductivity of DNA sequences,in which DNA is considered as a one-dimensional (1D) disordered system,and electrons transport via hopping between localized states.It finds that AC conductivity in DNA sequences increases as the frequency of the external electric field rises,and it takes the form of σac(ω)~ω2 ln2(1/ω).Also AC conductivity of DNA sequences increases with the increase of temperature,this phenomenon presents characteristics of weak temperature-dependence.Meanwhile,the AC conductivity in an off diagonally correlated case is much larger than that in the uncorrelated case of the Anderson limit in low temperatures,which indicates that the off-diagonal correlations in DNA sequences have a great effect on the AC conductivity,while at high temperature the off-diagonal correlations no longer play a vital role in electric transport. In addition,the proportion of nucleotide pairs p also plays an important role in AC electron transport of DNA sequences.For p<0.5,the conductivity of DNA sequence decreases with the increase of p,while for p > 0.5,the conductivity increases with the increase of p.

  4. Current status of sea transport of nuclear fuel materials and LLW in Japan

    International Nuclear Information System (INIS)

    Kitagawa, Hiroshi; Akiyama, Hideo

    2000-01-01

    Along with the basic policy of the nuclear fuel cycle of Japan, many fuel cycle facilities have been already constructed in Rokkasho-Mura, Aomori prefecture, such as the uranium enrichment plant, the low level waste disposal center and the receiving pool of the spent nuclear fuels for reprocessing. These facilities belong to the Japan Nuclear Fuel Limited. (JNFL). Domestic sea transport of the spent nuclear fuels (SF) has been carried out since 1977 to the Tokai Reprocessing Plant, and the first sea transport of the SF to the fuel cycle facility in Rokkasho-Mura was done in Oct, 1998 using a new exclusive ship 'Rokuei-Maru'. Sea transport of the low level radioactive wastes (LLW) has been carried out since 1992 to the Rokkasho LLW Disposal Center, and about 130,000 LLW drams were transported from the nuclear power plant sites. These sea transport have demonstrated the safety of the transport of the nuclear fuel cycle materials. It is hoped that the safe sea transport of the nuclear fuel materials will contribute to the more progress of the nuclear fuel cycle activities of Japan. (author)

  5. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

    1997-01-01

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  6. Experimental investigation of focusing and transport of heavy-current electron beams

    International Nuclear Information System (INIS)

    Baranchikov, E.I.; Gordeev, A.V.; Koba, Yu.V.; Korolev, V.D.; Pen'kina, V.S.; Rudakov, L.I.; Smirnov, V.P.; Sukhov, A.D.; Tarumov, E.Z.

    The results of an experimental and theoretical study of beam transfer through transverse magnetic fields are outlined. The injection and transport of an annular relativistic electron beam due to a magnetic trap of acute-angle geometry are experimentally studied

  7. Water characteristics and transport of the Antarctic circumpolar current in the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Muraleedharan, P.M.; Mathew, B.

    Geostrophic velocities are computed across meridians 37 degrees E and 105 degrees E using hydrographic data. The estimated mass transport is represented on a temperature - salinity diagram. The characteristics of the water within the Antarctic...

  8. On water transport in polymer electrolyte membranes during the passage of current

    DEFF Research Database (Denmark)

    Berning, Torsten

    2011-01-01

    This article discusses an approach to model the water transport in the membranes of PEM fuel cells during operation. Starting from a frequently utilized equation the various transport mechanisms are analyzed in detail. It is shown that the commonly used approach to simply balance the electro......-osmotic drag (EOD) with counter diffusion and/or hydraulic permeation is flawed, and that any net transport of water through the membrane is caused by diffusion. Depending on the effective drag the cathode side of the membrane may experience a lower hydration than the anode side. The effect of a water......-uptake layer on the net water transport will also be pictured. Finally, the effect of EOD is visualized using “Newton’s cradle”....

  9. Airborne biological hazards and urban transport infrastructure: current challenges and future directions.

    Science.gov (United States)

    Nasir, Zaheer Ahmad; Campos, Luiza Cintra; Christie, Nicola; Colbeck, Ian

    2016-08-01

    Exposure to airborne biological hazards in an ever expanding urban transport infrastructure and highly diverse mobile population is of growing concern, in terms of both public health and biosecurity. The existing policies and practices on design, construction and operation of these infrastructures may have severe implications for airborne disease transmission, particularly, in the event of a pandemic or intentional release of biological of agents. This paper reviews existing knowledge on airborne disease transmission in different modes of transport, highlights the factors enhancing the vulnerability of transport infrastructures to airborne disease transmission, discusses the potential protection measures and identifies the research gaps in order to build a bioresilient transport infrastructure. The unification of security and public health research, inclusion of public health security concepts at the design and planning phase, and a holistic system approach involving all the stakeholders over the life cycle of transport infrastructure hold the key to mitigate the challenges posed by biological hazards in the twenty-first century transport infrastructure.

  10. Superconducting ac cable

    Science.gov (United States)

    Schmidt, F.

    1980-11-01

    The components of a superconducting 110 kV ac cable for power ratings or = 2000 MVA were developed. The cable design is of the semiflexible type, with a rigid cryogenic envelope containing a flexible hollow coaxial cable core. The cable core consists of spirally wound Nb-A1 composite wires electrically insulated by high pressure polyethylene tape wrappings. A 35 m long single phase test cable with full load terminals rated at 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of this cable design.

  11. ac superconducting articles

    International Nuclear Information System (INIS)

    Meyerhoff, R.W.

    1977-01-01

    A noval ac superconducting cable is described. It consists of a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface

  12. Superconducting ac cable

    International Nuclear Information System (INIS)

    Schmidt, F.

    1980-01-01

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.) [de

  13. Current transport mechanism in graphene/AlGaN/GaN heterostructures with various Al mole fractions

    Directory of Open Access Journals (Sweden)

    Bhishma Pandit

    2016-06-01

    Full Text Available The current transport mechanism of graphene formed on AlxGa1−xN/GaN heterostructures with various Al mole fractions (x = 0.15, 0.20, 0.30, and 0.40 is investigated. The current–voltage measurement from graphene to AlGaN/GaN shows an excellent rectifying property. The extracted Schottky barrier height of the graphene/AlGaN/GaN contacts increases with the Al mole fraction in AlGaN. However, the current transport mechanism deviates from the Schottky-Mott theory owing to the deterioration of AlGaN crystal quality at high Al mole fractions confirmed by reverse leakage current measurement.

  14. Choice of sample size for high transport critical current density in a granular superconductor: percolation versus self-field effects

    International Nuclear Information System (INIS)

    Mulet, R.; Diaz, O.; Altshuler, E.

    1997-01-01

    The percolative character of the current paths and the self-field effects were considered to estimate optimal sample dimensions for the transport current of a granular superconductor by means of a Monte Carlo algorithm and critical-state model calculations. We showed that, under certain conditions, self-field effects are negligible and the J c dependence on sample dimensions is determined by the percolative character of the current. Optimal dimensions are demonstrated to be a function of the fraction of superconducting phase in the sample. (author)

  15. Effects of heat and water transport on the performance of polymer electrolyte membrane fuel cell under high current density operation

    International Nuclear Information System (INIS)

    Tabuchi, Yuichiro; Shiomi, Takeshi; Aoki, Osamu; Kubo, Norio; Shinohara, Kazuhiko

    2010-01-01

    Key challenges to the acceptance of polymer electrolyte membrane fuel cells (PEMFCs) for automobiles are the cost reduction and improvement in its power density for compactness. In order to get the solution, the further improvement in a fuel cell performance is required. In particular, under higher current density operation, water and heat transport in PEMFCs has considerable effects on the cell performance. In this study, the impact of heat and water transport on the cell performance under high current density was investigated by experimental evaluation of liquid water distribution and numerical validation. Liquid water distribution in MEA between rib and channel area is evaluated by neutron radiography. In order to neglect the effect of liquid water in gas channels and reactant species concentration distribution in the flow direction, the differential cell was used in this study. Experimental results suggested that liquid water under the channel was dramatically changed with rib/channel width. From the numerical study, it is found that the change of liquid water distribution was significantly affected by temperature distribution in MEA between rib and channel area. In addition, not only heat transport but also water transport through the membrane also significantly affected the cell performance under high current density operation.

  16. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  17. Hygienic measures during animal transport to abattoirs - a status quo analysis of the current cleaning and disinfection of animal transporters in Germany.

    Science.gov (United States)

    Weber, Luisa; Meemken, Diana

    2018-01-01

    The process of cleaning and disinfection of animal transport vehicles after unloading animals at the abattoir is a critical control point regarding proper hygiene. It is an important step regarding the biosecurity. In the present study, a status quo analysis of the currently performed cleaning and disinfection measures of animal transport vehicles was carried out at the vehicle washing facilities of five different industrial abattoirs in Germany. For this purpose, a checklist was developed and validated to assess the washing procedure of transport vehicles in a standardised way. The evaluated phases of cleaning included the evaluation criteria "length of time per used floor", "visual cleaning success" and the "hygienic awareness of the driver". During disinfection, attention was paid to the internal and external surfaces of the transporter and to the methods used to disinfect them. In addition, the technical and structural equipment of the five different washing facilities were recorded using a questionnaire and compared to the legal regulations, respectively. At each location, approximately 150 vehicles of all delivery types (transport vehicles owned by the abattoir, external delivery companies and vehicles owned by the supplying farmers) were inspected so that in total a number of more than 750 vehicles were included in this study. The aim was to develop abattoir specific, as well as generally applicable intervention measures and to generate "standard-operation procedures" (SOP's) for the cleaning and disinfection of animal transporters. At two out of five locations vehicles have left the abattoir without cleaning and disinfection. In 31-97% of all vehicles, only a cleaning of the vehicle was carried out, a subsequent disinfection did not take place. A cleaning followed by disinfecting took place in only 3-59% of all vehicles. The results indicate a considerable need for improvement and standardisation in this relevant field of disease prevention.

  18. ac propulsion system for an electric vehicle

    Science.gov (United States)

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  19. Superconducting three element synchronous ac machine

    International Nuclear Information System (INIS)

    Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.

    1975-01-01

    There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition

  20. Unmanned Aerial Aircraft Systems for transportation engineering: Current practice and future challenges

    Directory of Open Access Journals (Sweden)

    Emmanouil N. Barmpounakis

    2016-10-01

    Full Text Available Acquiring and processing video streams from static cameras has been proposed as one of the most efficient tools for visualizing and gathering traffic information. With the latest advances in technology and visual media, combined with the increased needs in dealing with congestion more effectively and directly, the use of Unmanned Aerial Aircraft Systems (UAS has emerged in the field of traffic engineering. In this paper, we review studies and applications that incorporate UAS in transportation research and practice with the aim to set the grounds from the proper understanding and implementation of UAS related surveillance systems in transportation and traffic engineering. The studies reviewed are categorized in different transportation engineering areas. Additional significant applications from other research fields are also referenced to identify other promising applications. Finally, issues and emerging challenges in both a conceptual and methodological level are revealed and discussed.

  1. Current transport mechanisms in lattice-matched Pt/Au-InAlN/GaN Schottky diodes

    Energy Technology Data Exchange (ETDEWEB)

    Ren, Jian; Yan, Dawei, E-mail: daweiyan@jiangnan.edu.cn; Yang, Guofeng; Wang, Fuxue; Xiao, Shaoqing; Gu, Xiaofeng [Key Laboratory of Advanced Process Control for Light Industry (Ministry of Education), Department of Electronic Engineering, Jiangnan University, Wuxi 214122 (China)

    2015-04-21

    Lattice-matched Pt/Au-In{sub 0.17}Al{sub 0.83}N/GaN hetreojunction Schottky diodes with circular planar structure have been fabricated and investigated by temperature dependent electrical measurements. The forward and reverse current transport mechanisms are analyzed by fitting the experimental current-voltage characteristics of the devices with various models. The results show that (1) the forward-low-bias current is mainly due to the multiple trap-assisted tunneling, while the forward-high-bias current is governed by the thermionic emission mechanism with a significant series resistance effect; (2) the reverse leakage current under low electric fields (<6 MV/cm) is mainly carried by the Frenkel-Poole emission electrons, while at higher fields the Fowler-Nordheim tunneling mechanism dominates due to the formation of a triangular barrier.

  2. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  3. Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

    Energy Technology Data Exchange (ETDEWEB)

    Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

    2008-07-01

    Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

  4. Effects of particle migration on the features of their transport by tidal currents in a region of freshwater influence

    Science.gov (United States)

    Korotenko, K. A.; Sentchev, A. V.

    2008-10-01

    Using a combined model that couples a three-dimensional ocean circulation model, a model for tidal currents, and a model for particle transport, the structure of the velocity field of the tidal current and the transport of particles migrating over the vertical were studied in the zone of the influence of the riverine runoff in the eastern part of the English Channel. It was found that the interaction between the tidal current and the baroclinic flow formed by the riverine runoff off the northeastern coast of France generates a steady-state intensive (˜0.3 m/s) residual current in the zone of the effect of the riverine runoff. In order to assess the influence of different types of particle migration (which simulate ichthyoplankton) on the processes of their transport in the region under consideration, we performed numerical experiments with particle clusters, for which parameterization of their migration was implemented on the basis of the field observations over the proper vertical movements of different types of ichthyoplankton. The experiments showed that the distribution of the fields of the particle concentrations and the velocities of their movements depend not only on the background hydrophysical conditions but also on the character of the vertical migration of the particles. In this paper, a comparison between the results of the modeling and those of the field observations in the region under consideration are presented.

  5. Research of transportation efficiency of low-energy high- current electron beam in plasma channel in external magnetic field

    International Nuclear Information System (INIS)

    Vagin, E S; Grigoriev, V P

    2015-01-01

    Effective high current (5-20 kA) and low energy (tens of keV) electrons beam transportation is possible only with almost complete charging neutralization. It is also necessary to use quite high current neutralization for elimination beam self-pinching effect. The research is based on the self-consistent mathematical model that takes into account beam and plasma particles dynamic, current and charge neutralization of electron beam and examines the transportation of electron beam into a chamber with low-pressure plasma in magnetic field. A numerical study was conducted using particle in cell (PIC) method. The study was performed with various system parameters: rise time and magnitude of the beam current, gas pressure and plasma density and geometry of the system. Regularities of local virtual cathode field generated by the beam in the plasma channel, as well as ranges of parameters that let transportation beam with minimal losses, depending on the external magnetic field were determined through a series of numerical studies. In addition, the assessment of the impact of the plasma ion mobility during the transition period and during steady beam was performed. (paper)

  6. Application of a two fluid theoretical plasma transport model on current tokamak reactor designs

    International Nuclear Information System (INIS)

    Ibrahim, E.; Fowler, T.K.

    1987-06-01

    In this work, the new theoretical transport models to TIBER II design calculations are described and the results are compared with recent experimental data in large tokamaks (TFTR, JET). Tang's method is extended to a two-fluid model treating ions and electrons separately. This allows for different ion and electron temperatures, as in recent low-density experiments in TFTR, and in the TIBER II design itself. The discussion is divided into two parts: (1) Development of the theoretical transport model and (2) calibration against experiments and application to TIBER II

  7. Modeling photovoltaic systems for AC appliances

    Directory of Open Access Journals (Sweden)

    Andreea Maria Neaca

    2009-10-01

    Full Text Available In this paper is described the development of a model which can simulate the performance of a photovoltaic (PV system under specific meteorological conditions and transforming the DC current into AC current. In this model, the accent stands on the design of a series charge regulator. It is treated also the benefit of creating a circuit, with different methods, that can test the maximum power point trackers (MPPT for different photovoltaic applications.

  8. Transport measurements in superconductors: critical current of granular high TC ceramic superconductor samples; Medidas de transporte em supercondutores: corrente critica de supercondutores granulares de alta temperatura critica

    Energy Technology Data Exchange (ETDEWEB)

    Passos, W.A.C., E-mail: wagner.passos@univasf.edu.br [Universidade Federal do Vale do Sao Francisco (IPCM/UNIVASF), Juazeiro do Norte, BA (Brazil). Instituto de Pesquisas em Ciencia dos Materiais; Silva, E.B. [Companhia Energetica do Sao Francisco (CHESF), Recife, PE (Brazil)

    2016-07-01

    This work presents a method to obtain critical current of granular superconductors. We have carried out transport measurements (ρxT curves and VxI curves) in a YBa{sub 2}Cu{sub 3}O{sub 7-δ} sample to determine critical current density of it. Some specimens reveal a 'semiconductor-like' behavior (electrical resistivity decreases with increasing temperatures above critical temperature T{sub c} of material) competing with superconductor behavior. Due to high granular fraction of the sample, these competition is clearly noted in ρxT curves. Measurements carried out from 0 to 8500 Oe of applied field show the same behavior, and the critical current density of the samples is shown. (author)

  9. AC losses in (Bi,Pb) 2Sr 2Ca 2Cu 3O x tapes

    Science.gov (United States)

    D'Anna, G.; Indenbom, M. V.; André, M.-O.; Benoit, W.; Grivel, J.-C.; Hensel, B.; Flükiger, R.

    1994-05-01

    A double peak structure is observed in the AC losses of (Bi,Pb) 2Sr 2Ca 2Cu 3O x silver-sheathed tapes using a torsion-pendulum oscillator. The low-temperature peak is associated to the intragrain flux expulsion, while the high-temperature peak results from a macroscopic current path around the whole sample due to a well-coupled fraction of the grains. The flux pinning by the dislocations forming small-angle grain boundaries is suggested to control the transport current.

  10. A direct power conversion topology for grid integrations of hybrid AC/DC resources

    DEFF Research Database (Denmark)

    Liu, Xiong; Loh, Poh Chiang; Wang, Peng

    2012-01-01

    and modulation schemes are proposed to extract the commanded current from the input ac/dc sources to the grid and guarantee high quality ac/dc inputs and ac output current waveforms with unity power factors. The proposed modulation scheme for sinusoidal outputs of the VMC is mathematically proved...

  11. Variation of longshore current and sediment transport along the south Maharashtra coast, west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Chandramohan, P.; SanilKumar, V.; Nayak, B.U.; Pathak, K.C.

    on the field measurements, the estimated longshore sediment transport rates at Ratnagiri, Ambolgarh and Vengurla were 1.19 x 10 super(5), 1.9 x 10 super(5) and 0.53 x 10 super(5) m super(3) y/1 respectively and the direction was southward. Significance of field...

  12. Multicomponent ion transport in a mono and bilayer cation-exchange membrane at high current density

    NARCIS (Netherlands)

    Moshtari Khah, S.; Oppers, N.A.W.; de Groot, M.T.; Keurentjes, J.T.F.; Schouten, J.C.; van der Schaaf, J.

    2017-01-01

    This work describes a model for bilayer cation-exchange membranes used in the chlor-alkali process. The ion transport inside the membrane is modeled with the Nernst–Planck equation. A logistic function is used at the boundary between the two layers of the bilayer membrane to describe the change in

  13. Continuous weighing of conveyor-transported materials based on gamma radiation conversion to electric current

    International Nuclear Information System (INIS)

    The principle is described of the continuous weighing of conveyer-transported materials applied in the food industry. The weighing technique is based on the measurement of the absorption of gamma radiation emitted by a source located behind the material to be scaled. (Z.M.)

  14. Border-wide assessment of intelligent transportation system (ITS) technology : current and future concepts.

    Science.gov (United States)

    2012-07-01

    The purpose of this effort was to conduct a border-wide assessment of the use of intelligent transportation systems (ITS) technologies and operational concepts at and near land border crossings between the U.S. and Mexico. The work focused on tolling...

  15. Lead emissions from road transport in Europe. A revision of current estimates using various estimation methodologies

    NARCIS (Netherlands)

    Denier van der Gon, H.A.C.; Appelman, W.

    2009-01-01

    Large-scale use of leaded gasoline was an important source of the neurotoxin lead in the European environment. After a sequence of regulations on the allowed gasoline lead content and, eventually, a ban on the use of lead additives in gasoline, road transport was no longer considered a source of

  16. A Numerical Modeling Framework for Cohesive Sediment Transport Driven by Waves and Tidal Currents

    Science.gov (United States)

    2012-09-30

    for sediment transport. The successful extension to multi-dimensions is benefited from an open-source CFD package, OpenFOAM (www.openfoam.org). This...linz.at/Drupal/), which couples the fluid solver OpenFOAM with the Discrete Element Model (DEM) solver LIGGGHTS (an improved LAMMPS for granular flow

  17. Transport and Use of Bicarbonate in Plants: Current Knowledge and Challenges Ahead

    Directory of Open Access Journals (Sweden)

    Charlotte Poschenrieder

    2018-05-01

    Full Text Available Bicarbonate plays a fundamental role in the cell pH status in all organisms. In autotrophs, HCO3− may further contribute to carbon concentration mechanisms (CCM. This is especially relevant in the CO2-poor habitats of cyanobacteria, aquatic microalgae, and macrophytes. Photosynthesis of terrestrial plants can also benefit from CCM as evidenced by the evolution of C4 and Crassulacean Acid Metabolism (CAM. The presence of HCO3− in all organisms leads to more questions regarding the mechanisms of uptake and membrane transport in these different biological systems. This review aims to provide an overview of the transport and metabolic processes related to HCO3− in microalgae, macroalgae, seagrasses, and terrestrial plants. HCO3− transport in cyanobacteria and human cells is much better documented and is included for comparison. We further comment on the metabolic roles of HCO3− in plants by focusing on the diversity and functions of carbonic anhydrases and PEP carboxylases as well as on the signaling role of CO2/HCO3− in stomatal guard cells. Plant responses to excess soil HCO3− is briefly addressed. In conclusion, there are still considerable gaps in our knowledge of HCO3− uptake and transport in plants that hamper the development of breeding strategies for both more efficient CCM and better HCO3− tolerance in crop plants.

  18. Transport and Use of Bicarbonate in Plants: Current Knowledge and Challenges Ahead.

    Science.gov (United States)

    Poschenrieder, Charlotte; Fernández, José Antonio; Rubio, Lourdes; Pérez, Laura; Terés, Joana; Barceló, Juan

    2018-05-03

    Bicarbonate plays a fundamental role in the cell pH status in all organisms. In autotrophs, HCO₃ − may further contribute to carbon concentration mechanisms (CCM). This is especially relevant in the CO₂-poor habitats of cyanobacteria, aquatic microalgae, and macrophytes. Photosynthesis of terrestrial plants can also benefit from CCM as evidenced by the evolution of C₄ and Crassulacean Acid Metabolism (CAM). The presence of HCO₃ − in all organisms leads to more questions regarding the mechanisms of uptake and membrane transport in these different biological systems. This review aims to provide an overview of the transport and metabolic processes related to HCO₃ − in microalgae, macroalgae, seagrasses, and terrestrial plants. HCO₃ − transport in cyanobacteria and human cells is much better documented and is included for comparison. We further comment on the metabolic roles of HCO₃ − in plants by focusing on the diversity and functions of carbonic anhydrases and PEP carboxylases as well as on the signaling role of CO₂/HCO₃ − in stomatal guard cells. Plant responses to excess soil HCO₃ − is briefly addressed. In conclusion, there are still considerable gaps in our knowledge of HCO₃ − uptake and transport in plants that hamper the development of breeding strategies for both more efficient CCM and better HCO₃ − tolerance in crop plants.

  19. Specific transport and storage solutions: Waste management facing current and future stakes of the nuclear fuel cycle

    International Nuclear Information System (INIS)

    Deniau, Helene; Gagner, Laurent; Gendreau, Francoise; Presta, Anne

    2006-01-01

    With major projects ongoing or being planned, and also with the daily management of radioactive waste from nuclear facilities, the role of transport and/or storage packaging has been often overlooked. Indeed, the packaging development process and transport solutions implemented are a key part of the waste management challenge: protection of people and environment. During over four decades, the AREVA Group has developed a complete and coherent system for the transport of waste produced by nuclear industries. The transport solutions integrate the factors to consider, as industrial transportation needs, various waste forms, associated hazards and current regulations. Thus, COGEMA LOGISTICS has designed, licensed and manufactured a large number of different transport, storage and dual purpose cask models for residues and all kinds of radioactive wastes. The present paper proposes to illustrate how a company acting both as a cask designer and a carrier is key to the waste management issue and how it can support the waste management policy of nuclear producers through their operational choices. We will focus on the COGEMA LOGISTICS technical solutions implemented to guarantee safe and secure transportation and storage solutions. We will describe different aspects of the cask design process, insisting on how it enables to fulfill both customer needs and regulation requirements. We will also mention the associated services developed by the AREVA Business Unit Logistics (COGEMA LOGISTICS, TRANSNUCLEAR, MAINCO, and LEMARECHAL CELESTIN) in order to manage transportation of liquid and solid waste towards interim or final storage sites. The paper has the following contents: About radioactive waste; - Radioactive waste classification; - High level activity waste and long-lived intermediate level waste; - Long-lived low level waste; - Short-lived low- and intermediate level waste; - Very low level waste; - The radioactive waste in nuclear fuel cycle; - Packaging design and

  20. Critical current and electric transport properties of superconducting epitaxial Nb(Ti)N submicron structures

    Science.gov (United States)

    Klimov, A.; Słysz, W.; Guziewicz, M.; Kolkovsky, V.; Wegrzecki, M.; Bar, J.; Marchewka, M.; Seredyński, B.

    2016-12-01

    Critical current and current-voltage characteristics of epitaxial Nb(Ti)N submicron ultrathin structures were measured as function of temperature. For 700-nm-wide bridge we found current-driven vortex de-pinning at low temperatures and thermally activated flux flow closer to the transition temperature, as the limiting factors for the critical current density. For 100-nm-wide meander we observed combination of phase-slip activation and vortex-anti-vortex pair (VAP) thermal excitation. Our Nb(Ti)N meander structure demonstrates high de-pairing critical current densities 107 A/cm2 at low temperatures, but the critical currents are much smaller due to presence of the local constrictions.

  1. Study of dependence upon the magnetic field and transport current of the magnetoresistive effect in YBCO-based bulk composites

    International Nuclear Information System (INIS)

    Balaev, D A; Prus, A G; Shaykhutdinov, K A; Gokhfeld, D M; Petrov, M I

    2007-01-01

    The magnetoresistive properties of bulk YBCO + CuO and YBCO+BaPb 0.75 Sn 0.25 O 3 composites for different orientations of external magnetic field H and macroscopic transport current j have been measured. These composites exhibit large magnetoresistance in weak magnetic fields ( 2 θ. This fact suggests that the flux flow in the intergrain boundaries is responsible for the large magnetoresistive effect observed in the composites

  2. Theory of flux cutting and flux transport at the critical current of a type-II superconducting cylindrical wire

    International Nuclear Information System (INIS)

    Clem, John R.

    2011-01-01

    I introduce a critical-state theory incorporating both flux cutting and flux transport to calculate the magnetic-field and current-density distributions inside a type-II superconducting cylinder at its critical current in a longitudinal applied magnetic field. The theory is an extension of the elliptic critical-state model introduced by Romero-Salazar and Perez-Rodriguez. The vortex dynamics depend in detail on two nonlinear effective resistivities for flux cutting (ρ(parallel)) and flux flow (ρ(perpendicular)), and their ratio r = ρ(parallel)/ρ(perpendicular). When r c (φ) that makes the vortex arc unstable.

  3. Low ac loss geometries in YBCO coated conductors

    International Nuclear Information System (INIS)

    Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

    2007-01-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

  4. Low ac loss geometries in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

    2007-10-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

  5. Measurements of the momentum and current transport from tearing instability in the Madison Symmetric Torus reversed-field pinch

    International Nuclear Information System (INIS)

    Kuritsyn, A.; Fiksel, G.; Almagri, A. F.; Miller, M. C.; Mirnov, V. V.; Prager, S. C.; Sarff, J. S.; Brower, D. L.; Ding, W. X.

    2009-01-01

    In this paper measurements of momentum and current transport caused by current driven tearing instability are reported. The measurements are done in the Madison Symmetric Torus reversed-field pinch [R. N. Dexter, D. W. Kerst, T. W. Lovell, S. C. Prager, and J. C. Sprott, Fusion Technol. 19, 131 (1991)] in a regime with repetitive bursts of tearing instability causing magnetic field reconnection. It is established that the plasma parallel momentum profile flattens during these reconnection events: The flow decreases in the core and increases at the edge. The momentum relaxation phenomenon is similar in nature to the well established relaxation of the parallel electrical current and could be a general feature of self-organized systems. The measured fluctuation-induced Maxwell and Reynolds stresses, which govern the dynamics of plasma flow, are large and almost balance each other such that their difference is approximately equal to the rate of change of plasma momentum. The Hall dynamo, which is directly related to the Maxwell stress, drives the parallel current profile relaxation at resonant surfaces at the reconnection events. These results qualitatively agree with analytical calculations and numerical simulations. It is plausible that current-driven instabilities can be responsible for momentum transport in other laboratory and astrophysical plasmas.

  6. Current and future energy and exergy efficiencies in the Iran’s transportation sector

    International Nuclear Information System (INIS)

    Zarifi, F.; Mahlia, T.M.I.; Motasemi, F.; Shekarchian, M.; Moghavvemi, M.

    2013-01-01

    Highlights: • The overall energy and exergy efficiencies of the sector were calculated. • The overall efficiencies were compared to other countries. • The overall energy and exergy efficiencies have been predicted by scenario approach. • A summary of recommendations to improve the sector is provided. - Abstract: Transportation is the second largest energy consumer sector in Iran which accounts for 24% of total energy consumption in 2009. This large percentage (almost a quarter) of energy consumption necessitates the determination of energy and exergy flows and their respective losses, which will enable the reduction of both energy growth and its consequent environmental impacts in the near future. This paper attempts to analyze and investigate the energy and exergy utilization of the transportation sector in Iran for the period of 1998–2009. Additionally, the total energy consumption in each subsector and the overall energy and exergy efficiencies are predicted via scenario approach. A comparison of the overall energy and exergy efficiencies of Iran with six other countries is also presented. The results show that the overall energy and exergy efficiencies of transportation sector in Iran is higher than China and Norway, while it is lower than Saudi Arabia, Jordan, Turkey, and Malaysia for the year 2000. Road appears to be the most efficient subsector. The overall energy efficiency is determined to be in the range of 22.02% in 1998, to 21.49% in 2009, while the overall exergy efficiency is determine to be in the range of 21.47% in 1998, to 21.19% in 2009. The energy consumption in each subsector is predicted from 2010 to 2035. It was discovered that the overall energy and exergy efficiencies possesses an upward trend during this time period. Finally, some recommendations vis-à-vis the improvement of the energy and exergy efficiencies in Iranian transportation sector in the future was provided and duly discussed

  7. Waves, currents and sediment transport modelling at the Wave Hub site

    OpenAIRE

    Gonzalez-Santamaria, Raul

    2013-01-01

    Primary supervisory team: Qingping Zou and Shunqi Pan This research project uses an integrated modelling system to investigate the effects of a wave farm on nearshore sediment transport at the Wave Hub site. The Wave Hub project is a large scale demonstration site for the development of the operation of arrays of wave energy generation devices located at the southwest coast of the UK where multiple field measurements took place. Particular attention of this study was paid to th...

  8. Assessment of existing sediment transport models for sand barrier dynamics under wave and currents

    Digital Repository Service at National Institute of Oceanography (India)

    Thuy, T.T.V.; Nghiem, L.T.; Jayakumar, S.; Nielsen, P.

    The paper summarizes morphology changes over rippled sand barriers under wave and wave combined current of 27 laboratorial experiments. Data of 4 wave conditions (H=10cm, T=1s; H=12cm, T=1s; H=12cm, T=1.5s; H=14cm, T=1.5s) and 6 currents (Q= 10, -10...

  9. Device for plasma confinement and heating by high currents and nonclassical plasma transport properties

    Science.gov (United States)

    Coppi, B.; Montgomery, D.B.

    1973-12-11

    A toroidal plasma containment device having means for inducing high total plasma currents and current densities and at the same time emhanced plasma heating, strong magnetic confinement, high energy density containment, magnetic modulation, microwaveinduced heating, and diagnostic accessibility is described. (Official Gazette)

  10. Scaling Effect of Phosphorene Nanoribbon - Uncovering the Origin of Asymmetric Current Transport

    Science.gov (United States)

    Lv, Yawei; Chang, Sheng; Huang, Qijun; Wang, Hao; He, Jin

    2016-01-01

    In this paper, phosphorene nanoribbons (PNRs) are theoretically studied using a multiscale simulation flow from the ab initio level to the tight binding (TB) level. The scaling effects of both armchair PNRs (aPNRs) and zigzag PNRs (zPNRs) from material properties to device properties are explored. The much larger effective mass of holes compared to that of electrons in zPNR is responsible for its asymmetric transport. However, in aPNR, not only the effective mass difference but also the non-equal density of state (DOS) distributions near valence band maximum (VBM) and conduction band minimum (CBM) lead to the asymmetric transport. This non-equal distribution phenomenon is caused by energy band degeneracies near the VBM. Based on these two different mechanisms, PNRs’ asymmetric transport characteristics at the device level are explained, and it is shown that this behaviour can be ameliorated well by reducing the ribbon width in an aPNR MOSFET. Calculation results also indicate that aPNR’s effective mass is comparable to that of a graphene nanoribbon (GNR) at the same bandgap; however, aPNR’s band gap variation is more stable and regular than that of GNR, making it a good candidate for use in low-dimensional nano devices. PMID:27897230

  11. THE MATHEMATIC STIMULATION OF TRANSIENT PROCESS IN A.C. – SYSTEM “ELECTRIC-TRACTION NETWORK – LOCOMOTIVE” 3. SWITCHING ON MAIN POWER CONVERTER IN “FREE PLAY” MODE; THE ANALYSIS OF VOLTS AND CURRENTS IN THE POWER SUPPLY INPUT SYSTEM

    Directory of Open Access Journals (Sweden)

    T. M. Mischenko

    2011-05-01

    Full Text Available The article is a continuation of analysis of the electric equivalent AC circuit «traction substation − device of transversal compensation − electric-traction network − electric locomotive DS 3» and the influence on a power transformer in the idle mode, depending on the feeder voltage and the distance of an electric locomotive from a traction substation. The numeral calculations are performed and the voltage and current values in the electric power supply system are analyzed.

  12. THE MATHEMATIC STIMULATION OF TRANSIENT PROCESS IN A.C. – SYSTEM “ELECTRIC-TRACTION NETWORK – LOCOMOTIVE” 3. SWITCHING ON MAIN POWER CONVERTER IN “FREE PLAY” MODE; THE ANALYSIS OF VOLTS AND CURRENTS IN THE POWER SUPPLY INPUT SYSTEM

    OpenAIRE

    T. M. Mischenko

    2011-01-01

    The article is a continuation of analysis of the electric equivalent AC circuit «traction substation − device of transversal compensation − electric-traction network − electric locomotive DS 3» and the influence on a power transformer in the idle mode, depending on the feeder voltage and the distance of an electric locomotive from a traction substation. The numeral calculations are performed and the voltage and current values in the electric power supply system are analyzed.

  13. ACS sampling system: design, implementation, and performance evaluation

    Science.gov (United States)

    Di Marcantonio, Paolo; Cirami, Roberto; Chiozzi, Gianluca

    2004-09-01

    By means of ACS (ALMA Common Software) framework we designed and implemented a sampling system which allows sampling of every Characteristic Component Property with a specific, user-defined, sustained frequency limited only by the hardware. Collected data are sent to various clients (one or more Java plotting widgets, a dedicated GUI or a COTS application) using the ACS/CORBA Notification Channel. The data transport is optimized: samples are cached locally and sent in packets with a lower and user-defined frequency to keep network load under control. Simultaneous sampling of the Properties of different Components is also possible. Together with the design and implementation issues we present the performance of the sampling system evaluated on two different platforms: on a VME based system using VxWorks RTOS (currently adopted by ALMA) and on a PC/104+ embedded platform using Red Hat 9 Linux operating system. The PC/104+ solution offers, as an alternative, a low cost PC compatible hardware environment with free and open operating system.

  14. Transportation

    National Research Council Canada - National Science Library

    Adams, James; Carr, Ron; Chebl, Maroun; Coleman, Robert; Costantini, William; Cox, Robert; Dial, William; Jenkins, Robert; McGovern, James; Mueller, Peter

    2006-01-01

    ...., trains, ships, etc.) and maximizing intermodal efficiency. A healthy balance must be achieved between the flow of international commerce and security requirements regardless of transportation mode...

  15. Transient analysis of carbon monoxide transport phenomena and adsorption kinetics in HT-PEMFC during dynamic current extraction

    International Nuclear Information System (INIS)

    Raj, Kamal Abdul Rasheedj; Chan, Siew Hwa

    2015-01-01

    Highlights: • Increasing the fuel cell temperature reduces outlet CO concentration. • Increasing the CO inlet (initial) concentration increases outlet CO concentration. • Increasing current density step and dwell time increases outlet CO concentration. • Increasing in the CL and GDL porosities reduces outlet CO concentration. - Abstract: This paper investigates the transport phenomena of carbon monoxide (CO) and adsorption kinetics, in a high-temperature proton exchange membrane fuel cell (HT-PEMFC) during step-wise current extraction (step-change in current extraction). Step-wise current extraction is a common process done to accommodate a sudden power surge during an operation. Since HT-PEMFCs are capable of handling high impurity of CO, hydrogen fuel that is contaminated with trace amount of CO is usually considered for commercial benefits. Thus, a transient three-dimensional isothermal anodic electro-kinetic numerical model is developed to determine the effect of operating parameters such as fuel cell temperature, CO inlet (initial) concentration, step-change of current density and dwell time on the transport phenomena of CO and adsorption kinetics. In addition, geometrical factors such as the catalyst layer (CL) and gas diffusion layer (GDL) porosity are also varied as well. The results show that the above-mentioned operating parameters can affect the maximum CO concentration at the CL, especially at the outlet of the channel. Specifically, a reduction of fuel cell temperature can significantly increase the CO concentration near the outlet, while increasing CO inlet (initial) concentration, step-change amplitude of current density and current density dwell time can cause an increase in CO concentration at the outlet, albeit to different extent. In addition, the increase in the porosity of CL and GDL, results in the reduction of the maximum CO concentration at the outlet, albeit to different extent. In addition, the CO and hydrogen surface coverage

  16. Numerical Analysis of Surge Phenomena, Currents, and Pollution Transport in the Sea of Azov

    Science.gov (United States)

    Ivanov, V. A.; Shul'ga, T. Ya.

    2018-04-01

    Dynamic processes and features of transformation of pollution in the Sea of Azov, caused by the action of a real wind and atmospheric pressure in the presence of stationary currents, are studied using a three-dimensional nonlinear hydrodynamic model. On the basis of numerical calculations, conclusions are reached about the influence of the velocities of stationary background currents on maximal deviations and the velocities of nonstationary currents generated by wind fields in the SKIRON model. It is shown that the combined effect of the constant wind and wind in the SKIRON atmospheric model leads to a significant expansion of the polluted area and to a longer dispersion time compared to the effects of solely stationary currents.

  17. Transport routes of metalloids into and out of the cell: a review of the current knowledge.

    Science.gov (United States)

    Zangi, Ronen; Filella, Montserrat

    2012-04-15

    Except for their extra- and intra-cellular interfaces, cell membranes are hydrophobic and inhibit the transport of hydrophilic molecules. Metalloids in aqueous solutions form chemical species with oxygen and hydroxyl groups and, therefore, exist as hydrophilic neutral polar solutes or as hydrophilic anions. This characteristic of metalloids introduces a large barrier for their passage through the cell membrane via unaided diffusion. The necessity for an uptake mechanism for metalloids arises from the requirement of these species for the maintenance of life, such as the need of boron for plant cells. Conversely, the transport of these species out of the cell is necessary because some metalloids are toxic, such as arsenic and antimony, and their entrance into the cell is undesirable. The undesired uptake of these toxic species is possible via pathways designed for the uptake of other structurally and chemically similar essential compounds. Therefore, the extrusion of arsenic and antimony out of the cell is an example of a detoxification mechanism. As a consequence of the hydrophobic character of the cell membrane in all living systems, the main route for the uptake and efflux of metalloids is facilitated by transmembrane proteins, driven either by concentration gradients or by energy-fueled pumps. However, metalloids forming or embedded in nano-sized particles escape the need to cross the cell membrane because these particles can be taken into the cell by endocytosis. Here, we review the uptake and efflux pathways of boron, silicon, arsenic, and antimony through the cell membranes of different organisms and the protein channels involved in these processes. In particular, passive diffusion via aquaglyceroporins, active transport via primary and secondary ion pumps, extrusion into vacuoles of metalloid-thiol conjugates via ATP-binding cassette, the efflux of methylated metalloids, and endocytosis are summarized. Copyright © 2012 Elsevier Ireland Ltd. All rights

  18. Forward Current Transport Mechanisms of Ni/Au—InAlN/AlN/GaN Schottky Diodes

    Science.gov (United States)

    Wang, Xiao-Feng; Shao, Zhen-Guang; Chen, Dun-Jun; Lu, Hai; Zhang, Rong; Zheng, You-Dou

    2014-05-01

    We fabricate two Ni/Au-In0.17Al0.83N/AlN/GaN Schottky diodes on substrates of sapphire and Si, respectively, and investigate their forward-bias current transport mechanisms by temperature-dependent current-voltage measurements. In the temperature range of 300-485 K, the Schottky barrier heights (SBHs) calculated by using the conventional thermionic-emission (TE) model are strongly positively dependent on temperature, which is in contrast to the negative-temperature-dependent characteristic of traditional semiconductor Schottky diodes. By fitting the forward-bias I-V characteristics using different current transport models, we find that the tunneling current model can describe generally the I-V behaviors in the entire measured range of temperature. Under the high forward bias, the traditional TE mechanism also gives a good fit to the measured I-V data, and the actual barrier heights calculated according to the fitting TE curve are 1.434 and 1.413 eV at 300K for InAlN/AlN/GaN Schottky diodes on Si and the sapphire substrate, respectively, and the barrier height shows a slightly negative temperature coefficient. In addition, a formula is given to estimate SBHs of Ni/Au—InAlN/AlN/GaN Schottky diodes taking the Fermi-level pinning effect into account.

  19. Beam instability during high-current heavy-ion beam transport

    International Nuclear Information System (INIS)

    Kikuchi, T.; Someya, T.; Kawata, S.; Nakajima, M.; Horioka, K.

    2005-01-01

    In driver system for heavy ion inertial fusion, beam dynamics is investigated by particle-in-cell simulations during final beam bunching. The particle simulations predict that the beam is transported with the localized transverse charge distribution induced by the strong space charge effect. The calculation results also show that the emittance growth during the longitudinal bunch compression for various particle distributions at the initial conditions and with two types of transverse focusing model, which are a continuous focusing and an alternating gradient focusing lattice configurations. (author)

  20. Transportation

    International Nuclear Information System (INIS)

    Anon.

    1998-01-01

    Here is the decree of the thirtieth of July 1998 relative to road transportation, to trade and brokerage of wastes. It requires to firms which carry out a road transportation as well as to traders and to brokers of wastes to declare their operations to the prefect. The declaration has to be renewed every five years. (O.M.)

  1. Dependence of helium transport on plasma current and ELM frequency in H-mode discharges in DIII-D

    International Nuclear Information System (INIS)

    Wade, M.R.; Hillis, D.L.; Hogan, J.T.; Finkenthal, D.F.; West, W.P.; Burrell, K.H.; Seraydarian, R.P.

    1993-05-01

    The removal of helium (He) ash from the plasma core with high efficiency to prevent dilution of the D-T fuel mixture is of utmost importance for future fusion devices, such as the International Thermonuclear Experimental Reactor (ITER). A variety of measurements in L-mode conditions have shown that the intrinsic level of helium transport from the core to the edge may be sufficient to prevent sufficient dilution (i.e., τ He /τ E < 5). Preliminary measurements in biased-induced, limited H-mode discharges in TEXTOR suggest that the intrinsic helium transport properties may not be as favorable. If this trend is shown also in diverted H-mode plasmas, then scenarios based on ELMing H-modes would be less desirable. To further establish the database on helium transport in H-mode conditions, recent studies on the DIII-D tokamak have focused on determining helium transport properties in H-mode conditions and the dependence of these properties on plasma current and ELM frequency

  2. Intracellular Na+ concentration influences short-term plasticity of glutamate transporter-mediated currents in neocortical astrocytes.

    Science.gov (United States)

    Unichenko, Petr; Myakhar, Olga; Kirischuk, Sergei

    2012-04-01

    Fast synaptic transmission requires a rapid clearance of the released neurotransmitter from the extracellular space. Glial glutamate transporters (excitatory amino acid transporters, EAATs) strongly contribute to glutamate removal. In this work, we investigated the paired-pulse plasticity of synaptically activated, glutamate transporter-mediated currents (STCs) in cortical layer 2/3 astrocytes. STCs were elicited by local electrical stimulation in layer 4 in the presence of ionotropic glutamate (AMPA and NMDA), GABAA, and GABAB receptor antagonists. In experiments with low [Na(+)]i (5 mM) intrapipette solution, STCs elicited by paired-pulse stimulation demonstrated paired-pulse facilitation (PPF) at short (astrocytic [Na(+)]i, reduced the mean STC amplitude, decreased PPF at short ISIs, and slowed STC kinetics. All GABA-induced changes were blocked by NO-711 and SNAP-5114, GABA transporter (GATs) antagonists. In experiments with the low intrapipette solution, GAT blockade under control conditions decreased PPF at short ISIs both at room and at near physiological temperatures. Dialysis of single astrocyte with low [Na(+)]i solution increased the amplitude and reduced PPR of evoked field potentials recorded in the vicinity of the astrocyte. We conclude that (1) endogenous GABA via GATs may influence EAAT functioning and (2) astrocytic [Na(+)]i modulates the short-term plasticity of STCs and in turn the efficacy of glutamate removal. Copyright © 2012 Wiley Periodicals, Inc.

  3. Colloid-Facilitated Radionuclide Transport: Current State of Knowledge from a Nuclear Waste Repository Risk Assessment Perspective

    International Nuclear Information System (INIS)

    Reimus, Paul William; Zavarin, Mavrik; Wang, Yifeng

    2017-01-01

    This report provides an overview of the current state of knowledge of colloid-facilitated radionuclide transport from a nuclear waste repository risk assessment perspective. It draws on work that has been conducted over the past 3 decades, although there is considerable emphasis given to work that has been performed over the past 3-5 years as part of the DOE Used Fuel Disposition Campaign. The timing of this report coincides with the completion of a 3-year DOE membership in the Colloids Formation and Migration (CFM) partnership, an international collaboration of scientists studying colloid-facilitated transport of radionuclides at both the laboratory and field-scales in a fractured crystalline granodiorite at the Grimsel Test Site in Switzerland. This Underground Research Laboratory has hosted the most extensive and carefully-controlled set of colloid-facilitated solute transport experiments that have ever been conducted in an in-situ setting, and a summary of the results to date from these efforts, as they relate to transport over long time and distance scales, is provided in Chapter 3 of this report.

  4. Colloid-Facilitated Radionuclide Transport: Current State of Knowledge from a Nuclear Waste Repository Risk Assessment Perspective

    Energy Technology Data Exchange (ETDEWEB)

    Reimus, Paul William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Zavarin, Mavrik [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Wang, Yifeng [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-01-25

    This report provides an overview of the current state of knowledge of colloid-facilitated radionuclide transport from a nuclear waste repository risk assessment perspective. It draws on work that has been conducted over the past 3 decades, although there is considerable emphasis given to work that has been performed over the past 3-5 years as part of the DOE Used Fuel Disposition Campaign. The timing of this report coincides with the completion of a 3-year DOE membership in the Colloids Formation and Migration (CFM) partnership, an international collaboration of scientists studying colloid-facilitated transport of radionuclides at both the laboratory and field-scales in a fractured crystalline granodiorite at the Grimsel Test Site in Switzerland. This Underground Research Laboratory has hosted the most extensive and carefully-controlled set of colloid-facilitated solute transport experiments that have ever been conducted in an in-situ setting, and a summary of the results to date from these efforts, as they relate to transport over long time and distance scales, is provided in Chapter 3 of this report.

  5. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan

    2015-01-01

    Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received

  6. Carrier Transport of Silver Nanowire Contact to p-GaN and its Influence on Leakage Current of LEDs

    Science.gov (United States)

    Oh, Munsik; Kang, Jae-Wook; Kim, Hyunsoo

    2018-03-01

    The authors investigated the silver nanowires (AgNWs) contact formed on p-GaN. Transmission line model applied to the AgNWs contact to p-GaN produced near ohmic contact with a specific contact resistance (ρ sc) of 10-1˜10-4 Ω·cm2. Noticeably, the contact resistance had a strong bias-voltage (or current-density) dependence associated with a local joule heating effect. Current-voltage-temperature (I-V-T) measurement revealed a strong temperature dependence with respect to ρ sc, indicating that the temperature played a key role of an enhanced carrier transport. The local joule heating at AgNW/GaN interface, however, resulted in a generation of leakage current of light-emitting diodes (LEDs) caused by degradation of AgNW contact.

  7. Transport spin dependent in nanostructures: Current and geometry effect of quantum dots in presence of spin-orbit interaction

    Science.gov (United States)

    Paredes-Gutiérrez, H.; Pérez-Merchancano, S. T.; Beltran-Rios, C. L.

    2017-12-01

    In this work, we study the quantum electron transport through a Quantum Dots Structure (QDs), with different geometries, embedded in a Quantum Well (QW). The behaviour of the current through the nanostructure (dot and well) is studied considering the orbital spin coupling of the electrons and the Rashba effect, by means of the second quantization theory and the standard model of Green’s functions. Our results show the behaviour of the current in the quantum system as a function of the electric field, presenting resonant states for specific values of both the external field and the spin polarization. Similarly, the behaviour of the current on the nanostructure changes when the geometry of the QD and the size of the same are modified as a function of the polarization of the electron spin and the potential of quantum confinement.

  8. Current transport studies of ZnO/p-Si heterostructures grown by plasma immersion ion implantation and deposition

    International Nuclear Information System (INIS)

    Chen, X.D.; Ling, C.C.; Fung, S.; Beling, C.D.; Mei, Y.F.; Fu, Ricky K.Y.; Siu, G.G.; Chu, Paul K.

    2006-01-01

    Rectifying undoped and nitrogen-doped ZnO/p-Si heterojunctions were fabricated by plasma immersion ion implantation and deposition. The undoped and nitrogen-doped ZnO films were n type (n∼10 19 cm -3 ) and highly resistive (resistivity ∼10 5 Ω cm), respectively. While forward biasing the undoped-ZnO/p-Si, the current follows Ohmic behavior if the applied bias V forward is larger than ∼0.4 V. However, for the nitrogen-doped-ZnO/p-Si sample, the current is Ohmic for V forward 2 for V forward >2.5 V. The transport properties of the undoped-ZnO/p-Si and the N-doped-ZnO/p-Si diodes were explained in terms of the Anderson model and the space charge limited current model, respectively

  9. Mass transport and the bootstrap current from Ohm's law in steady-state tokamaks

    International Nuclear Information System (INIS)

    Kim, J.-S.; Greene, J.M.

    1989-01-01

    The consequences of mass conservation and Ohm's law are examined for steady state Tokamaks. In a Tokamak, magnetofluid-dynamic waves rapidly equilibrate pressure and toroidal field along magnetic surfaces. As a result, the detailed current distribution is determined by the flux surface averaged poloidal and toroidal currents. The electrons that carry the plasma current are impeded in their motion by interactions with ions, which is resistivity and its generalizations, and by interactions with electrons, which is viscosity and its generalizations. The important viscous terms arise from the interaction between trapped and untrapped electrons, and so viscosity acts by impeding poloidal current. properly chosen, the results of neoclassical theory are The neoclassical viscous coefficient is here regarded as less likely than Spitzer conductivity to be experimentally relevant in a turbulent Tokamak. Thus, the toroidal Ohm's law is regarded as being more reliable than the poloidal Ohm's law. A combination of toroidal and poloidal Ohm's law, namely the component parallel to the magnetic field, eliminates the influence of plasma fueling, and directly relates the bootstrap current and the pressure gradient. The latter is the usual relation, but, since i

  10. Analysis of Input and Output Ripples of PWM AC Choppers

    Directory of Open Access Journals (Sweden)

    Pekik Argo Dahono

    2008-11-01

    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  11. Introduction to AC machine design

    CERN Document Server

    Lipo, Thomas A

    2018-01-01

    AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

  12. Generation and transportation of low-energy, high-current electron beams

    International Nuclear Information System (INIS)

    Ozur, G.E.; Proskurovskij, D.I.; Nazarov, D.S.

    1996-01-01

    Experimental data on the production of low-energy, high-current electron beams in a plasma-filled diode are presented. The highest beam energy density achieved is about 40 J/cm 2 , which makes it possible to treat materials in the mode of intense evaporation of the surface layer. It was shown that the use of a hollow cathode improves the beam homogeneity. The feasibility was demonstrated of the production of low-energy high-current electron beams in a gun with plasma anode based on the use of a reflective discharge. (author). 6 figs., 6 refs

  13. Generation and transportation of low-energy, high-current electron beams

    Energy Technology Data Exchange (ETDEWEB)

    Ozur, G E; Proskurovskij, D I; Nazarov, D S [Russian Academy of Sciences, Tomsk (Russian Federation). Institute of High Current Electronics

    1997-12-31

    Experimental data on the production of low-energy, high-current electron beams in a plasma-filled diode are presented. The highest beam energy density achieved is about 40 J/cm{sup 2}, which makes it possible to treat materials in the mode of intense evaporation of the surface layer. It was shown that the use of a hollow cathode improves the beam homogeneity. The feasibility was demonstrated of the production of low-energy high-current electron beams in a gun with plasma anode based on the use of a reflective discharge. (author). 6 figs., 6 refs.

  14. Ballistic current transport studies of ferromagnetic multilayer films and tunnel junctions (invited)

    International Nuclear Information System (INIS)

    Rippard, W. H.; Perrella, A. C.; Buhrman, R. A.

    2001-01-01

    Three applications of ballistic electron microscopy are used to study, with nanometer-scale resolution, the magnetic and electronic properties of magnetic multilayer thin films and tunnel junctions. First, the capabilities of ballistic electron magnetic microscopy are demonstrated through an investigation of the switching behavior of continuous Ni 80 Fe 20 /Cu/Co trilayer films in the presence of an applied magnetic field. Next, the ballistic, hot-electron transport properties of Co films and multilayers formed by thermal evaporation and magnetron sputtering are compared, a comparison which reveals significant differences in the ballistic transmissivity of thin film multilayers formed by the two techniques. Finally, the electronic properties of thin aluminum oxide tunnel junctions formed by thermal evaporation and sputter deposition are investigated. Here the ballistic electron microscopy studies yield a direct measurement of the barrier height of the aluminum oxide barriers, a result that is invariant over a wide range of oxidation conditions. [copyright] 2001 American Institute of Physics

  15. USXR Based MHD, Transport, Equilibria and Current Profile Diagnostics for NSTX. Final Report

    International Nuclear Information System (INIS)

    Finkenthal, Michael

    2009-01-01

    The present report resumes the research activities of the Plasma Spectroscopy/Diagnostics Group at Johns Hopkins University performed on the NSTX tokamak at PPPL during the period 1999-2009. During this period we have designed and implemented XUV based diagnostics for a large number of tasks: study of impurity content and particle transport, MHD activity, time-resolved electron temperature measeurements, ELM research, etc. Both line emission and continuum were used in the XUV range. New technics and novel methods have been devised within the framework of the present research. Graduate and post-graduate students have been involved at all times in addition to the senior research personnel. Several tens of papers have been published and lectures have been given based on the obtained results at conferences and various research institutions (lists of these activities were attached both in each proposal and in the annual reports submitted to our supervisors at OFES)

  16. Current Transport Properties of Monolayer Graphene/n-Si Schottky Diodes

    Science.gov (United States)

    Pathak, C. S.; Garg, Manjari; Singh, J. P.; Singh, R.

    2018-05-01

    The present work reports on the fabrication and the detailed macroscopic and nanoscale electrical characteristics of monolayer graphene/n-Si Schottky diodes. The temperature dependent electrical transport properties of monolayer graphene/n-Si Schottky diodes were investigated. Nanoscale electrical characterizations were carried out using Kelvin probe force microscopy and conducting atomic force microscopy. Most the values of ideality factor and barrier height are found to be in the range of 2.0–4.4 and 0.50–0.70 eV for monolayer graphene/n-Si nanoscale Schottky contacts. The tunneling of electrons is found to be responsible for the high value of ideality factor for nanoscale Schottky contacts.

  17. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  18. Study of tunneling transport in Si-based tunnel field-effect transistors with ON current enhancement utilizing isoelectronic trap

    Science.gov (United States)

    Mori, Takahiro; Morita, Yukinori; Miyata, Noriyuki; Migita, Shinji; Fukuda, Koichi; Mizubayashi, Wataru; Masahara, Meishoku; Yasuda, Tetsuji; Ota, Hiroyuki

    2015-02-01

    The temperature dependence of the tunneling transport characteristics of Si diodes with an isoelectronic impurity has been investigated in order to clarify the mechanism of the ON-current enhancement in Si-based tunnel field-effect transistors (TFETs) utilizing an isoelectronic trap (IET). The Al-N complex impurity was utilized for IET formation. We observed three types of tunneling current components in the diodes: indirect band-to-band tunneling (BTBT), trap-assisted tunneling (TAT), and thermally inactive tunneling. The indirect BTBT and TAT current components can be distinguished with the plot described in this paper. The thermally inactive tunneling current probably originated from tunneling consisting of two paths: tunneling between the valence band and the IET trap and tunneling between the IET trap and the conduction band. The probability of thermally inactive tunneling with the Al-N IET state is higher than the others. Utilization of the thermally inactive tunneling current has a significant effect in enhancing the driving current of Si-based TFETs.

  19. Self-consistent Ginzburg-Landau theory for transport currents in superconductors

    DEFF Research Database (Denmark)

    Ögren, Magnus; Sørensen, Mads Peter; Pedersen, Niels Falsig

    2012-01-01

    We elaborate on boundary conditions for Ginzburg-Landau (GL) theory in the case of external currents. We implement a self-consistent theory within the finite element method (FEM) and present numerical results for a two-dimensional rectangular geometry. We emphasize that our approach can in princi...... in principle also be used for general geometries in three-dimensional superconductors....

  20. Current fluctuations and statistics during a large deviation event in an exactly solvable transport model

    International Nuclear Information System (INIS)

    Hurtado, Pablo I; Garrido, Pedro L

    2009-01-01

    We study the distribution of the time-integrated current in an exactly solvable toy model of heat conduction, both analytically and numerically. The simplicity of the model allows us to derive the full current large deviation function and the system statistics during a large deviation event. In this way we unveil a relation between system statistics at the end of a large deviation event and for intermediate times. The mid-time statistics is independent of the sign of the current, a reflection of the time-reversal symmetry of microscopic dynamics, while the end-time statistics does depend on the current sign, and also on its microscopic definition. We compare our exact results with simulations based on the direct evaluation of large deviation functions, analyzing the finite-size corrections of this simulation method and deriving detailed bounds for its applicability. We also show how the Gallavotti–Cohen fluctuation theorem can be used to determine the range of validity of simulation results

  1. About Claims and Realities of Digitization in Current Maritime Transportation Chains

    DEFF Research Database (Denmark)

    Schramm, Hans-Joachim; Prockl, Günter; Kolar, Petr

    availability of documentary paperwork in some digital form, before we show the current context and status of approaches to digitalize them in paperless trade environments. In sum, our analysis shows huge deficits when it comes on negotiable bills of lading, despite the overall legal foundation enabling...

  2. Charge Transport in Spiro-OMeTAD Investigated through Space-Charge-Limited Current Measurements

    Science.gov (United States)

    Röhr, Jason A.; Shi, Xingyuan; Haque, Saif A.; Kirchartz, Thomas; Nelson, Jenny

    2018-04-01

    Extracting charge-carrier mobilities for organic semiconductors from space-charge-limited conduction measurements is complicated in practice by nonideal factors such as trapping in defects and injection barriers. Here, we show that by allowing the bandlike charge-carrier mobility, trap characteristics, injection barrier heights, and the shunt resistance to vary in a multiple-trapping drift-diffusion model, a numerical fit can be obtained to the entire current density-voltage curve from experimental space-charge-limited current measurements on both symmetric and asymmetric 2 ,2',7 ,7' -tetrakis(N ,N -di-4-methoxyphenylamine)-9 ,9' -spirobifluorene (spiro-OMeTAD) single-carrier devices. This approach yields a bandlike mobility that is more than an order of magnitude higher than the effective mobility obtained using analytical approximations, such as the Mott-Gurney law and the moving-electrode equation. It is also shown that where these analytical approximations require a temperature-dependent effective mobility to achieve fits, the numerical model can yield a temperature-, electric-field-, and charge-carrier-density-independent mobility. Finally, we present an analytical model describing trap-limited current flow through a semiconductor in a symmetric single-carrier device. We compare the obtained charge-carrier mobility and trap characteristics from this analytical model to the results from the numerical model, showing excellent agreement. This work shows the importance of accounting for traps and injection barriers explicitly when analyzing current density-voltage curves from space-charge-limited current measurements.

  3. Current-transport studies and trap extraction of hydrothermally grown ZnO nanotubes using gold Schottky diode

    Energy Technology Data Exchange (ETDEWEB)

    Amin, G.; Hussain, I.; Zaman, S.; Bano, N.; Nur, O.; Willander, M. [Department of Science and Technology, Campus Norrkoeping, Linkoeping University, 60174 Norrkoeping (Sweden)

    2010-03-15

    High-quality zinc oxide (ZnO) nanotubes (NTs) were grown by the hydrothermal technique on n-Si substrate. The room temperature (RT) current-transport mechanisms of Au Schottky diodes fabricated from ZnO NTs and nanorods (NRs) reference samples have been studied and compared. The tunneling mechanisms via deep-level states was found to be the main conduction process at low applied voltage but at the trap-filled limit voltage (V{sub TFL}) all traps were filled and the space-charge-limited current conduction was the dominating current-transport mechanism. The deep-level trap energy and the trap concentration for the NTs were obtained as {proportional_to}0.27 eV and 2.1 x 10{sup 16} cm{sup -3}, respectively. The same parameters were also extracted for the ZnO NRs. The deep-level states observed crossponds to zinc interstitials (Zn{sub i}), which are responsible for the violet emission. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

  4. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  5. Transportation

    National Research Council Canada - National Science Library

    Allshouse, Michael; Armstrong, Frederick Henry; Burns, Stephen; Courts, Michael; Denn, Douglas; Fortunato, Paul; Gettings, Daniel; Hansen, David; Hoffman, D. W; Jones, Robert

    2007-01-01

    .... The ability of the global transportation industry to rapidly move passengers and products from one corner of the globe to another continues to amaze even those wise to the dynamics of such operations...

  6. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

    2009-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

  7. Applications of Bayesian temperature profile reconstruction to automated comparison with heat transport models and uncertainty quantification of current diffusion

    International Nuclear Information System (INIS)

    Irishkin, M.; Imbeaux, F.; Aniel, T.; Artaud, J.F.

    2015-01-01

    Highlights: • We developed a method for automated comparison of experimental data with models. • A unique platform implements Bayesian analysis and integrated modelling tools. • The method is tokamak-generic and is applied to Tore Supra and JET pulses. • Validation of a heat transport model is carried out. • We quantified the uncertainties due to Te profiles in current diffusion simulations. - Abstract: In the context of present and future long pulse tokamak experiments yielding a growing size of measured data per pulse, automating data consistency analysis and comparisons of measurements with models is a critical matter. To address these issues, the present work describes an expert system that carries out in an integrated and fully automated way (i) a reconstruction of plasma profiles from the measurements, using Bayesian analysis (ii) a prediction of the reconstructed quantities, according to some models and (iii) a comparison of the first two steps. The first application shown is devoted to the development of an automated comparison method between the experimental plasma profiles reconstructed using Bayesian methods and time dependent solutions of the transport equations. The method was applied to model validation of a simple heat transport model with three radial shape options. It has been tested on a database of 21 Tore Supra and 14 JET shots. The second application aims at quantifying uncertainties due to the electron temperature profile in current diffusion simulations. A systematic reconstruction of the Ne, Te, Ti profiles was first carried out for all time slices of the pulse. The Bayesian 95% highest probability intervals on the Te profile reconstruction were then used for (i) data consistency check of the flux consumption and (ii) defining a confidence interval for the current profile simulation. The method has been applied to one Tore Supra pulse and one JET pulse.

  8. Transport critical current density and microstructure in extruded YBa2Cu3O7-x wires processed by zone melting

    International Nuclear Information System (INIS)

    Shi, D.; Krishnan, H.; Hong, J.M.; Miller, D.; McGinn, P.J.; Chen, W.H.; Xu, M.; Chen, J.G.; Fang, M.M.; Welp, U.; Lanagan, M.T.; Goretta, K.C.; Dusek, J.T.; Picciolo, J.J.; Balachandran, U.

    1990-01-01

    YBa 2 Cu 3 O 7-x compounds were extruded into long wires with the diameter of 1 mm after sintering. The sintered wires were subsequently zone melted to develop a highly textured microstructure. Magnetization experiments at 77 K indicated a J c value of 1x10 5 A/cm 2 at 1 T. Transport measurements at 77 K showed a greatly enhanced field dependence of the critical current density. Transmission electron microscopy revealed an important grain-boundary feature which eliminated the weak-link behavior. Large amounts of dislocations have also been found in the zone-melted sample which may contribute to flux pinning in the system

  9. Surface potential, charging and local current transport of individual Ge quantum dots grown by molecular beam epitaxy

    Energy Technology Data Exchange (ETDEWEB)

    Singha, R.K. [Department of Physics, Visva-Bharati, Santiniketan 731235 (India); Manna, S.; Bar, R.; Das, S. [Department of Physics, Indian Institute of Technology-Kharagpur, Kharagpur 721302 (India); Ray, S.K., E-mail: physkr@phy.iitkgp.ernet.in [Department of Physics, Indian Institute of Technology-Kharagpur, Kharagpur 721302 (India)

    2017-06-15

    Highlights: We have elaborately explained the individual Ge QD charging phenomena and current transport, which is very important to understand the Ge/Si nano devices. This paper will give a flavor to properly understand these phenomena linked together along with the photocurrent mechanism which is related to the Ge/Si valence band offset. • Both the CAFM and KPFM techniques point out the functionality of doping nature of the underneath Si substrate on the aforementioned characteristics of Ge QDs. • Analysis of the surface potential mapping using KPFM technique yields an approximate valence band offset measurement which is required to understand the intra-valence transition of holes for the realization of long wavelength infrared photodetector. • KPFM and CAFM can be utilized to explore the charging/discharging phenomena of dots and their composition variations. • Current-voltage (I–V) characteristics of the individual Ge QD strongly depends on the individual QD size. • Energy band diagrams for diamond tip and Ge QD shows the higher barrier for electrons and lower barrier for holes allowing the easy tunneling for holes to dominate the transport. - Abstract: It is fundamentally important to understand the nanoscale electronic properties of a single quantum dot (QD) contrary to an ensemble of QDs. Kelvin probe force microscopy (KPFM) and conductive atomic force microscopy (CAFM) are two important tools, which could be employed to probe surface potential, charging phenomena, and current transport mechanism of individual QD. We demonstrate the aforementioned characteristics of self-assembled Ge QDs, which was grown on Si substrates by solid source molecular beam epitaxy driven by the Stranski-Krastanov method. Study reveals that each Ge QD acts as charge storage node even at zero applied bias. The shape, size and density of QDs could be well probed by CAFM and KPFM, whereas QD facets could be better resolved by the conductive tip. The CAFM investigation

  10. Sistema interconectado de canales de marea del estuario de Bahía Blanca, Argentina: evaluación de la circulación de sedimento como carga de fondo por métodos acústicos An interconnected system of tidal channels in Bahia Blanca estuary, Argentina: an evaluation of bedload sediment transport through acoustic methods

    Directory of Open Access Journals (Sweden)

    Silvia S Ginsberg

    2009-01-01

    Full Text Available El estuario de Bahía Blanca, ubicado al sur de la provincia de Buenos Aires (Argentina, constituye una costa baja con extensas llanuras de marea, islas y una compleja red de canales de diferentes magnitudes. Estos últimos integran un sistema de canales interconectados. El objetivo de este trabajo es establecer la circulación sedimentaria como carga de fondo en un sistema de canales interconectados (Cabeza de Buey, El Alambre, La Lista y Principal mediante el análisis de los rasgos morfológicos de fondo, utilizando métodos acústicos (ecosonda y sonar lateral. El canal Cabeza de Buey se comunica con el canal La Lista a través del canal El Alambre. Los dos primeros vierten sus aguas en el canal Principal. El canal Cabeza de Buey posee un lecho plano constituido por material pelítico con arena muy fina. En su tramo más interno se presentan dunas medianas compuestas por arena fina, con un perfil asimétrico según el reflujo. Estas formas, continúan su desarrollo ininterrumpidamente hacia el canal El Alambre, donde se originan dunas grandes (altura 1,5 m formadas por arena muy fina. Sus crestas son sinuosas o barjanoides y poseen su talud hacia la corriente de bajante. En el canal La Lista se determinan dunas asimétricas medianas orientadas según el reflujo y grandes linea-ciones sedimentarias (sand ribbons sobre un fondo consolidado. El sedimento movilizado por la corriente corresponde a la fracción limo-arena fina. La distribución y configuración de las geoformas evidencian que el transporte sedimentario como carga de fondo se concentra principalmente en el canal La Lista. Es así como en el sistema de canales estudiado, sólo un canal de marea regula la dispersión de arena, transportando un importante volumen hacia el canal de navegación.Bahia Blanca estuary located in the south of Buenos Aires province, Argentina, is characterized by a low coastal area with large tidal plains, islands, and a complex network of tidal channels of

  11. AC Josephson effect without superconductivity, and other effects of radio frequency quantum nanoelectronics

    Science.gov (United States)

    Waintal, Xavier; Gaury, Benoit; Weston, Joseph

    With single coherent electron sources and electronic interferometers now available in the lab, the time resolved dynamics of electrons can now be probed directly. I will discuss how a fast raise of voltage propagates inside an electronic interferometer and leads to an oscillating current of well controled frequency. This phenomena is the normal counterpart to the AC josephson effect. I will also briefly advertize our software for computing quantum transport properties, Kwant (http://kwant-project.org) and its time-dependent extension T-Kwant.

  12. A comprehensive analysis of the current and future role of biofuels for transport in the European Union (EU

    Directory of Open Access Journals (Sweden)

    Massimo Raboni1

    2015-01-01

    Full Text Available The production of biofuels is strongly supported all over the world as a renewable energy source for reducing dependence on the unstable oil market. Bioethanol, the main biofuel produced in the world, is widely used to power vehicles in both the USA and Brazil, but concerns exist in both places regarding its sustainability. In Brazil, it is produced from a by-product of the sugar cane industry, while in the USA it is manufactured from food crops. The production of biogas and biodiesel is growing rapidly, but neither has outpaced the production of bioethanol. The European Union (EU is greatly interested in this issue, and in 2011 adopted an extensive strategy to reduce carbon dioxide emissions related to transport by 60% by the year 2050. In order to achieve this result, the current European transportation system must be transformed. This ambitious goal will require the implementation of complex measures including the reduction of fossil fuels in favor of renewable fuels. This program has various options regarding the development of biofuels (e. g., biogas, bioethanol and biodiesel and their related technologies, which are still on trial (mainly regarding the bioethanol production, and must also analyze their sustainability from a social and economic standpoint. The paper discusses the use of biofuels for transport in the European setting, and shows that their sustainability may result in relevant negative social effects due mainly to the use of land for energy crops (e.g., change of food price and world food shortage.

  13. Current Transport Mechanisms and Capacitance Characteristic in the InN/InP Schottky Structures

    Directory of Open Access Journals (Sweden)

    K. AMEUR

    2014-05-01

    Full Text Available In this work, electrical characterization of the current-voltage and capacitance- voltage curves for the Metal/InN/InP Schottky structures are investigated. We have studied electrically thin InN films realized by the nitridation of InP (100 substrates using a Glow Discharge Source (GDS in ultra high vacuum. The I (V curves have exhibited anomalous two-step (kink forward bias behaviour; a suitable fit was only obtained by using a model of two discrete diodes in parallel. Thus, we have calculated, using I(V and C(V curves of Hg/InN/InP Schottky structures, the ideality factor n, the saturation current Is, the barrier height jB, the series resistance Rs, the doping concentration Nd and the diffusion voltage Vd. We have also presented the band diagram of this heterojunction which indicates the presence of a channel formed by holes at the interface InN/InP which explain by the presence of two-dimensional electron gas (2-DEG and this was noticed in the presentation of characteristics C(V.

  14. Transport critical current measurement apparatus using liquid nitrogen cooled high-T(c) superconducting magnet with variable temperature insert.

    Science.gov (United States)

    Nishijima, G; Kitaguchi, H; Tshuchiya, Y; Nishimura, T; Kato, T

    2013-01-01

    We have developed an apparatus to investigate transport critical current (I(c)) as a function of magnetic field and temperature using only liquid nitrogen. The apparatus consists of a (Bi,Pb)(2)Sr(2)Ca(2)Cu(3)O(10) (Bi-2223) superconducting magnet, an outer dewar, and a variable temperature insert (VTI). The magnet, which is operated in depressurized liquid nitrogen, generates magnetic field up to 1.26 T. The sample is also immersed in liquid nitrogen. The pressure in the VTI is controlled from 0.02 to 0.3 MPa, which corresponds to temperature ranging from 66 to 88 K. We have confirmed the long-term stable operation of the Bi-2223 magnet at 1 T. The temperature stability of the sample at high transport current was also demonstrated. The apparatus provides easy-operating I(c) measurement environment for a high-T(c) superconductor up to 500 A in magnetic fields up to 1 T and in temperatures ranging from 66 to 88 K.

  15. Temperature dependent current transport of Pd/ZnO nanowire Schottky diodes

    Science.gov (United States)

    Gayen, R. N.; Bhattacharyya, S. R.; Jana, P.

    2014-09-01

    Zinc oxide (ZnO) nanowire based Schottky barrier diodes are fabricated by depositing Pd metal contact on top of vertically well-aligned ZnO nanowire arrays. A vertical array of ZnO nanowires on indium tin oxide (ITO) coated glass substrates is synthesized by hybrid wet chemical route. Scanning electron microscopy (SEM), x-ray diffraction (XRD) and x-ray photoelectron spectroscopy (XPS) measurement confirm the formation of stoichiometric well-aligned hexagonal (h-ZnO) nanowire arrays with wurtzite structure. Temperature dependent current-voltage (I-V) measurements on palladium-ZnO (Pd/ZnO) nanowire Schottky junctions in the temperature range 303-383 K exhibit excellent rectifying character. From these nonlinear I-V plots, different electrical parameters of diode-like reverse saturation current, barrier height and ideality factor are determined as a function of temperature assuming pure thermionic emission model. The ideality factor is found to decrease while the barrier height increases with the increase in temperature. The series resistance values calculated from Cheung’s functions also show temperature dependency. Such behavior can be attributed to the presence of defects that traps carriers, and barrier height inhomogeneity at the interface of the barrier junction. After barrier height inhomogeneity correction, considering a Gaussian distributed barrier height fluctuation across the Pd/ZnO interface, the estimated values of mean barrier height and modified Richardson constant are more closely matched to the theoretically predicted value for Pd/ZnO Schottky barrier diodes. The variation of density of interface states as a function of interface state energy is also calculated.

  16. 77 FR 38375 - Advisory Circular (AC) 150/5345-53D, Airport Lighting Equipment Certification Program; Proposed...

    Science.gov (United States)

    2012-06-27

    ... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Advisory Circular (AC) 150/5345-53D... Advisory Circular (AC) 150/5345-53D, Airport Lighting Equipment Certification Program, is being circulated... on a separate document and not embedded in the draft AC. Additionally, please provide justification...

  17. Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)

    International Nuclear Information System (INIS)

    Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.

    2007-01-01

    Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured

  18. Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)

    Science.gov (United States)

    Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.

    2007-10-01

    Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured.

  19. AC application of second generation HTS wire

    Science.gov (United States)

    Thieme, C. L. H.; Gagnon, K.; Voccio, J.; Aized, D.; Claassen, J.

    2008-02-01

    For the production of Second Generation (2G) YBCO High Temperature Superconductor wire American Superconductor uses a wide-strip MOD-YBCO/RABiTSTM process, a low-cost approach for commercial manufacturing. It can be engineered with a high degree of flexibility to manufacture practical 2G conductors with architectures and properties tailored for specific applications and operating conditions. For ac applications conductor and coil design can be geared towards low hysteretic losses. For applications which experience high frequency ac fields, the stabilizer needs to be adjusted for low eddy current losses. For these applications a stainless-steel laminate is used. An example is a Low Pass Filter Inductor which was developed and built in this work.

  20. The decay properties of the trapped magnetic field in HTS bulk superconducting actuator by AC controlled magnetic field

    International Nuclear Information System (INIS)

    Kim, S.B.; Uwani, Y.; Joo, J.H.; Kawamoto, R.; Jo, Y.S.

    2011-01-01

    The electric device applications of a high temperature superconducting (HTS) bulk magnet, having stable levitation and suspension properties according to their strong flux pinning force, have been proposed and developed. We have been investigating a three-dimensional (3-D) superconducting actuator using HTS bulks to develop a non-contract transportation device which moves freely in space. It is certain for our proposed 3-D superconducting actuator to be useful as a transporter used in a clean room where silicon wafers, which do not like mechanical contact and dust, are manufactured. The proposed actuator consists of the trapped HTS bulk as a mover and two-dimensionally arranged electromagnets as a stator. Up to now, the electromagnets consisted with iron core and copper coil were used as a stator, and each electromagnet was individually controlled using DC power supplies. In our previous work, the unstable movement characteristics of HTS bulk were observed under the DC operation, and the AC electromagnets driven with AC controlled current was proposed to solve these problems. In general, the trapped magnetic field in HTS bulk was decayed by a time-varying external magnetic field. Thus, it needs to optimize the shapes of AC electromagnets and operating patterns, the decay properties of the trapped magnetic field in the HTS bulk mover by the AC magnetic field should be cleared. In this paper, the influences of the frequency, the overall operating time, the strength of magnetization field and drive current against the decay of trapped magnetic field were experimentally studied using the fabricated AC electromagnets.

  1. Nontrivial ac spin response in the effective Luttinger model

    International Nuclear Information System (INIS)

    Hu Liangbin; Zhong Jiansong; Hu Kaige

    2006-01-01

    Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before

  2. Variability of Surface pollutants and aerosol concentration over Abu Dhabi, UAE - sources, transport and current levels

    Science.gov (United States)

    Phanikumar, Devulapalli V.; Basha, Ghouse; Ouarda, Taha B. M. J.

    2015-04-01

    pollutants are in contrast with the diurnal pattern of wind speed as evident from the previous observations. Wind rose diagram of pollutants reveal that the dominant source directions are scattered from northwesterly to southwesterly. Our results (2011-13) are compared with earlier observations from the same region (2007-08) and no alarming differences were observed in the pollutant levels. Our observations are discussed in the light of current understanding of pollutants sources over this region.

  3. Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Eriko Kage-Nakadai

    Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

  4. Modeling of lower hybrid current drive (LHCD) and parametric instability (PI) for high performance internal transport barriers (ITBs)

    International Nuclear Information System (INIS)

    Cesario, R.; Cardinali, A.; Castaldo, C.; Paoletti, F.; Challis, C.; Mailloux, J.; Mazon, D.

    2003-01-01

    ITBs (internal transport barrier) with high performance in time duration (4 seconds) were produced at Jet in plasma discharges operating at the plasma current of 2,4 MA and toroidal magnetic field of 3,45 T using lower hybrid (LH) radiofrequency power (2,3 MW) for heating and current drive. The first results of the modeling devoted to calculate the LH power deposition and current density profiles for ITB plasmas are presented. The LH power density profile was first calculated considering the nominal LH power n / spectrum launched by the antenna, a substantially centrally deposition is obtained, many passes (> 10) are necessary for producing a significant fraction of the coupled LH power to be absorbed. In a second step some broadening (20%) of the launched n / power spectrum was considered to simulate the effect of a non-linear wave scattering. Most of the LH power is deposited at the first pass, mainly in the outer half of plasma. The simulation gives a moderate amount (60%) of non-inductive current, including 30% of LHCD fraction. The q-profiles from polarization and from MSE (motional Stark effect) at the beginning and during the main heating phase were analysed. Non-linear plasma edge phenomena allow propagation of some LH power with large n / . Such effect should be retained for a realistic LHCD modeling of ITB plasmas. The consequent enhanced off-axis LHCD is consistent with the observed large ITBs and the obtained large region with low magnetic shear. The LH power might provide a powerful tool for controlling the q-profile for ITB at high plasma current, for potential application to the advanced tokamak regimes

  5. Modeling of lower hybrid current drive (LHCD) and parametric instability (PI) for high performance internal transport barriers (ITBs)

    Energy Technology Data Exchange (ETDEWEB)

    Cesario, R.; Cardinali, A.; Castaldo, C. [Associazione Euratom-ENEA sulla Fusione, Centro Ricerche Frascadi (Italy); Paoletti, F. [PPPL Pinceton (United States); Challis, C.; Mailloux, J. [Euratom-UKAEA fusion association, Culham Science Centre, Abingdon, Oxfordshire, OX (United Kingdom); Mazon, D. [Association Euratom-CEA Cadarache, 13 - Saint-Paul-lez-Durance (France)

    2003-07-01

    ITBs (internal transport barrier) with high performance in time duration (4 seconds) were produced at Jet in plasma discharges operating at the plasma current of 2,4 MA and toroidal magnetic field of 3,45 T using lower hybrid (LH) radiofrequency power (2,3 MW) for heating and current drive. The first results of the modeling devoted to calculate the LH power deposition and current density profiles for ITB plasmas are presented. The LH power density profile was first calculated considering the nominal LH power n{sub /} spectrum launched by the antenna, a substantially centrally deposition is obtained, many passes (> 10) are necessary for producing a significant fraction of the coupled LH power to be absorbed. In a second step some broadening (20%) of the launched n{sub /} power spectrum was considered to simulate the effect of a non-linear wave scattering. Most of the LH power is deposited at the first pass, mainly in the outer half of plasma. The simulation gives a moderate amount (60%) of non-inductive current, including 30% of LHCD fraction. The q-profiles from polarization and from MSE (motional Stark effect) at the beginning and during the main heating phase were analysed. Non-linear plasma edge phenomena allow propagation of some LH power with large n{sub /}. Such effect should be retained for a realistic LHCD modeling of ITB plasmas. The consequent enhanced off-axis LHCD is consistent with the observed large ITBs and the obtained large region with low magnetic shear. The LH power might provide a powerful tool for controlling the q-profile for ITB at high plasma current, for potential application to the advanced tokamak regimes.

  6. Water-induced charge transport in tablets of microcrystalline cellulose of varying density: dielectric spectroscopy and transient current measurements

    International Nuclear Information System (INIS)

    Nilsson, Martin; Alderborn, Goeran; Stroemme, Maria

    2003-01-01

    Room temperature dielectric frequency response data taken over 13 decades in frequency on microcrystalline cellulose (MCC) tablets of varying density are presented. The frequency response shows on three different processes: the first one is a high-frequency relaxation process whose magnitude increases and reaches a plateau as the tablet density increases. This process is associated with orientational motions of local chain segments via glycosidic bonds. The second relaxation process, related to the presence of water in the MCC matrix, is insensitive to changes in tablet density. At lower frequencies, dc-like imperfect charge transport dominates the dielectric spectrum. The dc conductivity was found to decrease with increasing tablet density and increase exponentially with increasing humidity. Transient current measurements indicated that two different ionic species, protons and OH - ions, lied behind the observed conductivity. At ambient humidity of 22%, only one in a billion of the water molecules present in the tablet matrix participated in long range dc conduction. The diffusion coefficient of the protons and OH - ions were found to be of the order of 10 -9 cm 2 /s, which is the same as for small salt building ions in MCC. This shows that ionic drugs leaving a tablet matrix may diffuse in the same manner as the constituent ions of water and, thus, elucidates the necessity to understand the water transport properties of excipient materials to be able to tailor the drug release process from pharmaceutical tablets

  7. Spin-dependent transport and current-induced spin transfer torque in a disordered zigzag silicene nanoribbon

    International Nuclear Information System (INIS)

    Zhou, Benliang; Zhou, Benhu; Liu, Guang; Guo, Dan; Zhou, Guanghui

    2016-01-01

    We study theoretically the spin-dependent transport and the current-induced spin transfer torque (STT) for a zigzag silicene nanoribbon (ZSiNR) with Anderson-type disorders between two ferromagnetic electrodes. By using the nonequilibrium Green's function method, it is predicted that the transport property and STT through the junction depend sensitively on the disorder, especially around the Dirac point. As a result, the conductance decreases and increases for two electrode in parallel and antiparallel configurations, respectively. Due to the disorder, the magnetoresistance (MR) decreases accordingly even within the energy regime for the perfect plateau without disorders. In addition, the conductance versus the relative angle of the magnetization shows a cosine-like behavior. The STT per unit of the bias voltage versus the angle of the magnetization exhibits a sine-like behavior, and versus the Fermi energy is antisymmetrical to the Dirac point and exhibits sharp peaks. Furthermore, the peaks of the STT are suppressed much as the disorder strength increases, especially around the Dirac point. The results obtained here may provide a valuable suggestion to experimentally design spin valve devices based on ZSiNR.

  8. Present status on the ion collective acceleration and high-current beam transport in the Lebedev's Physical Institute USSR

    International Nuclear Information System (INIS)

    Kolomenskij, A.A.

    1982-01-01

    The results of investigations into the ion collective acceleration and transport of high-current electron beams (HCEB) in vacuum channels with dielectric walls (VCDW) are presented. The physical principle of transport is in the partial neutralization of spatial charge of electrons with ions escaped from the prewall plasma and the compression of the beam with its own magnetic field. A problem of obtaining the intensive beams of negative ions in diode with magnetic isolation is considered. The mechanism of ion acceleration in VCDW is considered. It is shown that there are two regions with different mechanisms of acceleration. In the first region (''plasma'') ion acceleration in the quasipotential HCEB field up to energy of the order of the electron energy takes place. In the second region (''beam'') the acceleration takes place in the wave fields that can be excited due to the mechanism of the two-beam type instability. The mechanism of ion acceleration in direct electron beams is considered. This mechanism is based on the concept of relaxation oscillations of the virtual cathode and corresponding the reconstruction of the spatial charge distribution

  9. Spin-dependent transport and current-induced spin transfer torque in a disordered zigzag silicene nanoribbon

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Benliang [Department of Physics and Key Laboratory for Low-Dimensional Quantum Structures and Manipulation (Ministry of Education), Synergetic Innovation Center for Quantum Effects and Applications of Hunan, Hunan Normal University, Changsha 410081 (China); Zhou, Benhu [Department of Physics, Shaoyang University, Shaoyang 422001 (China); Liu, Guang; Guo, Dan [Department of Physics and Key Laboratory for Low-Dimensional Quantum Structures and Manipulation (Ministry of Education), Synergetic Innovation Center for Quantum Effects and Applications of Hunan, Hunan Normal University, Changsha 410081 (China); Zhou, Guanghui, E-mail: ghzhou@hunnu.edu.cn [Department of Physics and Key Laboratory for Low-Dimensional Quantum Structures and Manipulation (Ministry of Education), Synergetic Innovation Center for Quantum Effects and Applications of Hunan, Hunan Normal University, Changsha 410081 (China)

    2016-11-01

    We study theoretically the spin-dependent transport and the current-induced spin transfer torque (STT) for a zigzag silicene nanoribbon (ZSiNR) with Anderson-type disorders between two ferromagnetic electrodes. By using the nonequilibrium Green's function method, it is predicted that the transport property and STT through the junction depend sensitively on the disorder, especially around the Dirac point. As a result, the conductance decreases and increases for two electrode in parallel and antiparallel configurations, respectively. Due to the disorder, the magnetoresistance (MR) decreases accordingly even within the energy regime for the perfect plateau without disorders. In addition, the conductance versus the relative angle of the magnetization shows a cosine-like behavior. The STT per unit of the bias voltage versus the angle of the magnetization exhibits a sine-like behavior, and versus the Fermi energy is antisymmetrical to the Dirac point and exhibits sharp peaks. Furthermore, the peaks of the STT are suppressed much as the disorder strength increases, especially around the Dirac point. The results obtained here may provide a valuable suggestion to experimentally design spin valve devices based on ZSiNR.

  10. The serotonin transporter 5-HTTPR polymorphism is associated with current and lifetime depression in persons with chronic psychotic disorders.

    Science.gov (United States)

    Contreras, J; Hare, L; Camarena, B; Glahn, D; Dassori, A; Medina, R; Contreras, S; Ramirez, M; Armas, R; Munoz, R; Mendoza, R; Raventos, H; Ontiveros, A; Nicolini, H; Palmer, R; Escamilla, M

    2009-02-01

    Variation in the serotonin transporter gene (SLC6A4) promoter region has been shown to influence depression in persons who have been exposed to a number of stressful life events. We evaluated whether genetic variation in 5-HTTLPR, influences current depression, lifetime history of depression and quantitative measures of depression in persons with chronic psychotic disorders. This is an association study of a genetic variant with quantitative and categorical definitions of depression conducted in the southwest US, Mexico and Costa Rica. We analyzed 260 subjects with a history of psychosis, from a sample of 129 families. We found that persons carrying at least one short allele had a statistically significant increased lifetime risk for depressive syndromes (P depression during the course of their illness.

  11. Simulation of charged and excited particle transport in the low-current discharge in argon-mercury mixture

    International Nuclear Information System (INIS)

    Bondarenko, G G; Fisher, M R; Kristya, V I

    2012-01-01

    Simulation of the electron, ion and metastable excited atom transport in the argon-mercury mixture low-current discharge is fulfilled. Distributions of the particle densities along the discharge gap under different mixture temperatures are obtained and it is demonstrated that the principal mechanism of mercury ion generation is the Penning ionization of mercury atoms by argon metastables, which contribution grows sharply with the mixture temperature due to mercury density increase. Calculations show that the mercury and argon ion flow densities near the cathode are of the same order already under the relative mercury content of about 10 −4 corresponding at the argon pressure 10 3 Pa to the mixture temperature 30 C. Therefore, at the room temperature the electrodes of mercury illuminating lamps at the stage of their ignition are sputtered predominantly by mercury ions.

  12. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  13. Alternating current loss characteristics in (bismuth,lead)SCCO and yttrium barium copper oxide superconducting tapes

    Science.gov (United States)

    Nguyen, Doan Ngoc

    Alternating current (AC) loss and current carrying capacity are two of the most crucial considerations in large-scale power applications of high temperature superconducting (HTS) conductors. AC losses result in an increased thermal load for cooling machines, and thus increased operating costs. Furthermore, AC losses can stimulate quenching phenomena or at least decrease the stability margin for superconducting devices. Thus, understanding AC losses is essential for the development of HTS AC applications. The main focus of this dissertation is to make reliable total AC loss measurements and interpret the experimental results in a theoretical framework. With a specially designed magnet, advanced total AC loss measurement system in liquid nitrogen (77 K) has been successfully built. Both calorimetric and electromagnetic methods were employed to confirm the validity of the measured results and to have a more thorough understanding of AC loss in HTS conductors. The measurement is capable of measuring total AC loss in HTS tapes over a wide range of frequency and amplitude of transport current and magnetic field. An accurate phase control technique allows measurement of total AC loss with any phase difference between the transport current and magnetic field by calorimetric method. In addition, a novel total AC loss measurement system with variable temperatures from 30 K to 100 K was successfully built and tested. Understanding the dependence of AC losses on temperature will enable optimization of the operating temperature and design of HTS devices. As a part of the dissertation, numerical calculations using Brandt's model were developed to study electrodynamics and total AC loss in HTS conductors. In the calculations, the superconducting electrical behavior is assumed to follow a power-law model. In general, the practical properties of conductors, including field-dependence of critical current density Jc, n-value and non-uniform distribution of Jc, can be accounted for in

  14. Ac loss measurement of SSC dipole magnets

    International Nuclear Information System (INIS)

    Delchamps, S.; Hanft, R.; Jaffery, T.; Kinney, W.; Koska, W.; Lamm, M.J.; Mazur, P.O.; Orris, D.; Ozelis, J.P.; Strait, J.; Wake, M.

    1992-09-01

    AC losses in full length and 1.5 m model SSC collider dipoles were successfully measured by the direct observation of energy flow into and out of magnets during a ramp cycle. The measurement was performed by using two double-integrating type digital volt meters (DVM's) for current and voltage measurement. Measurements were performed for six is m long ASST magnets and five 1.5 m long model magnets, inducting one 40 mm diameter magnet. There were large variations in the eddy current losses. Since these magnets use conductors with slight deviations in their internal structures and processing of the copper surface depending on the manufacturer, it is likely that there are differences in the contact resistance between strands. Correlation between the ramp rate dependence of the,quench current and the eddy current loss was evident

  15. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  16. 21 CFR 880.5510 - Non-AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is a hydraulic, battery, or mechanically powered device, either fixed or mobile, used to lift and transport a...

  17. Nuclear structure of 231Ac

    International Nuclear Information System (INIS)

    Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.

    2008-01-01

    The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus

  18. Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

    Directory of Open Access Journals (Sweden)

    Evi Ploumpidou

    2017-12-01

    Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

  19. dc Arc Fault Effect on Hybrid ac/dc Microgrid

    Science.gov (United States)

    Fatima, Zahra

    The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.

  20. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez

    2015-01-01

    and DC microgrids, and then investigates the existing and promising solutions for the corresponding challenges. To the authors’ knowledge, three parts of smart grids are required to be developed to facilitate implementation of protection scheme in microgrids. The main requirements and open issues......In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  1. Nuclear transport

    International Nuclear Information System (INIS)

    Anon.

    2003-01-01

    During january and february 2003, a unique event concerning nuclear transport was reported and rated 1 on the INES scale. This event concerns the absence of a maintenance operation on a shipping cask. This shipping cask was used for several years for nuclear transport inside La-hague site before being re-assigned to transport on public thoroughfare. The re-assignment of the cask should have been preceded and conditioned by a maintenance operation whose purpose is to check the efficiency of its radiation shield. During this period 2 on-site inspections concerning the transport of nuclear materials were performed. (A.C.)

  2. Effect of sorbed methanol, current, and temperature on multicomponent transport in nafion-based direct methanol fuel cells.

    Science.gov (United States)

    Rivera, Harry; Lawton, Jamie S; Budil, David E; Smotkin, Eugene S

    2008-07-24

    The CO2 in the cathode exhaust of a liquid feed direct methanol fuel cell (DMFC) has two sources: methanol diffuses through the membrane electrode assembly (MEA) to the cathode where it is catalytically oxidized to CO2; additionally, a portion of the CO2 produced at the anode diffuses through the MEA to the cathode. The potential-dependent CO2 exhaust from the cathode was monitored by online electrochemical mass spectrometry (ECMS) with air and with H2 at the cathode. The precise determination of the crossover rates of methanol and CO2, enabled by the subtractive normalization of the methanol/air to the methanol/H2 ECMS data, shows that methanol decreases the membrane viscosity and thus increases the diffusion coefficients of sorbed membrane components. The crossover of CO2 initially increases linearly with the Faradaic oxidation of methanol, reaches a temperature-dependent maximum, and then decreases. The membrane viscosity progressively increases as methanol is electrochemically depleted from the anode/electrolyte interface. The crossover maximum occurs when the current dependence of the diffusion coefficients and membrane CO2 solubility dominate over the Faradaic production of CO2. The plasticizing effect of methanol is corroborated by measurements of the rotational diffusion of TEMPONE (2,2,6,6-tetramethyl-4-piperidone N-oxide) spin probe by electron spin resonance spectroscopy. A linear inverse relationship between the methanol crossover rate and current density confirms the absence of methanol electro-osmotic drag at concentrations relevant to operating DMFCs. The purely diffusive transport of methanol is explained in terms of current proton solvation and methanol-water incomplete mixing theories.

  3. Bifurcation theory of ac electric arcing

    International Nuclear Information System (INIS)

    Christen, Thomas; Peinke, Emanuel

    2012-01-01

    The performance of alternating current (ac) electric arcing devices is related to arc extinction or its re-ignition at zero crossings of the current (so-called ‘current zero’, CZ). Theoretical investigations thus usually focus on the transient behaviour of arcs near CZ, e.g. by solving the modelling differential equations in the vicinity of CZ. This paper proposes as an alternative approach to investigate global mathematical properties of the underlying periodically driven dynamic system describing the electric circuit containing the arcing device. For instance, the uniqueness of the trivial solution associated with the insulating state indicates the extinction of any arc. The existence of non-trivial attractors (typically a time-periodic state) points to a re-ignition of certain arcs. The performance regions of arcing devices, such as circuit breakers and arc torches, can thus be identified with the regions of absence and existence, respectively, of non-trivial attractors. Most important for applications, the boundary of a performance region in the model parameter space is then associated with the bifurcation of the non-trivial attractors. The concept is illustrated for simple black-box arc models, such as the Mayr and the Cassie model, by calculating for various cases the performance boundaries associated with the bifurcation of ac arcs. (paper)

  4. A nonlinear model for AC induced corrosion

    Directory of Open Access Journals (Sweden)

    N. Ida

    2012-09-01

    Full Text Available The modeling of corrosion poses particular difficulties. The understanding of corrosion as an electrochemical process has led to simple capacitive-resistive models that take into account the resistance of the electrolytic cell and the capacitive effect of the surface potential at the interface between conductors and the electrolyte. In some models nonlinear conduction effects have been added to account for more complex observed behavior. While these models are sufficient to describe the behavior in systems with cathodic protection, the behavior in the presence of induced AC currents from power lines and from RF sources cannot be accounted for and are insufficient to describe the effects observed in the field. Field observations have shown that a rectifying effect exists that affects the cathodic protection potential and this effect is responsible for corrosion in the presence of AC currents. The rectifying effects of the metal-corrosion interface are totally missing from current models. This work proposes a nonlinear model based on finite element analysis that takes into account the nonlinear behavior of the metal-oxide interface and promises to improve modeling by including the rectification effects at the interface.

  5. Coupled-analysis of current transport performance and thermal behaviour of conduction-cooled Bi-2223/Ag double-pancake coil for magnetic sail spacecraft

    Energy Technology Data Exchange (ETDEWEB)

    Nagasaki, Y., E-mail: nagasaki@rish.kyoto-u.ac.jp [Research Institute of Sustainable Humanosphere, Kyoto University, Gokasho, Uji, Kyoto 611-0011 (Japan); Nakamura, T. [Graduate School of Engineering, Kyoto University, Kyotodaigakukatsura, Nishikyo, Kyoto 615-8530 (Japan); Funaki, I. [Institute of Space and Astronautical Science, Japan Aerospace Exploration Agency, Sagamihara, Kanagawa 252-5210 (Japan); Ashida, Y.; Yamakawa, H. [Research Institute of Sustainable Humanosphere, Kyoto University, Gokasho, Uji, Kyoto 611-0011 (Japan)

    2013-09-15

    Highlights: • We model current transport and thermal performances of conduction-cooled HTS coil. • We investigate the effect of the longitudinal inhomogeneity of the HTS tape. • The analysis can precisely estimate performances of the conduction-cooled coil. • The longitudinal inhomogeneity of the HTS tape deteriorates coil performances. • Quench currents of the HTS coil are not consistent with the critical currents. -- Abstract: This paper investigated the quantitative current transport performance and thermal behaviour of a high temperature superconducting (HTS) coil, and the effect of the critical current inhomogeneity along the longitudinal direction of HTS tapes on the coil performances. We fabricated a double-pancake coil using a Bi-2223/Ag tape with a length of 200 m as a scale-down model for a magnetic sail spacecraft. We measured the current transport property and temperature rises during current applications of the HTS coil in a conduction-cooled system, and analytically reproduced the results on the basis of the percolation depinning model and three-dimensional heat balance equation. The percolation depinning model can describe the electric field versus current density of HTS tapes as a function of temperature and magnetic field vector, and we also introduced the longitudinal distribution of the local critical current of the HTS tape into this model. As a result, we can estimate the critical currents of the HTS coil within 10% error for a wide range of the operational temperatures from 45 to 80 K, and temperature rises on the coil during current applications. These results showed that our analysis and conduction-cooled system were successfully realized. The analysis also suggested that the critical current inhomogeneity along the length of the HTS tape deteriorated the current transport performance and thermal stability of the HTS coil. The present study contributes to the characterization of HTS coils and design of a coil system for the

  6. Coupled-analysis of current transport performance and thermal behaviour of conduction-cooled Bi-2223/Ag double-pancake coil for magnetic sail spacecraft

    International Nuclear Information System (INIS)

    Nagasaki, Y.; Nakamura, T.; Funaki, I.; Ashida, Y.; Yamakawa, H.

    2013-01-01

    Highlights: • We model current transport and thermal performances of conduction-cooled HTS coil. • We investigate the effect of the longitudinal inhomogeneity of the HTS tape. • The analysis can precisely estimate performances of the conduction-cooled coil. • The longitudinal inhomogeneity of the HTS tape deteriorates coil performances. • Quench currents of the HTS coil are not consistent with the critical currents. -- Abstract: This paper investigated the quantitative current transport performance and thermal behaviour of a high temperature superconducting (HTS) coil, and the effect of the critical current inhomogeneity along the longitudinal direction of HTS tapes on the coil performances. We fabricated a double-pancake coil using a Bi-2223/Ag tape with a length of 200 m as a scale-down model for a magnetic sail spacecraft. We measured the current transport property and temperature rises during current applications of the HTS coil in a conduction-cooled system, and analytically reproduced the results on the basis of the percolation depinning model and three-dimensional heat balance equation. The percolation depinning model can describe the electric field versus current density of HTS tapes as a function of temperature and magnetic field vector, and we also introduced the longitudinal distribution of the local critical current of the HTS tape into this model. As a result, we can estimate the critical currents of the HTS coil within 10% error for a wide range of the operational temperatures from 45 to 80 K, and temperature rises on the coil during current applications. These results showed that our analysis and conduction-cooled system were successfully realized. The analysis also suggested that the critical current inhomogeneity along the length of the HTS tape deteriorated the current transport performance and thermal stability of the HTS coil. The present study contributes to the characterization of HTS coils and design of a coil system for the

  7. AC ignition of HID lamps

    NARCIS (Netherlands)

    Sobota, A.; Kanters, J.H.M.; Manders, F.; Veldhuizen, van E.M.; Haverlag, M.

    2010-01-01

    Our aim was to examine the starting behaviour of mid-pressure argon discharges in pin-pin (point-to-point) geometry, typically used in HID lamps. We focused our work on AC ignition of 300 and 700 mbar Ar discharges in Philips 70W standard burners. Frequency was varied between 200 kHz and 1 MHz. In

  8. AC loss characteristics of Bi2223/Ag sheathed tape wires subjected to mechanical strains and stresses

    International Nuclear Information System (INIS)

    Tsukamoto, Osami; Li, Z

    2007-01-01

    The influence of uniaxial tensile stress-strain on the AC loss characteristics of multifilamentary Bi2223/Ag sheathed tape wires was investigated. The uniaxial tensile stress-strain was applied to the sample wire in liquid nitrogen at atmospheric pressure, and the AC losses (transport, magnetization and total losses) were measured by an electric method. Two kinds of wire, oxide-dispersion strengthened Ag-alloy sheathed and Ag-alloy sheathed wires, were tested. The stress-strain curves of the tested wires were divided in three regions, i.e. elastic deformation, continuous plastic deformation and serrated-like plastic deformation regions, though the ranges of those regions were different for different kinds of wire. In the elastic and continuous plastic regions, the stress-strain curve was smooth and continuous, and in the serrated-like plastic region, the curve was rough. In the serrated-like plastic region, the wires kept elongating, while increase of the tensile stress was suspended. Dependences of the critical currents on the stress-strain were generally as follows. While decreases of the wire critical currents were in the range of less than 4% of the original values of the no-stress condition, the critical currents of the wires were reversible, that is, the critical currents recovered the original values at zero stress when the stress were released, regardless of whether the wires were in the elastic or continuous plastic region. In the continuous plastic region, the critical currents decreased up to 10%-15% of the original values and the critical currents were irreversible when the degradations of the critical currents exceeded about 4%. In the serrated-like plastic regions, the critical currents were more severely degraded. The AC loss characteristics of the wires are different in those regions. In the elastic and continuous plastic regions, the absolute values of AC losses were dependent on the stress-strain. However, the dependences of those normalized

  9. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

  10. Stretched exponential relaxation and ac universality in disordered dielectrics

    DEFF Research Database (Denmark)

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens

    2007-01-01

    This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are stretc......This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues...

  11. Transport of ions in presence of induced electric field and electrostatic turbulence - Source of ions injected into ring current

    Science.gov (United States)

    Cladis, J. B.; Francis, W. E.

    1985-01-01

    The transport of ions from the polar ionosphere to the inner magnetosphere during stormtime conditions has been computed using a Monte Carlo diffusion code. The effect of the electrostatic turbulence assumed to be present during the substorm expansion phase was simulated by a process that accelerated the ions stochastically perpendicular to the magnetic field with a diffusion coefficient proportional to the energization rate of the ions by the induced electric field. This diffusion process was continued as the ions were convected from the plasma sheet boundary layer to the double-spiral injection boundary. Inward of the injection boundary, the ions were convected adiabatically. By using as input an O(+) flux of 2.8 x 10 to the 8th per sq cm per s (w greater than 10 eV) and an H(+) flux of 5.5 x 10 to the 8th per sq cm per s (w greater than 0.63 eV), the computed distribution functions of the ions in the ring current were found to be in good agreement, over a wide range in L (4 to 8), with measurements made with the ISEE-1 satellite during a storm. This O(+) flux and a large part of the H(+) flux are consistent with the DE satellite measurements of the polar ionospheric outflow during disturbed times.

  12. Design of a high-current low-energy beam transport line for an intense D-T/D-D neutron generator

    International Nuclear Information System (INIS)

    Lu, Xiaolong; Wang, Junrun; Zhang, Yu; Li, Jianyi; Xia, Li; Zhang, Jie; Ding, Yanyan; Jiang, Bing; Huang, Zhiwu; Ma, Zhanwen; Wei, Zheng; Qian, Xiangping; Xu, Dapeng; Lan, Changlin; Yao, Zeen

    2016-01-01

    An intense D-T/D-D neutron generator is currently being developed at the Lanzhou University. The Cockcroft–Walton accelerator, as a part of the neutron generator, will be used to accelerate and transport the high-current low-energy beam from the duoplasmatron ion source to the rotating target. The design of a high-current low-energy beam transport (LEBT) line and the dynamics simulations of the mixed beam were carried out using the TRACK code. The results illustrate that the designed beam line facilitates smooth transportation of a deuteron beam of 40 mA, and the number of undesired ions can be reduced effectively using two apertures.

  13. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  14. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  15. Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.

    Science.gov (United States)

    Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong

    2018-05-01

    Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.

  16. Engineering America's Current and Future Space Transportation Systems: 50 Years of Systems Engineering Innovation for Sustainable Exploration

    Science.gov (United States)

    Dmbacher, Daniel L.; Lyles, Garry M.; McConnaughey, Paul

    2008-01-01

    Over the past 50 years, the National Aeronautics and Space Administration (NASA) has delivered space transportation solutions for America's complex missions, ranging from scientific payloads that expand knowledge, such as the Hubble Space Telescope, to astronauts and lunar rovers destined for voyages to the Moon. Currently, the venerable Space Shuttle, which has been in service since 1981, provides the United States' (U.S.) capability for both crew and heavy cargo to low-Earth orbit to' construct the International Space Station, before the Shuttle is retired in 2010. In the next decade, NASA will replace this system with a duo of launch vehicles: the Ares I Crew Launch Vehicle and the Ares V Cargo Launch Vehicle (Figure 1). The goals for this new system include increased safety and reliability coupled with lower operations costs that promote sustainable space exploration for decades to come. The Ares I will loft the Orion Crew Exploration Vehicle, while the heavy-lift Ares V will carry the Altair Lunar Lander and the equipment and supplies needed to construct a lunar outpost for a new generation of human and robotic space pioneers. This paper will provide details of the in-house systems engineering and vehicle integration work now being performed for the Ares I and planned for the Ares V. It will give an overview of the Ares I system-level test activities, such as the ground vibration testing that will be conducted in the Marshall Center's Dynamic Test Stand to verify the integrated vehicle stack's structural integrity and to validate computer modeling and simulation (Figure 2), as well as the main propulsion test article analysis to be conducted in the Static Test Stand. These activities also will help prove and refine mission concepts of operation, while supporting the spectrum of design and development work being performed by Marshall's Engineering Directorate, ranging from launch vehicles and lunar rovers to scientific spacecraft and associated experiments

  17. Nitrate fate and transport through current and former depressional wetlands in an agricultural landscape, Choptank Watershed, Maryland, United States

    Science.gov (United States)

    Denver, J.M.; Ator, S.W.; Lang, M.W.; Fisher, T.R.; Gustafson, A.B.; Fox, R.; Clune, J.W.; McCarty, G.W.

    2014-01-01

    Understanding local groundwater hydrology and geochemistry is critical for evaluating the effectiveness of wetlands at mitigating agricultural impacts on surface waters. The effectiveness of depressional wetlands at mitigating nitrate (NO3) transport from fertilized row crops, through groundwater, to local streams was examined in the watershed of the upper Choptank River, a tributary of Chesapeake Bay on the Atlantic Coastal Plain. Hydrologic, geochemical, and water quality data were collected from January of 2008 through December of 2009 from surface waters and networks of piezometers installed in and around current or former depressional wetlands of three major types along a gradient of anthropogenic alteration: (1) natural wetlands with native vegetation (i.e., forested); (2) prior-converted croplands, which are former wetlands located in cultivated fields; and (3) hydrologically restored wetlands, including one wetland restoration and one shallow water management area. These data were collected to estimate the orientation of groundwater flow paths and likely interactions of groundwater containing NO3 from agricultural sources with reducing conditions associated with wetlands of different types. Natural wetlands were found to have longer periods of soil saturation and reducing conditions conducive to denitrification compared to the other wetland types studied. Because natural wetlands are typically located in groundwater recharge areas along watershed divides, nitrogen (N) from nearby agriculture was not intercepted. However, these wetlands likely improve water quality in adjacent streams via dilution. Soil and geochemical conditions conducive to denitrification were also present in restored wetlands and prior-converted croplands, and substantial losses of agricultural NO3 were observed in groundwater flowing through these wetland sediments. However, delivery of NO3 from agricultural areas through groundwater to these wetlands resulting in opportunities for

  18. Aperture measurements with AC dipole

    CERN Document Server

    Fuster Martinez, Nuria; Dilly, Joschua Werner; Nevay, Laurence James; Bruce, Roderik; Tomas Garcia, Rogelio; Redaelli, Stefano; Persson, Tobias Hakan Bjorn; CERN. Geneva. ATS Department

    2018-01-01

    During the MDs performed on the 15th of September and 29th of November 2017, we measured the LHC global aperture at injection with a new AC dipole method as well as using the Transverse Damper (ADT) blow-up method used during the 2017 LHC commissioning for benchmarking. In this note, the MD procedure is presented as well as the analysis of the comparison between the two methods. The possible benefits of the new method are discussed.

  19. AC losses in high Tc superconductors

    International Nuclear Information System (INIS)

    Campbell, A.M.

    1998-01-01

    Full text: Although in principle the AC losses in high Tc superconductors can be calculated from the critical current density, a number of complications make this difficult. The Jc is very field dependent, there are intergranular and intragranular critical currents, the material is anisotropic and there is usually a large demagnetising factor. Care must be taken in interpreting electrical measurements since the voltage depends on the position of the contacts. In spite of these complications the simple theory of Norris has proved surprisingly successful and arguments will be presented as to why this is the case. Results on a range of tapes will be compared with theory and numerical methods for predicting losses discussed. Finally a theory for coupling losses will be given for a composite conductor with high resistance barriers round the filaments

  20. System and method for determining stator winding resistance in an AC motor

    Science.gov (United States)

    Lu, Bin [Kenosha, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Theisen, Peter J [West Bend, WI

    2011-05-31

    A system and method for determining stator winding resistance in an AC motor is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of an AC motor. The circuit includes at least one contactor and at least one switch to control current flow and terminal voltages in the AC motor. The system also includes a controller connected to the circuit and configured to modify a switching time of the at least one switch to create a DC component in an output of the system corresponding to an input to the AC motor and determine a stator winding resistance of the AC motor based on the injected DC component of the voltage and current.

  1. The use of radiocarbon to constrain current and future soil organic matter turnover and transport in a temperate forest

    NARCIS (Netherlands)

    Braakhekke, M.C.; Beer, C.; Schrumpf, M.; Ahrens, B.; Hoosbeek, M.R.; Kruijt, B.; Kabat, P.; Reichstein, M.; Ekici, A.

    2014-01-01

    We investigated the merits of radiocarbon measurements for estimating soil organic matter (SOM) turnover and vertical transport for a temperate deciduous forest in Germany. Eleven parameters, defining decomposition and transport in the soil carbon model SOMPROF, were estimated using a Bayesian

  2. A model for calculating the AC losses of second-generation high temperature superconductor pancake coils

    Energy Technology Data Exchange (ETDEWEB)

    Yuan Weijia; Campbell, A M; Coombs, T A [Electronic, Power and Energy Conversion Group, Engineering Department, University of Cambridge, Cambridge CB2 1PZ (United Kingdom)], E-mail: wy215@cam.ac.uk

    2009-07-15

    A model is presented for calculating the AC losses of a stack of second-generation high temperature superconductor tapes. This model takes as a starting point the model of Clem and co-workers for a stack in which each tape carries the same current. It is based on the assumption that the magnetic flux lines lie parallel to the tapes within the part of the stack where the flux has not penetrated. In this paper we allow for the depth of penetration of field to vary across the stack, and use the Kim model to allow for the variation of J{sub c} with B. The model is applied to the cases of a transport current and an applied field. For a transport current the calculated result differs from the Norris expression for a single tape carrying a uniform current and it does not seem possible to define a suitable average J{sub c} which could be used. Our method also gives a more accurate value for the critical current of the stack than other methods. For an applied field the stack behaves as a solid superconductor with the J{sub c} averaged locally over several tapes, but still allowed to vary throughout the stack on a larger scale. For up to about ten tapes the losses rise rapidly with the number of tapes, but in thicker stacks the tapes shield each other and the losses become that of a slab with a field parallel to the faces.

  3. Study of neoclassical transport and bootstrap current for W7-X in the 1/upsilon regime, using results from the PIES code

    International Nuclear Information System (INIS)

    Nemov, V V; Kalyuzhnyj, V N; Kasilov, S V; Drevlak, M; Nuehrenberg, J; Kernbichler, W; Reiman, A; Monticello, D

    2004-01-01

    For the magnetic field of the Wendelstein 7-X (W7-X) standard high-mirror configuration, computed by the PIES code, taking into account real coil geometry, neoclassical transport and bootstrap current are analysed in the 1/upsilon regime using methods based on the integration along magnetic field lines in a given magnetic field. The zero beta and (beta) = 1% cases are studied. The results are compared to the corresponding results for the vacuum magnetic field directly produced by modular coils. A significant advantage of W7-X over a conventional stellarator resulting from reduced neoclassical transport and from reduced bootstrap current follows from the computations although the neoclassical transport is somewhat larger than that previously obtained for the ideal W7-X model configuration

  4. New direct estimates of Iceland-Scotland Overflow Water transport through the Charlie-Gibbs Fracture Zone and its relationship to the North Atlantic Current

    Science.gov (United States)

    Bower, Amy; Furey, Heather; Xu, Xiaobiao

    2015-04-01

    Detailed observations of the pathways, transports and water properties of dense overflows associated with the Atlantic Meridional Overturning Circulation (AMOC) provide critical benchmarks for climate models and mixing parameterizations. A recent two-year time series from eight moorings offers the first long-term simultaneous observations of the hydrographic properties and transport of Iceland-Scotland Overflow Water (ISOW) flowing westward through the Charlie-Gibbs Fracture Zone (CGFZ), a major deep gap in the Mid-Atlantic Ridge (MAR) connecting the eastern and western basins of the North Atlantic. In addition, current meters up to 500-m depth and satellite altimetry allow us to investigate the overlying North Atlantic Current (NAC) as a source of ISOW transport variability. Using the isohaline 34.94 to define the ISOW layer, the two year mean and standard deviation of ISOW transport was -1.7 ± 1.5 Sv, compared to -2.4 ± 3.0 Sv reported by Saunders for a 13-month period in 1988-1989 using the same isohaline. Differences in the two estimates are partly explained by limitations of the Saunders array, but more importantly reflect the strong low-frequency variability in ISOW transport through CGFZ (which includes complete reversals). Both the observations and output from a multi-decadal simulation of the North Atlantic using the Hybrid Coordinate Ocean Model (HYCOM) forced with interannually varying wind and buoyancy fields indicate a strong positive correlation between ISOW transport and the strength of the NAC through the CGFZ. This result raises new questions regarding the interaction of the upper and lower limbs of the AMOC, downstream propagation of ISOW transport variability in the Deep Western Boundary Current and alternative pathways of ISOW across the MAR.

  5. AC impedance electrochemical modeling of lithium-ion positive electrodes

    International Nuclear Information System (INIS)

    Dees, D.; Gunen, E.; Abraham, D.; Jansen, A.; Prakash, J.

    2004-01-01

    Under Department of Energy's Advanced Technology Development Program,various analytical diagnostic studies are being carried out to examine the lithium-ion battery technology for hybrid electric vehicle applications, and a series of electrochemical studies are being conducted to examine the performance of these batteries. An electrochemical model was developed to associate changes that were observed in the post-test analytical diagnostic studies with the electrochemical performance loss during testing of lithium ion batteries. While both electrodes in the lithium-ion cell have been studied using a similar electrochemical model, the discussion here is limited to modeling of the positive electrode. The positive electrode under study has a composite structure made of a layered nickel oxide (LiNi 0.8 Co 0.15 Al 0.05 O 2 ) active material, a carbon black and graphite additive for distributing current, and a PVDF binder all on an aluminum current collector. The electrolyte is 1.2M LiPF 6 dissolved in a mixture of EC and EMC and a Celgard micro-porous membrane is used as the separator. Planar test cells (positive/separator/negative) were constructed with a special fixture and two separator membranes that allowed the placement of a micro-reference electrode between the separator membranes (1). Electrochemical studies including AC impedance spectroscopy were then conducted on the individual electrodes to examine the performance and ageing effects in the cell. The model was developed by following the work of Professor Newman at Berkeley (2). The solid electrolyte interface (SEI) region, based on post-test analytical results, was assumed to be a film on the oxide and an oxide layer at the surface of the oxide. A double layer capacity was added in parallel with the Butler-Volmer kinetic expression. The pertinent reaction, thermodynamic, and transport equations were linearized for a small sinusoidal perturbation (3). The resulting system of differential equations was solved

  6. Novel dielectric reduces corona breakdown in ac capacitors

    Science.gov (United States)

    Loehner, J. L.

    1972-01-01

    Dielectric system was developed which consists of two layers of 25-gage paper separated by one layer of 50-gage polypropylene to reduce corona breakdown in ac capacitors. System can be used in any alternating current application where constant voltage does not exceed 400 V rms. With a little research it could probably be increased to 700 to 800 V rms.

  7. Low ac loss geometries in YBCO coated conductors and impact on conductor stability

    Energy Technology Data Exchange (ETDEWEB)

    Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

    2007-01-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.

  8. AcEST: DK950544 [AcEST

    Lifescience Database Archive (English)

    Full Text Available some 3 SCAF14756, whole genome shot... 77 3e-13 tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste...|A8IF50_9PERC Intestinal peptide transporter OS=Sebastes nebulosus GN=SLC15A1 PE=2 SV=1 Length = 742 Score =

  9. AcEST: DK951699 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8IF50_9PERC Intestinal peptide transporter OS=Sebaste... 93 8e-18 tr|A7ST97|A7ST97_NEMVE Predicted protein (...++D +L KY TI+YLS+ Y Sbjct: 66 ALCYLTPILGAIVADSWLGKYKTIVYLSIVY 96 >tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste

  10. Ac system interruption analysis of an orthogonal-core type dc-ac converter. Koryu keito shadanji no chokko jishinkei dc-ac renkeiyo henkanki no dosa kaiseki

    Energy Technology Data Exchange (ETDEWEB)

    Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College

    1991-04-30

    This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.

  11. Polaron effects on the dc- and ac-tunneling characteristics of molecular Josephson junctions

    Science.gov (United States)

    Wu, B. H.; Cao, J. C.; Timm, C.

    2012-07-01

    We study the interplay of polaronic effect and superconductivity in transport through molecular Josephson junctions. The tunneling rates of electrons are dominated by vibronic replicas of the superconducting gap, which show up as prominent features in the differential conductance for the dc and ac current. For relatively large molecule-lead coupling, a features that appears when the Josephson frequency matches the vibron frequency can be identified with an over-the-gap structure observed by Marchenkov [Nat. Nanotech. 1748-338710.1038/nnano.2007.2182, 481 (2007)]. However, we are more concerned with the weak-coupling limit, where resonant tunneling through the molecular level dominates. We find that certain features involving both Andreev reflection and vibron emission show an unusual shift of the bias voltage V at their maximum with the gate voltage Vg as V˜(2/3)Vg. Moreover, due to the polaronic effect, the ac Josephson current shows a phase shift of π when the bias eV is increased by one vibronic energy quantum ℏωv. This distinctive even-odd effect is explained in terms of the different sign of the coupling to vibrons of electrons and of Andreev-reflected holes.

  12. Bulk-Like Electrical Properties Induced by Contact-Limited Charge Transport in Organic Diodes: Revised Space Charge Limited Current

    KAUST Repository

    Xu, Guangwei; Gao, Nan; Lu, Congyan; Wang, Wei; Ji, Zhuoyu; Bi, Chong; Han, Zhiheng; Lu, Nianduan; Yang, Guanhua; Li, Yuan; Liu, Qi; Li, Ling; Liu, Ming

    2018-01-01

    , the charge transport properties of organic diodes are usually characterized by probing the current–voltage (I–V) curves of the devices. However, to unveil the landscape of the underlying potential/charge distribution, which essentially determines the I

  13. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  14. Current level detector

    International Nuclear Information System (INIS)

    Kerns, C.R.

    1977-01-01

    A device is provided for detecting the current level of a dc signal. It includes an even harmonic modulator to which a reference ac signal is applied. The unknown dc signal acts on the reference ac signal so that the output of the modulator includes an even harmonic whose amplitude is proportional to the unknown dc current. The device may be used to provide overcurrent protection for proportional wire chambers

  15. Effects of clamping force on the water transport and performance of a PEM (proton electrolyte membrane) fuel cell with relative humidity and current density

    International Nuclear Information System (INIS)

    Cha, Dowon; Ahn, Jae Hwan; Kim, Hyung Soon; Kim, Yongchan

    2015-01-01

    The clamping force should be applied to a proton electrolyte membrane (PEM) fuel cell due to its structural characteristics. The clamping force affects the ohmic and mass transport resistances in the PEM fuel cell. In this study, the effects of the clamping force on the water transport and performance characteristics of a PEM fuel cell are experimentally investigated with variations in the relative humidity and current density. The water transport characteristics were analyzed by calculating the net drag coefficient. The ohmic resistance decreased with the increase in the clamping force due to the reduced contact resistance and more even membrane hydration. However, the mass transport resistance increased with the increase in the clamping force due to the gas diffusion layer compression. The net drag coefficient decreased with the increase in the clamping force due to high water back-diffusion. Additionally, the relationship between the total resistance and the net drag coefficient was investigated. - Highlights: • Effects of clamping force on the performance of a PEM fuel cell are investigated. • Water transport characteristics are analyzed using net drag coefficient. • Ohmic resistance decreased with clamping force, but mass transport resistance increased. • Net drag coefficient decreased with the increase in clamping force. • Total resistance was significantly degraded for a net drag coefficient below 0.2.

  16. AcEST: BP913708 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ial protein cyt-4 OS=Neurospora c... 32 1.3 sp|P23975|SC6A2_HUMAN Sodium-dependent nora...drenaline transporter... 30 4.9 sp|O55192|SC6A2_MOUSE Sodium-dependent noradrenaline transporter... 29...+ Sbjct: 237 LLLCLMVVVIVLYFSLWKGVKTSGKVVWITATLPYFV 273 >sp|O55192|SC6A2_MOUSE Sodium-dependent nora...RERHA-------KTLANI 982 Query: 183 N--NKALFQALV 212 + N+ + QALV Sbjct: 983 DGRNELILQALV 994 >sp|P23975|SC6A2_...HUMAN Sodium-dependent noradrenaline transporter OS=Homo sapiens GN=SLC6A2 PE=1 S

  17. Induced AC voltages on pipelines may present a serious hazard

    International Nuclear Information System (INIS)

    Kirkpatrick, E.L.

    1997-01-01

    The problem of induced AC voltages on pipelines has always been with us. Early pipeline construction consisted of bare steel or cast iron pipe, which was very well grounded. Bell and spigot, mechanical, or dresser-style joint couplings often were used, creating electrically discontinuous pipelines which are less susceptible to AC induction. Although induced AC affects any pipeline parallel to a high-voltage alternating current (HVAC) power line, the effects were not noticeable on bare pipelines. With the advent of welded steel pipelines, modern cathodic protection (CP) methods and materials, and the vastly improved quality of protective coatings, induced AC effects on pipelines have become a significant consideration on many pipeline rights-of-way. In the last two to three decades, one has been seeing much more joint occupancy of the same right-of-way by one or more pipelines and power lines. As the cost of right-of-way and the difficulty in acquisition, particularly in urban areas, have risen, the concept of joint occupancy rights-of-way has become more attractive to many utility companies. Federal and state regulations usually insist on joint-use right-of-way when a utility proposes crossing regulated or publicly owned lands, wherever there is an existing easement. Such joint use allows the induced AC phenomena to occur and may create electrical hazards and interference to pipeline facilities. Underground pipelines are especially susceptible if they are well-coated and electrically isolated for CP

  18. Studies of the disruption prevention by ECRH at plasma current rise stage in limiter discharges/Possibility of an internal transport barrier producing under dominating electron transport in the T-10 tokamak

    International Nuclear Information System (INIS)

    Alikaev, V.V.; Borshegovskij, A.A.; Chistyakov, V.V.

    2001-01-01

    'Studies of the Disruption Prevention by ECRH at Plasma Current Rise Stage in Limiter Discharges' - Studies of disruption prevention by means of ECRH in T-10 at the plasma current rise phase in limiter discharges with circular plasma cross-section were performed. Reliable disruption prevention by ECRH at HF power (P HF ) min level equal to 20% of ohmic heating power P OH was demonstrated. m/n=2/1 mode MHD-activity developed before disruption (with characteristic time ∼ 120 ms) can be considered as disruption precursor and can be used in a feedback system. 'Possibility of an Internal Transport Barrier Producing under Dominating Electron Transport in the T-10 Tokamak' - The reversed shear experiments were carried out on T-10 at the HF power up to 1MW. The reversed shear in the core was produced by on-axis ECCD in direction opposite to the plasma current. There are no obvious signs of Internal Transport Barriers formation under condition when high-k turbulence determines the electron transport. (author)

  19. Analytical theory and possible detection of the ac quantum spin Hall effect.

    Science.gov (United States)

    Deng, W Y; Ren, Y J; Lin, Z X; Shen, R; Sheng, L; Sheng, D N; Xing, D Y

    2017-07-11

    We develop an analytical theory of the low-frequency ac quantum spin Hall (QSH) effect based upon the scattering matrix formalism. It is shown that the ac QSH effect can be interpreted as a bulk quantum pumping effect. When the electron spin is conserved, the integer-quantized ac spin Hall conductivity can be linked to the winding numbers of the reflection matrices in the electrodes, which also equal to the bulk spin Chern numbers of the QSH material. Furthermore, a possible experimental scheme by using ferromagnetic metals as electrodes is proposed to detect the topological ac spin current by electrical means.

  20. AcEST: BP921832 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3975|SC6A2_HUMAN Sodium-dependent noradrenaline transporter OS=Homo sapiens Align...lue sp|P23975|SC6A2_HUMAN Sodium-dependent noradrenaline transporter... 31 2.1 sp...|Q6DEL1|S38A7_DANRE Putative sodium-coupled neutral amino acid... 30 4.7 >sp|P23975|SC6A2_HUMAN Sodium-dependent noradrenaline

  1. Longshore currents and associated sediment transport in the nearshore areas of Kerala and Goa, west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Murty, C.S.; Veerayya, M.

    The field observations on the longshore currents at selected locations along the coasts of Goa and Kerala on the western seaboard spanning over a period of five years revealed high variability in their direction and speed. The currents...

  2. Analysis for Heat Transfer in a High Current-Passing Carbon Nanosphere Using Nontraditional Thermal Transport Model.

    Science.gov (United States)

    Hol C Y; Chen, B C; Tsai, Y H; Ma, C; Wen, M Y

    2015-11-01

    This paper investigates the thermal transport in hollow microscale and nanoscale spheres subject to electrical heat source using nontraditional thermal transport model. Working as supercapacitor electrodes, carbon hollow micrometer- and nanometer-sized spheres needs excellent heat transfer characteristics to maintain high specific capacitance, long cycle life, and high power density. In the nanoscale regime, the prediction of heat transfer from the traditional heat conduction equation based on Fourier's law deviates from the measured data. Consequently, the electrical heat source-induced heat transfer characteristics in hollow micrometer- and nanometer-sized spheres are studied using nontraditional thermal transport model. The effects of parameters on heat transfer in the hollow micrometer- and nanometer-sized spheres are discussed in this study. The results reveal that the heat transferred into the spherical interior, temperature and heat flux in the hollow sphere decrease with the increasing Knudsen number when the radius of sphere is comparable to the mean free path of heat carriers.

  3. Nuclear transport

    International Nuclear Information System (INIS)

    Anon.

    2002-01-01

    During September and October 2001, 1 event has been reported and classified at the first level of the INES scale. This incident concerns the violation of the European regulation that imposes to any driver of radioactive matter of being the holder of a certificate asserting that he attended a special training. During this period, 13 in-site inspections have been made in places related to nuclear transport. (A.C.)

  4. High-transport current density up to 30 T in bulk YBa2Cu3O7 and the critical angle effect

    International Nuclear Information System (INIS)

    Ekin, J.W.; Salama, K.; Selvamanickam, V.

    1991-01-01

    Measurements of the dc transport critical current of oriented-grained YBa 2 Cu 3 O 7 have been made using high quality Ag contacts and a high-current sample mount. The critical- current density J c at 77 K for mutually perpendicular current and magnetic field B in the a,b plane is 8 kA/cm 2 at 8 T, decreasing gradually to 3.7 kA/cm 2 at 20 T, and remaining over 1 kA/cm 2 out to 30 T. High magnetic field measurements of J c as a function of the angle θ of B with respect to the c axis are also reported. In contrast to earlier results at lower fields ( c vs θ curve with a head-and-shoulders shape, consisting of a sharp peak (''head'') 2 planes, and a wide (30 degree at 9 T, for example) shoulder region on either side of B perpendicular c, where the transport J c remains high and constant. Beyond the shoulder region, however, the transport J c decreases sharply, giving rise to the concept of a critical field angle for application design, defined by the minima in d 2 J c /dθ 2 at the edge of the shoulders

  5. a.c. conductance study of polycrystal C60

    International Nuclear Information System (INIS)

    Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin

    1995-01-01

    The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))

  6. Colloids: a review of current knowledge with a view to application to phenomena of transportation within PWR

    International Nuclear Information System (INIS)

    Guinard, L.

    1996-01-01

    In an attempt to minimise dosimetry within the primary circuit of PWR units, research is being carried out into understanding the phenomena of transportation and deposition of corrosion products. It is therefore desirable to known the form of these corrosion products and the laws governing this form. It is generally considered that they are in soluble or particulate form. A third starts with a general presentation of colloids and goes on to define points which are useful, both on a theoretical and experimental level, in terms of application to phenomena of transportation within PWRs. (author). 69 refs., 30 figs., 6 tabs., 3 appends

  7. The nature of transport critical current hysteresis in HTSC: magnetic fields and high pressures. [Y-Ba-Cu-O

    Energy Technology Data Exchange (ETDEWEB)

    Svistunov, V M; Yachenko, A.I. d' ; Tarenkov, V Yu [Donetsk Physico-Technical Inst., Ukrainian SSR (USSR)

    1991-12-01

    It was found that pressure has a strong influence on the critical current hysteresis loop of ceramics at H {proportional to} 10 kOe. The phenomenon is attributed to the critical current hysteresis of separate Josephson contacts and is due to the Abrikosov vortex density gradient within granules. The gradient defines both the sign and the value of the pinning current, whereas the sign of Meissner reversible surfaces current component is determined by the external field H direction. As a result the critical current of Josephson contacts defined by the total surface value depends on the magnetic prehistory of a sample. (orig.).

  8. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  9. The AC photovoltaic module is here!

    Science.gov (United States)

    Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.

    1997-02-01

    This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).

  10. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Directory of Open Access Journals (Sweden)

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  11. Theoretical analysis on ac loss properties of two-strand parallel conductors composed of superconducting multifilamentary strands

    CERN Document Server

    Iwakuma, M; Funaki, K

    2002-01-01

    The ac loss properties of two-strand parallel conductors composed of superconducting multifilamentary strands were theoretically investigated. The constituent strands generally need to be insulated and transposed for the sake of uniform current distribution and low ac loss. In case the transposition points deviate from the optimum ones, shielding current is induced according to the interlinkage magnetic flux of the twisted loop enclosed by the insulated strands and the contact resistances at the terminals. It produces an additional ac loss. Supposing a simple situation where a two-strand parallel conductor with one-point transposition is exposed to a uniform ac magnetic field, the basic equations for the magnetic field were proposed and the theoretical expressions of the additional ac losses derived. As a result, the following features were shown. The additional ac loss in the non-saturation case, where the induced shielding current is less than the critical current of a strand, is proportional to the square ...

  12. AcEST: DK950047 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .5 >sp|Q91502|SC6A8_TORMA Creatine transporter OS=Torpedo marmorata PE=2 SV=1 Length = 611 Score = 31.2 bits...n sp|Q91502|SC6A8_TORMA Creatine transporter OS=Torpedo marmorata Align length 44 Score (bit) 31.2 E-value 5...atine transporter OS=Torpedo marmorata ... 31 5.5 sp|Q6P.........................................done Score E Sequences producing significant alignments: (bits) Value sp|Q91502|SC6A8_TORMA Cre... search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q91502 Definitio

  13. Space Charge Modulated Electrical Breakdown of Oil Impregnated Paper Insulation Subjected to AC-DC Combined Voltages

    Directory of Open Access Journals (Sweden)

    Yuanwei Zhu

    2018-06-01

    Full Text Available Based on the existing acknowledgment that space charge modulates AC and DC breakdown of insulating materials, this investigation promotes the related investigation into the situations of more complex electrical stress, i.e., AC-DC combined voltages. Experimentally, the AC-DC breakdown characteristics of oil impregnated paper insulation were systematically investigated. The effects of pre-applied voltage waveform, AC component ratio, and sample thickness on AC-DC breakdown characteristics were analyzed. After that, based on an improved bipolar charge transport model, the space charge profiles and the space charge induced electric field distortion during AC-DC breakdown were numerically simulated to explain the differences in breakdown characteristics between the pre-applied AC and pre-applied DC methods under AC-DC combined voltages. It is concluded that large amounts of homo-charges are accumulated during AC-DC breakdown, which results in significantly distorted inner electric field, leading to variations of breakdown characteristics of oil impregnated paper insulation. Therefore, space charges under AC-DC combined voltages must be considered in the design of converter transformers. In addition, this investigation could provide supporting breakdown data for insulation design of converter transformers and could promote better understanding on the breakdown mechanism of insulating materials subjected to AC-DC combined voltages.

  14. Self-field AC losses in Bi-2223 superconducting tapes

    International Nuclear Information System (INIS)

    Mueller, K. H.; Leslie, K.E.

    1996-01-01

    Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed

  15. Integrated Application of Active Controls (IAAC) technology to an advanced subsonic transport project: Current and advanced act control system definition study. Volume 2: Appendices

    Science.gov (United States)

    Hanks, G. W.; Shomber, H. A.; Dethman, H. A.; Gratzer, L. B.; Maeshiro, A.; Gangsaas, D.; Blight, J. D.; Buchan, S. M.; Crumb, C. B.; Dorwart, R. J.

    1981-01-01

    The current status of the Active Controls Technology (ACT) for the advanced subsonic transport project is investigated through analysis of the systems technical data. Control systems technologies under examination include computerized reliability analysis, pitch axis fly by wire actuator, flaperon actuation system design trade study, control law synthesis and analysis, flutter mode control and gust load alleviation analysis, and implementation of alternative ACT systems. Extensive analysis of the computer techniques involved in each system is included.

  16. Critical conducting networks in disordered solids: ac universality from topological arguments

    DEFF Research Database (Denmark)

    Milovanov, A.V.; Juul Rasmussen, Jens

    2001-01-01

    This paper advocates an unconventional description of charge transport processes in disordered solids, which brings together the ideas of fractal geometry, percolation theory, and topology of manifolds. We demonstrate that the basic features of ac conductivity in disordered materials as seen...... in various experiments are reproduced with remarkable accuracy by the conduction properties of percolating fractal networks near the threshold of percolation. The universal character of ac conductivity in three embedding dimensions is discussed in connection with the available experimental data. An important...

  17. Suppression of roll-off characteristics of organic light-emitting diodes by narrowing current injection/transport area to 50 nm

    Energy Technology Data Exchange (ETDEWEB)

    Hayashi, Kyohei, E-mail: k-hayashi@bioorg.rcast.u-tokyo.ac.jp; Inoue, Munetomo; Yoshida, Kou [Center for Organic Photonics and Electronics Research (OPERA), Kyushu University, 744 Motooka, Nishi, Fukuoka 819-0395 (Japan); Nakanotani, Hajime [Center for Organic Photonics and Electronics Research (OPERA), Kyushu University, 744 Motooka, Nishi, Fukuoka 819-0395 (Japan); JST, ERATO, Adachi Molecular Exciton Engineering Project, c/o OPERA, Kyushu University, 744 Motooka, Nishi, Fukuoka 819-0395 (Japan); Innovative Organic Device Laboratory, Institute of Systems, Information Technologies and Nanotechnologies (ISIT), 744 Motooka, Nishi, Fukuoka 819-0395 (Japan); Mikhnenko, Oleksandr; Nguyen, Thuc-Quyen, E-mail: quyen@chem.ucsb.edu, E-mail: adachi@cstf.kyushu-u.ac.jp [Center for Polymers and Organic Solids, University of California, Santa Barbara, California 93106-9510 (United States); Adachi, Chihaya, E-mail: quyen@chem.ucsb.edu, E-mail: adachi@cstf.kyushu-u.ac.jp [Center for Organic Photonics and Electronics Research (OPERA), Kyushu University, 744 Motooka, Nishi, Fukuoka 819-0395 (Japan); JST, ERATO, Adachi Molecular Exciton Engineering Project, c/o OPERA, Kyushu University, 744 Motooka, Nishi, Fukuoka 819-0395 (Japan); Innovative Organic Device Laboratory, Institute of Systems, Information Technologies and Nanotechnologies (ISIT), 744 Motooka, Nishi, Fukuoka 819-0395 (Japan); International Institute for Carbon Neutral Energy Research (WPI-I2CNER), Kyushu University, 744 Motooka, Nishi, Fukuoka 819-0395 (Japan)

    2015-03-02

    Using e-beam nanolithography, the current injection/transport area in organic light-emitting diodes (OLEDs) was confined into a narrow linear structure with a minimum width of 50 nm. This caused suppression of Joule heating and partial separation of polarons and excitons, so the charge density where the electroluminescent efficiency decays to the half of the initial value (J{sub 0}) was significantly improved. A device with a narrow current injection width of 50 nm exhibited a J{sub 0} that was almost two orders of magnitude higher compared with that of the unpatterned OLED.

  18. Magnetic hysteresis and complex susceptibility as measures of ac losses in a multifilamentary NbTi superconductor

    International Nuclear Information System (INIS)

    Goldfarb, R.B.; Clark, A.F.

    1985-01-01

    Magnetization and ac susceptibility of a standard NbTi superconductor were measured as a function of longitudinal dc magnetic field. The ac-field-amplitude and frequency dependences of the complex susceptibility are examined. The magnetization is related to the susceptibility by means of a theoretical derivation based on the field dependence of the critical current density. Hysteresis losses, obtained directly from dc hysteresis loops and derived theoretically from ac susceptibility and critical current density, were in reasonable agreement

  19. Current and new developments in transport and regulatory issues concerning radioisotopes: managing change for minimum business impact

    International Nuclear Information System (INIS)

    Bennett, Neil; Coppell, David; Rogers, David; Schrader, John

    2004-01-01

    Changes in the regulatory framework governing the Radiation Processing Industry have the potential to make a real business impact on day-to-day profitability. Many areas of the Radiation Processing Industry are affected by changes in the regulatory framework within which these areas are managed. When planning for such changes the transportation element in the shipment of sealed cobalt radiation sources is an area that is often neglected by some parts of the distribution chain. A balance must be struck between the cobalt supplier and the facility operator/customer that rests upon how much the customer needs to know about the intricacies of cobalt shipment. The objective of this paper is to highlight areas of possible business impact and reassure the users of sealed radiation sources that the global suppliers of these products are used to negotiating local variations in regulations governing the physical transportation of radiation sources, changes in regulations governing the design, manufacture and use of transportation containers and changes in the availability of commercial shippers and shipping routes. The major suppliers of industrial quantities of cobalt-60 are well placed to lead their customers through this complex process as a matter of routine

  20. Indoor Air Pollution in Non Ac Passenger Bus

    Science.gov (United States)

    El Husna, Iksiroh; Unzilatirrizqi, Rizal D. Yan El; Karyanto, Yudi; Sunoko, Henna R.

    2018-02-01

    Passenger buses have been one of favorite means of transportation in Indonesia due to its affordability and flexibility. Intensity of human activities during the trip in the buses have a potential of causing indoor air pollution (polusi udara dalam ruang; PUDR). The indoor air pollution has an impact of 1000-time bigger than outdoor air pollution (polusi udara luar ruang; PULR) on lung. This study aimed to find out indoor air pollution rate of non air conditioned buses using an approach to biological agent pollutant source. The study applied an analysis restricted to microorganisms persistence as one of the sources of the indoor air pollution. The media were placed in different parts of the non AC buses. This study revealed that fungs were found in the non AC buses. They became contaminants and developed pathogenic bacteria that caused air pollution.